(data stored in ACNUC7421 zone)

EMBL: CP001359

ID   CP001359; SV 1; circular; genomic DNA; STD; PRO; 5029329 BP.
XX
AC   CP001359; ABKC01000000-ABKC01000075;
XX
PR   Project:PRJNA20095;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 4)
XX
DE   Anaeromyxobacter dehalogenans 2CP-1 chromosome, complete genome.
XX
KW   .
XX
OS   Anaeromyxobacter dehalogenans 2CP-1
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales;
OC   Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
XX
RN   [1]
RP   1-5029329
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Saunders E., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Beliaev A.S., Richardson P.;
RT   "Complete sequence of Anaeromyxobacter dehalogenans 2CP-1";
RL   Unpublished.
XX
RN   [2]
RP   1-5029329
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Saunders E., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Beliaev A.S., Richardson P.;
RT   ;
RL   Submitted (07-JAN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; d8597afaabe487dc585204e2fee26fa3.
DR   BioSample; SAMN00000050.
DR   EnsemblGenomes-Gn; A2cp1_R0001.
DR   EnsemblGenomes-Gn; A2cp1_R0002.
DR   EnsemblGenomes-Gn; A2cp1_R0003.
DR   EnsemblGenomes-Gn; A2cp1_R0004.
DR   EnsemblGenomes-Gn; A2cp1_R0005.
DR   EnsemblGenomes-Gn; A2cp1_R0006.
DR   EnsemblGenomes-Gn; A2cp1_R0007.
DR   EnsemblGenomes-Gn; A2cp1_R0008.
DR   EnsemblGenomes-Gn; A2cp1_R0009.
DR   EnsemblGenomes-Gn; A2cp1_R0010.
DR   EnsemblGenomes-Gn; A2cp1_R0011.
DR   EnsemblGenomes-Gn; A2cp1_R0012.
DR   EnsemblGenomes-Gn; A2cp1_R0013.
DR   EnsemblGenomes-Gn; A2cp1_R0014.
DR   EnsemblGenomes-Gn; A2cp1_R0015.
DR   EnsemblGenomes-Gn; A2cp1_R0016.
DR   EnsemblGenomes-Gn; A2cp1_R0017.
DR   EnsemblGenomes-Gn; A2cp1_R0018.
DR   EnsemblGenomes-Gn; A2cp1_R0019.
DR   EnsemblGenomes-Gn; A2cp1_R0020.
DR   EnsemblGenomes-Gn; A2cp1_R0021.
DR   EnsemblGenomes-Gn; A2cp1_R0022.
DR   EnsemblGenomes-Gn; A2cp1_R0023.
DR   EnsemblGenomes-Gn; A2cp1_R0024.
DR   EnsemblGenomes-Gn; A2cp1_R0025.
DR   EnsemblGenomes-Gn; A2cp1_R0026.
DR   EnsemblGenomes-Gn; A2cp1_R0027.
DR   EnsemblGenomes-Gn; A2cp1_R0028.
DR   EnsemblGenomes-Gn; A2cp1_R0029.
DR   EnsemblGenomes-Gn; A2cp1_R0030.
DR   EnsemblGenomes-Gn; A2cp1_R0031.
DR   EnsemblGenomes-Gn; A2cp1_R0032.
DR   EnsemblGenomes-Gn; A2cp1_R0033.
DR   EnsemblGenomes-Gn; A2cp1_R0034.
DR   EnsemblGenomes-Gn; A2cp1_R0035.
DR   EnsemblGenomes-Gn; A2cp1_R0036.
DR   EnsemblGenomes-Gn; A2cp1_R0037.
DR   EnsemblGenomes-Gn; A2cp1_R0038.
DR   EnsemblGenomes-Gn; A2cp1_R0039.
DR   EnsemblGenomes-Gn; A2cp1_R0040.
DR   EnsemblGenomes-Gn; A2cp1_R0041.
DR   EnsemblGenomes-Gn; A2cp1_R0042.
DR   EnsemblGenomes-Gn; A2cp1_R0043.
DR   EnsemblGenomes-Gn; A2cp1_R0044.
DR   EnsemblGenomes-Gn; A2cp1_R0045.
DR   EnsemblGenomes-Gn; A2cp1_R0046.
DR   EnsemblGenomes-Gn; A2cp1_R0047.
DR   EnsemblGenomes-Gn; A2cp1_R0048.
DR   EnsemblGenomes-Gn; A2cp1_R0049.
DR   EnsemblGenomes-Gn; A2cp1_R0050.
DR   EnsemblGenomes-Gn; A2cp1_R0051.
DR   EnsemblGenomes-Gn; A2cp1_R0052.
DR   EnsemblGenomes-Gn; A2cp1_R0053.
DR   EnsemblGenomes-Gn; A2cp1_R0054.
DR   EnsemblGenomes-Gn; A2cp1_R0055.
DR   EnsemblGenomes-Gn; A2cp1_R0056.
DR   EnsemblGenomes-Gn; A2cp1_R0057.
DR   EnsemblGenomes-Gn; A2cp1_R0058.
DR   EnsemblGenomes-Gn; A2cp1_R0059.
DR   EnsemblGenomes-Gn; EBG00001020257.
DR   EnsemblGenomes-Gn; EBG00001020258.
DR   EnsemblGenomes-Gn; EBG00001020259.
DR   EnsemblGenomes-Gn; EBG00001020260.
DR   EnsemblGenomes-Gn; EBG00001020261.
DR   EnsemblGenomes-Gn; EBG00001020262.
DR   EnsemblGenomes-Gn; EBG00001020263.
DR   EnsemblGenomes-Gn; EBG00001020264.
DR   EnsemblGenomes-Gn; EBG00001020265.
DR   EnsemblGenomes-Gn; EBG00001020266.
DR   EnsemblGenomes-Gn; EBG00001020267.
DR   EnsemblGenomes-Gn; EBG00001020268.
DR   EnsemblGenomes-Gn; EBG00001020269.
DR   EnsemblGenomes-Gn; EBG00001020270.
DR   EnsemblGenomes-Gn; EBG00001020271.
DR   EnsemblGenomes-Gn; EBG00001020272.
DR   EnsemblGenomes-Gn; EBG00001020273.
DR   EnsemblGenomes-Gn; EBG00001020274.
DR   EnsemblGenomes-Gn; EBG00001020275.
DR   EnsemblGenomes-Gn; EBG00001020276.
DR   EnsemblGenomes-Gn; EBG00001020277.
DR   EnsemblGenomes-Gn; EBG00001020278.
DR   EnsemblGenomes-Gn; EBG00001020279.
DR   EnsemblGenomes-Gn; EBG00001020280.
DR   EnsemblGenomes-Gn; EBG00001020281.
DR   EnsemblGenomes-Gn; EBG00001020282.
DR   EnsemblGenomes-Gn; EBG00001020283.
DR   EnsemblGenomes-Gn; EBG00001020284.
DR   EnsemblGenomes-Gn; EBG00001020285.
DR   EnsemblGenomes-Gn; EBG00001020286.
DR   EnsemblGenomes-Gn; EBG00001020287.
DR   EnsemblGenomes-Gn; EBG00001020288.
DR   EnsemblGenomes-Gn; EBG00001020289.
DR   EnsemblGenomes-Gn; EBG00001020290.
DR   EnsemblGenomes-Gn; EBG00001020291.
DR   EnsemblGenomes-Gn; EBG00001020292.
DR   EnsemblGenomes-Gn; EBG00001020293.
DR   EnsemblGenomes-Gn; EBG00001020294.
DR   EnsemblGenomes-Gn; EBG00001020295.
DR   EnsemblGenomes-Gn; EBG00001020296.
DR   EnsemblGenomes-Gn; EBG00001020297.
DR   EnsemblGenomes-Gn; EBG00001020298.
DR   EnsemblGenomes-Gn; EBG00001020299.
DR   EnsemblGenomes-Gn; EBG00001020300.
DR   EnsemblGenomes-Gn; EBG00001020301.
DR   EnsemblGenomes-Gn; EBG00001020302.
DR   EnsemblGenomes-Gn; EBG00001020303.
DR   EnsemblGenomes-Gn; EBG00001020304.
DR   EnsemblGenomes-Gn; EBG00001020305.
DR   EnsemblGenomes-Gn; EBG00001020306.
DR   EnsemblGenomes-Gn; EBG00001020307.
DR   EnsemblGenomes-Gn; EBG00001020308.
DR   EnsemblGenomes-Gn; EBG00001020309.
DR   EnsemblGenomes-Gn; EBG00001020310.
DR   EnsemblGenomes-Gn; EBG00001020311.
DR   EnsemblGenomes-Gn; EBG00001020312.
DR   EnsemblGenomes-Gn; EBG00001020313.
DR   EnsemblGenomes-Gn; EBG00001020314.
DR   EnsemblGenomes-Gn; EBG00001020315.
DR   EnsemblGenomes-Gn; EBG00001020316.
DR   EnsemblGenomes-Gn; EBG00001020317.
DR   EnsemblGenomes-Gn; EBG00001020318.
DR   EnsemblGenomes-Gn; EBG00001020319.
DR   EnsemblGenomes-Tr; A2cp1_R0001-1.
DR   EnsemblGenomes-Tr; A2cp1_R0002-1.
DR   EnsemblGenomes-Tr; A2cp1_R0003-1.
DR   EnsemblGenomes-Tr; A2cp1_R0004-1.
DR   EnsemblGenomes-Tr; A2cp1_R0005-1.
DR   EnsemblGenomes-Tr; A2cp1_R0006-1.
DR   EnsemblGenomes-Tr; A2cp1_R0007-1.
DR   EnsemblGenomes-Tr; A2cp1_R0008-1.
DR   EnsemblGenomes-Tr; A2cp1_R0009-1.
DR   EnsemblGenomes-Tr; A2cp1_R0010-1.
DR   EnsemblGenomes-Tr; A2cp1_R0011-1.
DR   EnsemblGenomes-Tr; A2cp1_R0012-1.
DR   EnsemblGenomes-Tr; A2cp1_R0013-1.
DR   EnsemblGenomes-Tr; A2cp1_R0014-1.
DR   EnsemblGenomes-Tr; A2cp1_R0015-1.
DR   EnsemblGenomes-Tr; A2cp1_R0016-1.
DR   EnsemblGenomes-Tr; A2cp1_R0017-1.
DR   EnsemblGenomes-Tr; A2cp1_R0018-1.
DR   EnsemblGenomes-Tr; A2cp1_R0019-1.
DR   EnsemblGenomes-Tr; A2cp1_R0020-1.
DR   EnsemblGenomes-Tr; A2cp1_R0021-1.
DR   EnsemblGenomes-Tr; A2cp1_R0022-1.
DR   EnsemblGenomes-Tr; A2cp1_R0023-1.
DR   EnsemblGenomes-Tr; A2cp1_R0024-1.
DR   EnsemblGenomes-Tr; A2cp1_R0025-1.
DR   EnsemblGenomes-Tr; A2cp1_R0026-1.
DR   EnsemblGenomes-Tr; A2cp1_R0027-1.
DR   EnsemblGenomes-Tr; A2cp1_R0028-1.
DR   EnsemblGenomes-Tr; A2cp1_R0029-1.
DR   EnsemblGenomes-Tr; A2cp1_R0030-1.
DR   EnsemblGenomes-Tr; A2cp1_R0031-1.
DR   EnsemblGenomes-Tr; A2cp1_R0032-1.
DR   EnsemblGenomes-Tr; A2cp1_R0033-1.
DR   EnsemblGenomes-Tr; A2cp1_R0034-1.
DR   EnsemblGenomes-Tr; A2cp1_R0035-1.
DR   EnsemblGenomes-Tr; A2cp1_R0036-1.
DR   EnsemblGenomes-Tr; A2cp1_R0037-1.
DR   EnsemblGenomes-Tr; A2cp1_R0038-1.
DR   EnsemblGenomes-Tr; A2cp1_R0039-1.
DR   EnsemblGenomes-Tr; A2cp1_R0040-1.
DR   EnsemblGenomes-Tr; A2cp1_R0041-1.
DR   EnsemblGenomes-Tr; A2cp1_R0042-1.
DR   EnsemblGenomes-Tr; A2cp1_R0043-1.
DR   EnsemblGenomes-Tr; A2cp1_R0044-1.
DR   EnsemblGenomes-Tr; A2cp1_R0045-1.
DR   EnsemblGenomes-Tr; A2cp1_R0046-1.
DR   EnsemblGenomes-Tr; A2cp1_R0047-1.
DR   EnsemblGenomes-Tr; A2cp1_R0048-1.
DR   EnsemblGenomes-Tr; A2cp1_R0049-1.
DR   EnsemblGenomes-Tr; A2cp1_R0050-1.
DR   EnsemblGenomes-Tr; A2cp1_R0051-1.
DR   EnsemblGenomes-Tr; A2cp1_R0052-1.
DR   EnsemblGenomes-Tr; A2cp1_R0053-1.
DR   EnsemblGenomes-Tr; A2cp1_R0054-1.
DR   EnsemblGenomes-Tr; A2cp1_R0055-1.
DR   EnsemblGenomes-Tr; A2cp1_R0056-1.
DR   EnsemblGenomes-Tr; A2cp1_R0057-1.
DR   EnsemblGenomes-Tr; A2cp1_R0058-1.
DR   EnsemblGenomes-Tr; A2cp1_R0059-1.
DR   EnsemblGenomes-Tr; EBT00001623186.
DR   EnsemblGenomes-Tr; EBT00001623188.
DR   EnsemblGenomes-Tr; EBT00001623193.
DR   EnsemblGenomes-Tr; EBT00001623194.
DR   EnsemblGenomes-Tr; EBT00001623196.
DR   EnsemblGenomes-Tr; EBT00001623198.
DR   EnsemblGenomes-Tr; EBT00001623200.
DR   EnsemblGenomes-Tr; EBT00001623201.
DR   EnsemblGenomes-Tr; EBT00001623204.
DR   EnsemblGenomes-Tr; EBT00001623205.
DR   EnsemblGenomes-Tr; EBT00001623208.
DR   EnsemblGenomes-Tr; EBT00001623210.
DR   EnsemblGenomes-Tr; EBT00001623211.
DR   EnsemblGenomes-Tr; EBT00001623213.
DR   EnsemblGenomes-Tr; EBT00001623215.
DR   EnsemblGenomes-Tr; EBT00001623216.
DR   EnsemblGenomes-Tr; EBT00001623218.
DR   EnsemblGenomes-Tr; EBT00001623220.
DR   EnsemblGenomes-Tr; EBT00001623222.
DR   EnsemblGenomes-Tr; EBT00001623224.
DR   EnsemblGenomes-Tr; EBT00001623226.
DR   EnsemblGenomes-Tr; EBT00001623229.
DR   EnsemblGenomes-Tr; EBT00001623231.
DR   EnsemblGenomes-Tr; EBT00001623233.
DR   EnsemblGenomes-Tr; EBT00001623235.
DR   EnsemblGenomes-Tr; EBT00001623237.
DR   EnsemblGenomes-Tr; EBT00001623239.
DR   EnsemblGenomes-Tr; EBT00001623244.
DR   EnsemblGenomes-Tr; EBT00001623247.
DR   EnsemblGenomes-Tr; EBT00001623249.
DR   EnsemblGenomes-Tr; EBT00001623250.
DR   EnsemblGenomes-Tr; EBT00001623252.
DR   EnsemblGenomes-Tr; EBT00001623255.
DR   EnsemblGenomes-Tr; EBT00001623256.
DR   EnsemblGenomes-Tr; EBT00001623258.
DR   EnsemblGenomes-Tr; EBT00001623262.
DR   EnsemblGenomes-Tr; EBT00001623265.
DR   EnsemblGenomes-Tr; EBT00001623268.
DR   EnsemblGenomes-Tr; EBT00001623271.
DR   EnsemblGenomes-Tr; EBT00001623273.
DR   EnsemblGenomes-Tr; EBT00001623275.
DR   EnsemblGenomes-Tr; EBT00001623277.
DR   EnsemblGenomes-Tr; EBT00001623279.
DR   EnsemblGenomes-Tr; EBT00001623282.
DR   EnsemblGenomes-Tr; EBT00001623284.
DR   EnsemblGenomes-Tr; EBT00001623287.
DR   EnsemblGenomes-Tr; EBT00001623289.
DR   EnsemblGenomes-Tr; EBT00001623290.
DR   EnsemblGenomes-Tr; EBT00001623293.
DR   EnsemblGenomes-Tr; EBT00001623295.
DR   EnsemblGenomes-Tr; EBT00001623297.
DR   EnsemblGenomes-Tr; EBT00001623299.
DR   EnsemblGenomes-Tr; EBT00001623301.
DR   EnsemblGenomes-Tr; EBT00001623303.
DR   EnsemblGenomes-Tr; EBT00001623305.
DR   EnsemblGenomes-Tr; EBT00001623307.
DR   EnsemblGenomes-Tr; EBT00001623309.
DR   EnsemblGenomes-Tr; EBT00001623311.
DR   EnsemblGenomes-Tr; EBT00001623312.
DR   EnsemblGenomes-Tr; EBT00001623313.
DR   EnsemblGenomes-Tr; EBT00001623314.
DR   EnsemblGenomes-Tr; EBT00001623315.
DR   EnsemblGenomes-Tr; EBT00001623316.
DR   EuropePMC; PMC3416602; 22752177.
DR   EuropePMC; PMC4184826; 25280065.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP001359.
DR   SILVA-SSU; CP001359.
DR   StrainInfo; 301903; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID:  4003799
CC   Source DNA and bacteria available from Alexander S. Beliaev
CC   (alex.beliaev@pnl.gov)
CC   Contacts: Alexander S. Beliaev (alex.beliaev@pnl.gov)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5029329
FT                   /organism="Anaeromyxobacter dehalogenans 2CP-1"
FT                   /strain="2CP-1"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Anaeromyxobacter dehalogenans"
FT                   /db_xref="taxon:455488"
FT                   /culture_collection="ATCC:BAA-258"
FT                   /type_material="type strain of Anaeromyxobacter
FT                   dehalogenans"
FT   gene            248..1624
FT                   /locus_tag="A2cp1_0001"
FT   CDS_pept        248..1624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: ank:AnaeK_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63362"
FT                   /db_xref="GOA:B8J6Y1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Y1"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACL63362.1"
FT                   /translation="MEAPASALVETPLDDLWSRIDGFLRARCREDLYERWFEPLRPVSL
FT                   DEGRLQIGAPDKFHRDFVEDNYRGWFEEFIPELTGERLRIAFAVDDAPRPIGAAAAPAP
FT                   AAVAAARAPEPHLDPRDSRPNPRYAFDTFVVGASNHFAFAAAQAVAANPGRTWNPLFLH
FT                   GDSGLGKTHLLHAVAHAILEKSGGRVAIVSSERYTNDFVAALSKGTMDEFRRKYRECSA
FT                   LLVDDVQFLAGKDKTAEEFFHTFNELHDHHVQIVLSSDRSPKELKGLDERLCSRFEWGM
FT                   RVQIEVPEFETRAAILQKKADVEKIDLPDDVTQLLAQHIRSNVRELEGALMRLAAFASL
FT                   KSEPITVPLARDVLADVIPPPGYRPPIEKIQEAVAGHYGLTVAKLTSASREQKIAFPRQ
FT                   VAMYLCRELAKEKFQSIAEKFNKKDHTTVIAAVDRVKGLLESDDAVRTAVAQLSAKLAP
FT                   "
FT   gene            2042..3169
FT                   /locus_tag="A2cp1_0002"
FT   CDS_pept        2042..3169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ank:AnaeK_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63363"
FT                   /db_xref="GOA:B8J6Y2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Y2"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACL63363.1"
FT                   /translation="MELKIGAQELAKALGRSQGIVEKKSTMPILSHVLLEAKKGDQLVV
FT                   SATDLDLAVSSEHACEVLKEGAVAVSARHLYEIVRALPEQTVTLKKAHNNYLEVKSGPS
FT                   EFRIVGLPAEDFPALPRFDKVPFAPVDPALLLEMIERTFFAVSNDETRYNLNGVYFEPA
FT                   GDALRLVATDGHRLSLSERAVGATFGLKRGVILPKKGLAELKKLLAEAAESGEEQPEAK
FT                   LGFVENSAIFRRPNVVLVMRLIEGLFPDYKQVIPKAGEKVFKVGRGRFLETLRRISLLS
FT                   SDKAHAVKLDLSKDLLRVLSQNPDLGEAKEEVPVEYAGEPLKIGFNARYIMEVLQAVKS
FT                   NEVVFELADDLSPGVLKGGEEADQGFTAVVMPMRI"
FT   gene            3353..4471
FT                   /locus_tag="A2cp1_0003"
FT   CDS_pept        3353..4471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: ank:AnaeK_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63364"
FT                   /db_xref="GOA:B8J6Y3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J6Y3"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACL63364.1"
FT                   /translation="MKLLSLHVQDFRNLAAVELAPSPRATVLLGENGQGKTNLLEAIYF
FT                   LTTLKPLRAVRLAELVRFGAEQGAVAGDFEGPGGVRRVAVQVAAGGRTATLDGKALGSG
FT                   ARLDDYFEGLASVCFSPDDLLLVKAGPDGRRRFLDRAAFNRWPAVLGEAREYVRALRAR
FT                   NAALRAGPAEVEASFREPLVRAGARILVRRRDLVAELAPRLQAAFAEISGPAAPEAHLA
FT                   YRAAGGVDVEHPEAEVAARLAHALEARLERDREKGFTSAGPHMDDLVLALGGKGARLYG
FT                   SQGQQRALVLALKIAEIENLRAALGRPPLLLLDDVSSELDPAKNRFLLGYLAALPAQAF
FT                   LTSTDRRLIEPAAGPDTAFFEVRSGVVSPLVS"
FT   gene            4659..7046
FT                   /locus_tag="A2cp1_0004"
FT   CDS_pept        4659..7046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: ank:AnaeK_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63365"
FT                   /db_xref="GOA:B8J6Y4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Y4"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACL63365.1"
FT                   /translation="MLEGLEAVRKRPHMYIGDVGARGLHHLVYEVVDNSVDEAMAGRAN
FT                   EINVAIHADNSITVLDNGSGIPIGPHPTVKGMDTLDVVLTKLHAGGKFESNAYKVSGGL
FT                   HGVGVTCVNALSEWLKAEVYRDGKVWAQRYERGTPAGKVTAIGETQRRGTRITFKPDAT
FT                   IFEVTEYSFETLSGRLRELAFLNAGLKITIEDERHGKKHEFLFKDGIREFVAFLNKSRE
FT                   VLFQPPIALRQEVETERGAALVEIALQWNDGYDEKVFAFANNIHNHEGGTHLIGFKAAL
FT                   TRTINAYGQKNNLFKDLKDELPSGDDMREGLAAVISVRLPGASFEGQTKTKLSNTEAKS
FT                   MVETMLNERLSAFLEENPNVAKRICGKVAEAARARIAARKARETVRRKGALDSASLPGK
FT                   LADCQSRDPKESELYLVEGDSAGGSAKQGRDRRTQAILPLRGKILNVEKARFDKMLGSA
FT                   EIATIITALGTGIGPEEFDVEKIRYHKIVIMTDADVDGSHIRTLLLTFFFRQMPSVIER
FT                   GLVYIAQPPLFRVAKGKKESYLKDEAALDEYLLALGTDRTRLVAGDTVIEGRDLARLAR
FT                   DAIAYRALLARVDRRRDSRIVDAAIQLGDLDLDLLKHHEQVKEQVQKIFDKAQKLHPEL
FT                   QVRIAKIERDEEHGCDALVYQTSMAGAPRDTRLDHDYLSGAEWGELAALHAAIAELGPG
FT                   PFRLETPEGAEEVLDVFEAVEAVKKAAGQGQTIQRYKGLGEMNPEQLWETTMDPARRTM
FT                   LQVRVDDTVEADEVFSILMGDAVEPRREFIEKHALDVQNLDI"
FT   gene            7060..8055
FT                   /locus_tag="A2cp1_0005"
FT   CDS_pept        7060..8055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0005"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: ank:AnaeK_0005
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III; PFAM:
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63366"
FT                   /db_xref="GOA:B8J6Y5"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Y5"
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /protein_id="ACL63366.1"
FT                   /translation="MPRAAIVALGTHVPDRVVTNEELTKHMETTDAWIQERTGIQERRW
FT                   VREGTGNSDLALEATKKALDKAGWKPTDIEAIVYASLSPDHMFPGDGCFLNAKLGIPGV
FT                   PAIDIRNQCTGFLYGLSVADAWIRTGMYKRVLLVGSEVHSTGLDVTTRGRDVAVIFGDG
FT                   AGAALLEATDDPNRGVLSCHLHADGRFARDLFTDAPGSIYHPRVQPRMLDDASIFPHME
FT                   GQKVFKHAVVRMPEVLKEAFDKNGVGPQDLKVLVPHQANLRIAQMVQRSLGLRDDQVFN
FT                   NIQRYGNTTAASIPLALAEAVEARGVARGDLVGLCAFGAGFTWASALVRW"
FT   gene            8147..8220
FT                   /locus_tag="A2cp1_R0001"
FT                   /note="tRNA-Gln1"
FT   tRNA            8147..8220
FT                   /locus_tag="A2cp1_R0001"
FT                   /product="tRNA-Gln"
FT   gene            8265..8786
FT                   /locus_tag="A2cp1_0006"
FT   CDS_pept        8265..8786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0006"
FT                   /product="peptidase zinc-dependent"
FT                   /note="PFAM: peptidase zinc-dependent; KEGG: ank:AnaeK_0006
FT                   peptidase zinc-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63367"
FT                   /db_xref="GOA:B8J6Y6"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Y6"
FT                   /inference="protein motif:PFAM:PF07998"
FT                   /protein_id="ACL63367.1"
FT                   /translation="MAAPSHVLLIGLGNVGPKTLAEAAQALRDVYALASKAGPSLDRPQ
FT                   YAFNKDRGQYHAPAIVRRLAALRAGAGGAPVLGVVDVDLFLPDAAYVLGDADRDAGAAV
FT                   YSVSRLGAADPALARRRIQVEAVHGVGHLLGLSHCLDFRCAMFLSRDAADSDRKGPGLC
FT                   ASCRASLARP"
FT   gene            8783..9586
FT                   /locus_tag="A2cp1_0007"
FT   CDS_pept        8783..9586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63368"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Y7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0007"
FT                   /protein_id="ACL63368.1"
FT                   /translation="MKSLCQRDGMSCGACCGLYNAEDLSRPALHAELGRRTRALREVER
FT                   TPAAFRAAAAALAGGGPSPMFPSVRVCPLLGFLDEAETRVGCLAHPAANGGVDLRDCGV
FT                   YDVATCDAFLCPSHAWLSEEEAAIAAAACDDYHLYGLVITDVEFVRAALAGVAVRAGAR
FT                   VERRHLEHGPFRAALRELFALKEELAPGSDGLFGAFRPGADGEPVARRIDYEALGRAGG
FT                   SPYDRILTCVGADPRSGNDLEALEAEVRRRLDACAAVFGGTRPAG"
FT   gene            complement(9583..11718)
FT                   /locus_tag="A2cp1_0008"
FT   CDS_pept        complement(9583..11718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0008"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: HEAT domain containing protein; protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; KEGG: ank:AnaeK_0008 protein of unknown function
FT                   DUF224 cysteine-rich region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63369"
FT                   /db_xref="GOA:B8J6Y8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Y8"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACL63369.1"
FT                   /translation="MNPALTSAMLLVAAAVFTFTMTRRVMPLFALRRDVRTDRPGERIR
FT                   ALLRFGLGQRRLVDPEERRPGLLHVVIFAAFLVLAIRTVTMFGMGFSAGFHLPLLAPDS
FT                   GLGRAYGLVKDVMVLLALFAVLGFLWRRLVTRPDRVTRSTEGVVILFFIAGLMITDVLF
FT                   DGALHLLREDPLGLGDLLAGAGFELPAPRFDWLAPAGSLGAALYHASGASAGTVSAVGE
FT                   ASFWLHLALILVFGNVLPYGKHFHIITGLPNVFFARLPPAGALRKLDLEAEDASYGAAT
FT                   VKDLSWKEAWDVYSCTECGRCQTHCPTYVTGKPLSHKEVNRSIRHHLAEVAPALTALAR
FT                   AKDPAVREAAAGALPPISEVIPPETFWACTTCGWCETACPVLIENVPRLVDMRRQAVQV
FT                   DSVFPDEAQRVFKGIETQGNPWGIGSNKRTEWCEDLAVPRAADGGDYEWLFFVGCAGAF
FT                   DDRQKKVSRAIVRILREAKVSFAILGEEETCTGDAARRLGNEYLFQMQATALTETLNGH
FT                   GVKKILVQCPHCLNSIANELPQFGGRYEVVHHAELIARLVKDGRLAPGVAEGLGQVTFH
FT                   DPCYLARWNGVTEAPREALAAAGVQVAEMPRNRRQGFCCGAGGGRFWLEEKLGARVNQN
FT                   RVDEAAATLGKAGGVIATGCPFCLTMMKDGVNETGREETLRVLDVAEIVALGLPKRAES
FT                   APAAAPEHTPAAPQGEA"
FT   sig_peptide     complement(11662..11718)
FT                   /locus_tag="A2cp1_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.724 at
FT                   residue 19"
FT   gene            complement(11834..12877)
FT                   /locus_tag="A2cp1_0009"
FT   CDS_pept        complement(11834..12877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63370"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Y9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0009"
FT                   /protein_id="ACL63370.1"
FT                   /translation="MKRTLAILAPLAIAASGCVVATPVPSEPPPVAMPAPAPAPPLQVW
FT                   YYGEHFVPDAFGGGWCYEPGAHWHDYYPDQPSAYVLDGGYYFYRGPLVFTYWEGHPVPG
FT                   GGWCYVRGPHRHDYYPPRGNDWQWRRGHGWAYRGHWRPERPPPAAYWPSRPAPYPSRPA
FT                   PAPAPYPGRPAPAPYPGRPAPAPAPAPYPDRPYPGRPPPAPAPAPLPAPAPAPAPYPGR
FT                   PVPAPAPAPVPDDRGRRDDAPGHGNLPPGHGGTPPGQAAPSAPAYPAPGRGNDRGNVQP
FT                   PGHGGTPPGRAAPAPAPAPAPRDDARGGGNGQGRRDDKNDKADNGKKDDRKARQQDDLK
FT                   DRRFQRL"
FT   sig_peptide     complement(12812..12877)
FT                   /locus_tag="A2cp1_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 22"
FT   gene            complement(13207..13875)
FT                   /locus_tag="A2cp1_0010"
FT   CDS_pept        complement(13207..13875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0010"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: ank:AnaeK_0010 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63371"
FT                   /db_xref="GOA:B8J6Z0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Z0"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ACL63371.1"
FT                   /translation="MSPNFRHAQPVTLVLYEDPLSPWCLVAERRILTALEDVEGAFGAL
FT                   QLEPFPTRLEPRAMTKAERRALARAARKAAREPEAAAITDDLWLSPDPPLTSIPALTAL
FT                   AAARLQGPSREAALRHAIREASLVRGLNVARTDVLLELAERAGLDLHRFAGALAAPATE
FT                   RRVRAVHESAFDKGIRGAPALVIGDEWLVTGPRSVDEYRTVLQRYASARLGLAPLKTLH
FT                   "
FT   gene            complement(13994..14977)
FT                   /locus_tag="A2cp1_0011"
FT   CDS_pept        complement(13994..14977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0011"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   PFAM: protein of unknown function DUF201; RimK domain
FT                   protein ATP-grasp; KEGG: ank:AnaeK_0011 alpha-L-glutamate
FT                   ligase, RimK family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63372"
FT                   /db_xref="GOA:B8J6Z1"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Z1"
FT                   /inference="protein motif:TFAM:TIGR00768"
FT                   /protein_id="ACL63372.1"
FT                   /translation="MPPGKKTARAKRAAARPRPDGELGVAILSRNPRLYSTRRLVEAAT
FT                   ALGHAPRVLDTLRCNMVLARDRPRIFYLGEEVVASDVHVVIPRIGASITGYGVAVVNQF
FT                   DLMGVPVLAAATPIGRSRDKLRALQLLSRFGIDIPRTVMCRYREEVPEAVQMVGGLPCI
FT                   IKLIQGSQGVGVMIANTEVEVRGLLDTLWTLGQEILLQELVAESKGRDVRALVVGDRVV
FT                   AAMRRTARAGEFRSNIHRGGVAEALELGREYAETAVKAARVMGLEVAGVDMLEARTGPK
FT                   IMEVNSSPGFEGLEAATGLDIAALYVRHAVDFASTRQSGYASGHLA"
FT   gene            15100..17940
FT                   /locus_tag="A2cp1_0012"
FT   CDS_pept        15100..17940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0012"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   ank:AnaeK_0012 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63373"
FT                   /db_xref="GOA:B8J6Z2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Z2"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ACL63373.1"
FT                   /translation="MDSKYSVNLPKTDFPMKANLPQREPEILRQWEEQAIFQRLVAQNA
FT                   GRPGAKRFVLHDGPPYANGDIHIGHALNKILKDVVVKYRNLNGEVADYIPGWDCHGLPI
FT                   ELKVDKELGPKKRELDRPAIIEACRKYAQKWIEKQRESFKRLGVFGRWETPYATMSRGY
FT                   EAEIVRTFARAAEKGFLYRGKKPVYWCITDRTALAEAEVEYEQHRSPSIYVAFDLVSAL
FT                   PDPKLAGRPARLVIWTTTPWTLPANLAVAAHPDFTYVAYDLNGQVVVVAKDLLAAFLAD
FT                   VAPGELSVSDVPAPHSPPAHEAATGGGGTVLAPQLAHPERVLAHLDGSALEGLRYRHPF
FT                   LDRESQVILGDHVTLEAGTGLVHTAPGHGQEDYVVGLRYGLEVLNPVDGAGRFTERAGK
FT                   YAGKKIFEANPEIVADLHASGHLLSDPKASLEHSYPHCWRCHNPVVFRATDQWFLSLEH
FT                   ADLRKATLAEIDRVRWIPHWGRERIHNMIENRPDWCVSRQRTWGVPIPVFYCEGCNEAL
FT                   LSPPVMERVAAAFEAEGMEAWYRHPPADFTAGAACPKCGKTEFRREQDILDVWWDSGVS
FT                   WAAVIEREGLELPVDLYLEGSDQHRGWFHSSLLTSMALRGAAPYRAVLTHGFILDQHGK
FT                   AMSKSAGNGIEPSEIIKKYGADILRLWVSASDYRDDIGLGDQILAGLAEGYRKIRNTIR
FT                   YALGALDGFDPARDAVPEAELEPIDRWALARLAAWDEKVAKAYEDYEFHLAYHATMQFC
FT                   AVELSALYFDVIKDRLYTWKADGRQRRSAQTALHAIAQDLIRLLAPILSFTASEAWTYL
FT                   PGRPTESVWLAGLPRRARPADADALEARYGKLFEVRGVVQSKLEEARRAKLIGSGLEAM
FT                   VTVRAEGEQRRLLEEARAELPTLFIVSKVVLADGPLSAEVARAPGVKCERCWIYAEDVG
FT                   RDAAHPTLCAKCVGNL"
FT   gene            17940..18560
FT                   /locus_tag="A2cp1_0013"
FT   CDS_pept        17940..18560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0013"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: ank:AnaeK_0013
FT                   lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63374"
FT                   /db_xref="GOA:B8J6Z3"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Z3"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ACL63374.1"
FT                   /translation="MRRPVSKWALLALLFAALLAADQWTKYLAVERLTVVFERGGDETL
FT                   AERVRGFYTYRHLEPLSTEPYYVWRPVWRMNYVENPGAAWGLFRGHSQLFRNAFFTLVS
FT                   LAAVAFILHYYRKLRQDQRYLQVALALVLAGAVGNFVDRLARRYVIDFVEWYWWNRPDL
FT                   RWPTFNVADSLIVVGVAMLVLHPGSKREAARAPERRGAAAERV"
FT   sig_peptide     17940..18002
FT                   /locus_tag="A2cp1_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.831 at
FT                   residue 21"
FT   gene            18573..19478
FT                   /locus_tag="A2cp1_0014"
FT   CDS_pept        18573..19478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0014"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: ank:AnaeK_0014 prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63375"
FT                   /db_xref="GOA:B8J6Z4"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Z4"
FT                   /inference="protein motif:PFAM:PF01790"
FT                   /protein_id="ACL63375.1"
FT                   /translation="MLPVLFRIPLPGGASLPLHTYGLLIAVGFMVGIWLAQREAARRGQ
FT                   DPRRLADLAFWILVAALVGSRVYYMLVNPGDFFSPARFLVATPFGRIPRVLAVWQGGLV
FT                   FYGGFIGAALTAAWYLRRHRMGFLEHADTLIPSVALGHFFGRLGCFGAGCCWGDVAHGH
FT                   LPWAARFPPESLAFQSFADRPDPGQYLAPDRLSTLPLHPTQLYEAFGELGLFLLLVIVV
FT                   RPRKRFHGQVLSAWLMLYAVLRTGVEAFRGDVERGVILGLGVGQWTSLVIFAAGAAVWA
FT                   RARRSGAVGAGAAAAPAGGR"
FT   gene            19512..20252
FT                   /locus_tag="A2cp1_0015"
FT   CDS_pept        19512..20252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63376"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Z5"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0015"
FT                   /protein_id="ACL63376.1"
FT                   /translation="MALPPQKPGRPAGPPPSAEEAARAARHATDELTDETAKLEEELEA
FT                   LKARYEQYFLGTERREPAHWRDEVRKKVLRLKGAFTRNTGLRFRIQSLHARYLSYERLW
FT                   QRSVREREEGTYRRDLLKARRHAREAEGTPAAAAASATPAPGSASASPRVESPAAVARP
FT                   SATPPPAPSAAGGDEARMRALYDAYISAKKQCHEDVSRLSYDVVARSVAKQVPEVMARF
FT                   KAKSVDFRVEVKDGKAILKAIPRV"
FT   gene            20489..20881
FT                   /locus_tag="A2cp1_0016"
FT   CDS_pept        20489..20881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63377"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Z6"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0016"
FT                   /protein_id="ACL63377.1"
FT                   /translation="MRALLPSIAAVLLCAACGRSDADARRARLGAERRALEATLDHLED
FT                   RLIVNQARVRFWKEMQSRHESVTAVACTSQEEHAIEMARHVLPGEPARRAGRRASTERA
FT                   SIDRARVAAAPNAPSPAPARTAAAAP"
FT   sig_peptide     20489..20557
FT                   /locus_tag="A2cp1_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.977 at
FT                   residue 23"
FT   gene            21040..21112
FT                   /locus_tag="A2cp1_R0002"
FT                   /note="tRNA-Phe1"
FT   tRNA            21040..21112
FT                   /locus_tag="A2cp1_R0002"
FT                   /product="tRNA-Phe"
FT   gene            complement(21051..22295)
FT                   /locus_tag="A2cp1_0017"
FT   CDS_pept        complement(21051..22295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0017"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mag:amb1491
FT                   integrase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63378"
FT                   /db_xref="GOA:B8J6Z7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Z7"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACL63378.1"
FT                   /translation="MGEHLFRKSCQKNGWYYGWFYGPDGKRVTRSLRTADRRIARDRLR
FT                   QFEREAHASGGAASNAAPHTVEDTVRFIVEVGCSDRAEGTLEMYAKKGGHLVRVFGDQQ
FT                   VHALSLDKVQDYINQRLGEGAARETVRKELSTLRVALETAKARKLYVGDPRSIFPPFRV
FT                   TYRPRERHLSVEEFGKLLAVLDAKRRRWIMVAVYSGARRSEVEALRWDTHVNLETGWLV
FT                   LPGTKTAKARRSVPILQPLADELASDPSKKGFVVEAWANVGRDLRIACAHAGVARVSPN
FT                   DLRRTFASWMKQQGEDSAVVAKLLGHASTRMVDLVYGRLNDENLRRAVAKLPSVAVPSV
FT                   GSTSEAALGRLVGEEGLLGTGAPPVVAENLPHENQKARQISRSGGPRWCSSSEGVPGAG
FT                   IEPATRGFSVPCSTD"
FT   gene            22434..22580
FT                   /locus_tag="A2cp1_0018"
FT   CDS_pept        22434..22580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63379"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Z8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63379.1"
FT                   /translation="MASAFRSWVGVLAVTGDLLAGAVRWAAGPPGRGNSALTLYCNSAL
FT                   EGS"
FT   gene            complement(22598..23185)
FT                   /locus_tag="A2cp1_0019"
FT   CDS_pept        complement(22598..23185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0019"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; KEGG: sus:Acid_6125
FT                   resolvase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63380"
FT                   /db_xref="GOA:B8J6Z9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B8J6Z9"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACL63380.1"
FT                   /translation="MNNPARIATYHRVSTLDQNASLAREELRGAAARLGGEVVLDMEET
FT                   GSGARNDRPGLQRLMEAARRGKLDAVVVWKLDRFGRSALDVLANIRDLDAAGVRFIAIT
FT                   QGIDIRPGGDAMSRLILGVLASVAEFERDLIRERTKLGIQKARAAGKRIGRPQVARPER
FT                   VQVQRLREEGHSWREVAEALGCSTWAARQVAA"
FT   gene            23340..23780
FT                   /locus_tag="A2cp1_0020"
FT   CDS_pept        23340..23780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63381"
FT                   /db_xref="UniProtKB/TrEMBL:B8J700"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63381.1"
FT                   /translation="MKTIDAKTRAKIARGWAGSSLTQDEYAAKYGISARTLRLYRSRYA
FT                   SRQPPVDQVRAIITGAMQELRDLLDSLDREEPKAACHSVTCTDQKLVEDAGVVGLNDDA
FT                   VNALVASVRAEFAALPEAEEVGSARPRARPGSFFADMDALPR"
FT   gene            23877..24581
FT                   /locus_tag="A2cp1_0021"
FT   CDS_pept        23877..24581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: deb:DehaBAV1_0212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63382"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="UniProtKB/TrEMBL:B8J701"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63382.1"
FT                   /translation="MVSHFIANNEVSPSPTSTPDSTSNDAAARPKTLSERHCQHLVDSG
FT                   LTAETIARRGFYSCSDAEGRKILNWSERVRGNASGLVIPYPNVPGYAKIRPDSPRLRSG
FT                   EWPAPANEPHHDYRVGDARWEPEPEVRKYEAPIGSMPHAYIPVDACASFSDAEVRLYVT
FT                   EGEKKTEVLCQQGQPCISIPGVSNAHDVDHRREAQDWGGARSGSSRRNSASTCFPTARS
FT                   VSCSTRPTWRRT"
FT   gene            24578..26224
FT                   /locus_tag="A2cp1_0022"
FT   CDS_pept        24578..26224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0022"
FT                   /product="ATPase-like protein"
FT                   /note="KEGG: dvl:Dvul_1052 plasmid/phage primase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63383"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8J702"
FT                   /inference="protein motif:COG:COG3378"
FT                   /protein_id="ACL63383.1"
FT                   /translation="MNAIRACIRAARMIKEEGAVPLVGYVPPIPKLEKTGIDDYFVNAQ
FT                   KRSVAYPKSYNPLEGDFADARPVGPNELIEWLVEQKDEAGWERDDVLPELRRAAIWARV
FT                   WHERERRAWHAWTRRAAKTFFVGQDEIEQMVAHLGLAQRDEPKASSWNDFDDGKILEHC
FT                   VPILNHAFRLLVDRNGTERIFQVNDRNEATLQQSNANIHKALHDALKAEFGTVPPARLL
FT                   EASNVLWKKETARLAEEPEPFCFAGDDRVCFKRFDWKPAEAPFPAWEEFLTRLSDREAF
FT                   MAFVWSCFEKKNRSRQYLWLRGEGQDGKSKVLGVLLEVFGPAGAAINNSHVEKGNQFFF
FT                   SALYGKRLVIYPDCKNAKFGMKEIVRNCTSGDPVAVEFKGETPFTTVLRIRLFVASNTK
FT                   PEFTSQAADRSRIIYVEVAESASKDDPTWEERLKAQLPGFLWSCKATYERVCAHHGDIP
FT                   VSEQTKAMLDEAAVAFEEQFHDIFDAHFSEAPGEAAPAKPVATILRGYGMNNNQINDFK
FT                   AWMGRVHRVVYRPRKDGRVYEGLAFLPSSVR"
FT   gene            complement(26455..27756)
FT                   /locus_tag="A2cp1_0023"
FT   CDS_pept        complement(26455..27756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63384"
FT                   /db_xref="UniProtKB/TrEMBL:B8J703"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63384.1"
FT                   /translation="MASRSKRKASFRTVVHESCPIRNTHRRLESAHRLWHEALNNYEDP
FT                   DGFRTFLNSAIQELRNVTFVLQKERFSAPGFDEWYAAWRKRLGESDAARWIVDLRNKVV
FT                   KEGDLDTASLVHVRLLRGYVEAGEFVPFEGPPTASCKEIAVAIAATAPHEVREDGILVV
FT                   ERRWELPDLPGRELLEALASVYGLLSALVSDAHVVAGGSECGLIECDKSAGYAQEFLAG
FT                   RPACMSASQEARTSVVDLKRGRFYVPRTRTIKKGTKKDLERLRAKYESKSAAPPDWKRI
FT                   KDLPLRDQARHLHEVGVQLLRADGYLVHTFHLLRDGKLVRFIGVPRPDEKTDLHVLMWQ
FT                   AIRPEVERTRADALISSNEIWLGTGKSGVRPAEDPNRREAVHTVAADKSGVRFALTTLF
FT                   RREPTGIILERVSEEEQALIPFLEAVFDCWRTFR"
FT   gene            27996..28208
FT                   /locus_tag="A2cp1_0024"
FT   CDS_pept        27996..28208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63385"
FT                   /db_xref="UniProtKB/TrEMBL:B8J704"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63385.1"
FT                   /translation="MATWTIRIDAEEVSVTYREGDKVQHCGNSERVLEAEVVGWVHSEA
FT                   DAFDRLVTPSGIFVRQVEPAGGARS"
FT   gene            28205..28474
FT                   /locus_tag="A2cp1_0025"
FT   CDS_pept        28205..28474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63386"
FT                   /db_xref="UniProtKB/TrEMBL:B8J705"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63386.1"
FT                   /translation="MSAKLKRVGLRPGTRYQTRDAFFTRANEFFILEDFEWVKPLRLDL
FT                   EPGSIGIFEREDGQKIVVRYEDDPRDGDEEQESGIRPTTGVLRR"
FT   gene            complement(29055..30518)
FT                   /locus_tag="A2cp1_0026"
FT   CDS_pept        complement(29055..30518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0026"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: ank:AnaeK_3964
FT                   transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63387"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7P5"
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /protein_id="ACL63387.1"
FT                   /translation="MGGDDHRCEWRERAEALEARLAQVEATLEKLQRHQFGARSEKMPP
FT                   ISEAIRDPAHAEAERIAAQQKRRENAEKKRQLVARKIVHEVREDQKSCPKCGGHEFTPL
FT                   GEGKVTELYELVPARIERQLHVQKKVRCRCGETIITADGPAKVFDKTRFGPTFMAQVAV
FT                   SKCADSLPLYRQAKAYRRTGVEVNDSTLGDLFHRTAELVDPLYERLLHLVAEKEIVLAD
FT                   ETTHRVQAKGKTRTAWIWSFIARDEAERELIAYVFSRSRSGETPVRVLEGTIGKLLVDG
FT                   YEGYNKVTLPGGRERAGCWAHARRKFFDAQSTATAAAKHAMELILELYKIERAALDADL
FT                   LGTPEHLAMRQTRSRVVIDEIRAWLDAVQGRHPPRSPIGVAIGYALGQWNELTLFLTDP
FT                   HLPIDNNASEGALRVCALGRKNFLFVGTDAAGENLAGLYSLIATCEANGINPVDYLADV
FT                   LLRVQTHPASRIDELLPHNWTPPRPEPSA"
FT   gene            complement(30532..30930)
FT                   /locus_tag="A2cp1_0027"
FT   CDS_pept        complement(30532..30930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0027"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: ank:AnaeK_3965
FT                   IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63388"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7P6"
FT                   /inference="protein motif:PFAM:PF05717"
FT                   /protein_id="ACL63388.1"
FT                   /translation="MITIPRSVRIYIGSTPIDMRKSIDGLHAIVQNELAKDAYSGHLFV
FT                   FVSRRWDRVKILTWDKGGFVLVYKRLERGQFKLPHMDPSTMAVEIDATQLAMLLDGIDF
FT                   GRVRRPEHWQPSQSDPQAARPMDKPAPA"
FT   gene            complement(30927..31319)
FT                   /locus_tag="A2cp1_0028"
FT   CDS_pept        complement(30927..31319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63389"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7P7"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3676"
FT                   /protein_id="ACL63389.1"
FT                   /translation="MADQDRSRWTKLVADFESCDLPQREFATERGIPLSNLRYWIYRLR
FT                   KESRPLVSQAPERSDQVPERRAAPEGSRLVPVRVVASAPKARQDTAAAVAADAALELLF
FT                   PSGARLRFTAGTDLAYVRALAAALAS"
FT   gene            31437..31694
FT                   /locus_tag="A2cp1_0029"
FT   CDS_pept        31437..31694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63390"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7P8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63390.1"
FT                   /translation="MSTVVTPVGTFKRVSSQDLKFAVVYVPEDRRRAGQDGFCHGWAVA
FT                   VERAQVLADEVRAKFEAEPLVVAVTCRRRRTERVQRTDEE"
FT   gene            31919..32710
FT                   /locus_tag="A2cp1_0030"
FT   CDS_pept        31919..32710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mar:MAE_23620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63391"
FT                   /db_xref="InterPro:IPR026349"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7P9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63391.1"
FT                   /translation="MPPLPEYPRVLFKKSPLRLVVGQIRFPLQLRLADTAFTAPFQDAL
FT                   ADDYPVAAREQQVAFQVTPKGGLQAAPSETLLRFASRNGDWAVVLGESALTLEVRGYSA
FT                   VEEFSSRFEKVLGAAKERLRLRERSRLGLRYINEFRHDAGRSLADWAKLMNPELLGFAG
FT                   NNLLGGTVEHMAHEVRVRRDDGVLAIRHGLLVGGVVEPIPTAPVAEGRFYLLDMDYYDE
FT                   RPSPLDIAATSRALTAYNDVMYRFFRWSLGESMYKHLEPNE"
FT   gene            32707..33552
FT                   /locus_tag="A2cp1_0031"
FT   CDS_pept        32707..33552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bth:BT_2618 two-component system response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63392"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Q0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63392.1"
FT                   /translation="MSAALATLATGADTGMYRPAHPENENVILAASLWESLYGFLVRAP
FT                   GPRTGQDTMPAPKHTAVRNWFALVDVQTQPTGYGWISAPVLRAYVAEGDPQDLDETDSG
FT                   EQAVSFAAEANVGGPHALDERARPLSTVAVAPEAQAVTRLVTLTGLEMERIASLLGVSR
FT                   TTLYAWRDGSKPRGSKRDHLLQVVAVIEEVARRFGEPRTVAAWLLTPSPASNLMPFDVI
FT                   RERRYELCRGMLTRRRTARPTLPQRAPRRLSATQLREGLDRMSAKPFADDYEPEEEQGD
FT                   "
FT   gene            33556..34392
FT                   /locus_tag="A2cp1_0032"
FT   CDS_pept        33556..34392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO0439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63393"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Q1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63393.1"
FT                   /translation="MAGGGEHAGQQLLARGWRQGALLPARAPVRSTEFAPGVPPQPRDR
FT                   VRDAGDGVLVVASQTCDLARNPASDPEVECLRAFWTSKERIIRPAASNSGRHFLLRERV
FT                   DPDGKKEGLIADATARVLVTKESLLQFAPDQGCANAQTERRFREWLGRRFSRIAIPTAH
FT                   VEAIQRPIVEALKLEDGDESILPLLRGVKEVLFAVGNDAVPFQVHLLFLAEEGLTDDEA
FT                   LSAADSERLGAWFGEALAAAGEAELHDWELVDTGSLSLRDYLAFTPLPLDEYSLEG"
FT   gene            complement(34602..35099)
FT                   /locus_tag="A2cp1_0033"
FT   CDS_pept        complement(34602..35099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0033"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: ank:AnaeK_0019 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63394"
FT                   /db_xref="GOA:B8J7Q2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Q2"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0019"
FT                   /protein_id="ACL63394.1"
FT                   /translation="MDPRFDAMPERRPSALVLHPDVSIRAELGWALGARDMASVSAADG
FT                   ASGLALLLEELLALDALVVKLDLPGRDARAFADLVRRAGGEQELAIVVLASDPSPSLRD
FT                   ELAALGVDEVVDPRLGPGTVADAVIAAVWRRRSGAGAGTRAPRSQRRLRETEGLDTFST
FT                   AA"
FT   gene            complement(35363..36169)
FT                   /locus_tag="A2cp1_0034"
FT   CDS_pept        complement(35363..36169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63395"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Q3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0021"
FT                   /protein_id="ACL63395.1"
FT                   /translation="MSTKTVATLACSLAFGLLLAAPGRAAGQCTSSDVPAGGIFTKLDA
FT                   QGLYSDLFSLTLINLSDAALEGTADINATMAKYSLTYPPGMVRWECAHPPFYKLCSDTE
FT                   LNPNTCQDVTQGFRPAPFTVRVERNDSAIWRGGWANDCYDGKIDFTWRDSTFQLKFKRQ
FT                   KVYGGALAYPHYGTWTTLLPRTGSWCAPGTFCSGVWTTPHDYEMRNITTIAANELVVSL
FT                   YSTDNQNLVVVLRETHWDGAQGDAYDGKRLDWVDNDSPRVPGDCNH"
FT   sig_peptide     complement(36092..36169)
FT                   /locus_tag="A2cp1_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.491 at
FT                   residue 26"
FT   gene            complement(36184..37569)
FT                   /locus_tag="A2cp1_0035"
FT   CDS_pept        complement(36184..37569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63396"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Q4"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0022"
FT                   /protein_id="ACL63396.1"
FT                   /translation="MSRTSRLHVLTLAILLPLAATAQTNYFPYGTAGEMQTDLVTYDGI
FT                   ARTVVVRILNLTPYRIEHTEATSTAYGDQYQVGTTLADVLDRDRLTAKAFFFAPVGVPA
FT                   VIPGVPPEAYTEGYVNTVTRPYEMVFSWNERAGRVEQSRVGWVVRGVQSWVCPPPPLGG
FT                   ECTPRHDDVHLGLWVTRPLDDPGESLYAGFFGSDFLGTLTMAVSVAGVITDPFNPLNWY
FT                   GLFISVADMADPARFEEEQVAPDDGIEMYVASYPIPAPFTRSDPSQDCYLSNNNLVENE
FT                   VAAPSPALPDPRICTPQTVSGTADDGTDAQWADAAGPGASELITTIHVLRGRRYLPHSE
FT                   GGSACAGKWGSVPIVNVTIWTRDQYAASNVAGLAHASLAARPQRDQGAAKLVAEYRKFY
FT                   EKYDRAGLLAIREVVLALDPEAREQLRAAVLTVRSDGVLDKDAHKALHMVIVAARARLT
FT                   DDE"
FT   sig_peptide     complement(37501..37569)
FT                   /locus_tag="A2cp1_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT   gene            37974..39617
FT                   /locus_tag="A2cp1_0036"
FT   CDS_pept        37974..39617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0036"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ank:AnaeK_0023
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63397"
FT                   /db_xref="GOA:B8J7Q5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Q5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL63397.1"
FT                   /translation="MASPGPDRRSRRFLFGGYVVVVASFIAASVYTAEHIREIDVASDE
FT                   IARDAMPTIRCLAEARHLLGQFEIESAAFAAVPVTPAARAAAEAPLRALAEQVGVYLAL
FT                   PLFPGERPFWEDVRRGTSRFVGAANRMLGQADAGDARLARETFLREVRPAAAHLHELLS
FT                   RDLDFNARNGSQLAEHIKAVRARGLWLSLSLGVLCGGIALLAGRVVAGQLRRHDALVSE
FT                   HERMMEERAGELEAFAGRVAHDIMNPTASAQLAIDLELRRRQAAGEPAGEGLERARRSL
FT                   RRIQTLVAGLLGFARAGARPEPGAAADVVEVVHDVVSGAEARATEAGMTVGAELVPGTV
FT                   ACAKGVLTSLVANLVDNAIKYARRDGRVVIRAAPDAAAIRVEVEDDGPGLPPDLGDRVF
FT                   EPYVRGGAGDVPGLGLGLATVKRLAEAHGGHVGVRSEPGRGTTFWFELPRAAAVSELRG
FT                   SRAGSRPAHRARTWLRGPRRSRGRCRRDRGRTRCGGPRADPSAARRWAPPGGAAPRRRR
FT                   PPRRAPRGTRAGPTARPRAWAGRGTGRRAA"
FT   gene            complement(39391..39780)
FT                   /locus_tag="A2cp1_0037"
FT   CDS_pept        complement(39391..39780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0037"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ank:AnaeK_0024
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63398"
FT                   /db_xref="GOA:B8J7Q6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Q6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACL63398.1"
FT                   /translation="MTALQSIRQLDYTVLFARDPERMRRFYAEVMGFPIARELGPGWVE
FT                   FRVGSNLLVLTQRGGLFHDPPTPEGALSVQLAFRVAPSAVDACAEELRRLEVPIVSPPT
FT                   DQPWGHRTLFFRDPDGNVLEIYADL"
FT   gene            39815..40717
FT                   /locus_tag="A2cp1_0038"
FT   CDS_pept        39815..40717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0038"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: ank:AnaeK_0025 helix-turn-helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63399"
FT                   /db_xref="GOA:B8J7Q7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Q7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0025"
FT                   /protein_id="ACL63399.1"
FT                   /translation="MVMPASVAKKVPADAGGGTTTLAARALGDFLRRMRSRPALAVAGG
FT                   GRRRVTGLRREEVAVAANISITWYTWLEQGRPVRTSRRTVRALARALRLGEAEAAHLAR
FT                   LADAVATAAPRWRRTAQASPALRAMVDGFRDAPAYVVNGRWDVLHANAAAGTVLGSFEA
FT                   TPGVTDNVLARLFLDPGWRERFLDWEAVASSAVAQFRAAGGRLVAHPDWNAFVADLAAR
FT                   SPEFARAWESHALADPHLRRKRLAGPGGEPLELLYASFAPEGEPEDVRVVLYVPADDAA
FT                   RGVLARALRPAGPRRRPAR"
FT   gene            40794..42320
FT                   /locus_tag="A2cp1_0039"
FT   CDS_pept        40794..42320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0039"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="KEGG: ank:AnaeK_0026 prolyl-tRNA synthetase;
FT                   TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); Anticodon-binding domain protein;
FT                   Prolyl-tRNA synthetase, class II-like"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63400"
FT                   /db_xref="GOA:B8J7Q8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Q8"
FT                   /inference="protein motif:TFAM:TIGR00408"
FT                   /protein_id="ACL63400.1"
FT                   /translation="MASAETAIRPTRAENFSEWYLEVIKAADLAESSTVRGCMVIKPWG
FT                   YALWEHVQRVLDGMFKATGHVNAYFPLFIPLSLLEKEAAHVEGFAKECAVVTHHRLEAR
FT                   DGKLVPVGELEEPLVVRPTSETIIGESFARWVQSYRDLPLLINQWANVVRWEMRTRMFL
FT                   RTAEFLWQEGHTAHATEQEAIDETMQMLGIYARFAEEWMALPVVQGEKTASERFPGAVR
FT                   TYCIEAMMQDRKALQAGTSHFLGQNFARASGIQFQDEKGALTHAWTTSWGLSTRMIGAM
FT                   IMTHGDDDGMVCPPRLAPQQVVIIPVIQKPEVREQVLAWCAELKRELEAQSYAGAPVRV
FT                   HLDARDVQGAKKSWEWIKKGAPIRLEVGPKDIEKGAVFMGRRDRKPREKQSVPRGELVA
FT                   GVGALLQEIQDALLRRARAVRAEHTRPIDTKDEFYAYFTPPATVRPNDPTPIHGGFALA
FT                   HFSGDPAVEARIKEDLGVTVRCIPLEPGEPGTCPFTGQPSPKRVVWAKSY"
FT   gene            complement(42354..42875)
FT                   /locus_tag="A2cp1_0040"
FT   CDS_pept        complement(42354..42875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63401"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Q9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0028"
FT                   /protein_id="ACL63401.1"
FT                   /translation="MHLASRAAPVVLAVSLVTACAGAREAGRDPPQSLTVRELTVVDAR
FT                   GQPRLRIGAPLPPPKGAERRAVDAFGIQFMDQDGYEVAGLGMLEPVDIRGLCFDIKDAY
FT                   EAMCVGLVKGEPSITFRHDWKERITLGVEKGVASIVLRDAQGEPRVRLEVDPDGKTRVE
FT                   GVAPTAPARP"
FT   sig_peptide     complement(42804..42875)
FT                   /locus_tag="A2cp1_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.575 at
FT                   residue 24"
FT   gene            complement(42964..43577)
FT                   /pseudo
FT                   /locus_tag="A2cp1_0041"
FT   gene            complement(43669..44658)
FT                   /locus_tag="A2cp1_0042"
FT   CDS_pept        complement(43669..44658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0042"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   ank:AnaeK_0030 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63402"
FT                   /db_xref="GOA:B8J7R0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7R0"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL63402.1"
FT                   /translation="MPRPDPFVPPELHVVFGAGQVGRRLARELLALGHRVRLIRRGPPG
FT                   PELPGLRWLSGDAADPLFAGEACRGADVVYDCTNPPDYHRWDELLVPLRRGIRDAAARA
FT                   GARLVALDCLYMYGRPAASPFDEDAPLAPCSHKGELRALLARELLEAHARGDLRATTGR
FT                   ASDFFGPGAGAAALLGDRLAARLRAGKPFEAFGDPDLPHAYSYVADVARGLAVLGTHEA
FT                   ALGRAWHLPVSWTGSTRGLVEAVGAALGRPARLRIVPDWLLRVGGLLDPTLGAAVEMTY
FT                   QWKVPYVPDDRRFRAAFSVEPTPAAEAVAATARAILGAEAPAGRRDAA"
FT   gene            44738..45676
FT                   /locus_tag="A2cp1_0043"
FT   CDS_pept        44738..45676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0043"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ank:AnaeK_0031 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63403"
FT                   /db_xref="GOA:B8J7R1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7R1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL63403.1"
FT                   /translation="MQRPPPAPPAAALDWDHARVLRALLEARSLSGAGARLGVNASTIS
FT                   RRLTALEAALGARLFDRTPDGVLPTALAESLGPHAEAMERAANALALAAQGRELAAEGE
FT                   VRLTAAPGVAEYLLAPALPRLLAAHPGLRLALDATIGYADLTRREADLAIRGVLPASGD
FT                   LLARKLGTATGGVFGAPRQARALGTLRSLDAARWITWGEDLAHLELTRAVLDHVPPERI
FT                   ALRTSHMGTQMAAARAGVGLVLADRNMALACGLAEVRLAPAARRQLPSARAGDLWLVVH
FT                   RALREVPRVAAVWDFVLEEARRLGLSPGHGT"
FT   gene            45847..48078
FT                   /locus_tag="A2cp1_0044"
FT   CDS_pept        45847..48078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0044"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="SMART: Fibronectin type III domain protein; KEGG:
FT                   ank:AnaeK_0032 fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63404"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7R2"
FT                   /inference="protein motif:SMART:SM00060"
FT                   /protein_id="ACL63404.1"
FT                   /translation="MRQPVHRSSRGGLLTPRARGSSRLAPTTAVVFALSAVLVSGCGPD
FT                   EAPTAASALAGDPMPGKIVEPAPAPLPPRFTTQALPVAGEVCVGSAAHDKHAASGIGCT
FT                   ACHPCGGALGFANPVTFPGGTSSANGSVVSDASGTTCSVGCHAPLGAEPHGVSWTAGPL
FT                   QCVTCHTDVGAIDPATALSAHPLPDGSSGTSCQSCHDTSQHLSGEVRMVDGGGGSAAVT
FT                   CAGCHAGQGQTLSGETPPLLVGWDDMASGDFHGDRPGTCRFDALDAAGQRSIGRGAYPC
FT                   PPNQPDQPGAMRITPRWWYANGTSGAWAWTCVLQPVDPAGNPVGAARTGQPCPEGTIQN
FT                   SSCTSNLSSPSCYPTTLVTRGFGGTLLAPYARGQGAIACARCHDFHASNNAFLLAAHVN
FT                   GVAIPPGSIDRAGVGAQVLCTACHQGDRHEVCKACHRERWVTDGSYSWFEGAPADPAPD
FT                   GAACFFCHGHEGIQQMEVTSPVYPPNHPYSTGLPQSACTHCHDGWAPPPTEYVAPRFQA
FT                   GPALSAVTATSATIAWTSSEKATSYVEYGVGTAGHVAGNDAFVVQHSVQLTGLTPGTTY
FT                   VWRVRTSDVFRNVTHTALQSFTTPAEGALSSPDLAPVSASFEVGTYDATVPLVWFPVTA
FT                   AAGVVLQYEVQLASDAAFTYLQNGSLTGPGVPGSTVGSTGWVSGTPTTSGGRPALQVPA
FT                   RILDIPQDWCGPYAPRLYYWRVRVRDQQGHESGWSTPGNFGAFAWDPWC"
FT   gene            complement(48202..50157)
FT                   /locus_tag="A2cp1_0045"
FT   CDS_pept        complement(48202..50157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0045"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: ank:AnaeK_0033
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63405"
FT                   /db_xref="GOA:B8J7R3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7R3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACL63405.1"
FT                   /translation="MRSASLATKLVLALGLAFAVVLGGFTAASAAFTVRTVEQQTADAL
FT                   RGRVALVRDMVGVYDASLARATADLLHVFRASYPEGIRADPSRAAYVEGVALPGLAAGD
FT                   RMVDLDYPTVDRFTATSGAVATVFARAGGDFVRITTSVQTDAGRRAVGTFLGADHPAHR
FT                   RLLEGEPYTGKAVLFGRDFFTRYEPIVQDGKVIGALFVGVDFTDGLAALRERIRGVRAG
FT                   DQGYFFVVDASAGAGRNRLIVHPTRAGEAAPDGLGPALATGSGGAEGLRIAGADAKGAA
FT                   RPEIATCQAFEPWQWLVCGAVPEEELTHDGRRLGLLLSTGGAALVIVLAGLALWLVRRM
FT                   VLEPLARTARFAERVAAGDLASELEIRAGDEVGALGEALNEMVRALRAVVGTLRSASDA
FT                   VAEACQALSASTAQIAEGASEQAAGAETASGATTELAARVRDVAGGAAETEALAARSAA
FT                   SARSGGEAVRRAVAAVQEIAGRTAVIEEIAHQTNLLALNAAIEAARSGVHGRGFAVVAT
FT                   EIRRLAERSRAAAAEIGALGTSTVQAARLAGEALDAVVPDIGRTSELVRGMAVATEEIS
FT                   AGAHEVTGAIGQLDAAIQASASSSEELASTAARLAEEAEALRRSAAWFRTGEPEHDTAP
FT                   ATRAPALPAVSPGRAA"
FT   sig_peptide     complement(50065..50157)
FT                   /locus_tag="A2cp1_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.506 at
FT                   residue 31"
FT   gene            50426..51448
FT                   /locus_tag="A2cp1_0046"
FT   CDS_pept        50426..51448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0046"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: ank:AnaeK_0034 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63406"
FT                   /db_xref="GOA:B8J7R4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7R4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL63406.1"
FT                   /translation="MRRSTALSLTAALAAGAWLAARRLRRRRPLAGGVALVTGGSRGLG
FT                   LVLARELGRRGMRIVLCARDEEELERARSGLAQDGIDATGLPGDVTDEDGTRTLVADVE
FT                   ENLGPVELLVNSAGIIQVGPAEAMSVEDYRHAMDVLFYGALHAAEAVLPGMRARRRGTI
FT                   VNVTSIGAAVGIPHLAPYDAAKFAARGWSEALGAETAKYGVDVITVVPGLMRTGSFGRA
FT                   LVKGRRYAEASLFSLLASLPLVTVSAERAARRIVRAIEHRERFVIIGLPARVLRLAHSL
FT                   MPGAIVATLGFVNRFLPTAAPGERHGIALPAELFRRGLARSILTALGERAARRYNEEPA
FT                   "
FT   sig_peptide     50426..50485
FT                   /locus_tag="A2cp1_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.636 at
FT                   residue 20"
FT   gene            complement(51540..52763)
FT                   /locus_tag="A2cp1_0047"
FT   CDS_pept        complement(51540..52763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0047"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: ank:AnaeK_0035 membrane
FT                   protein involved in aromatic hydrocarbon degradation"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63407"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7R5"
FT                   /inference="protein motif:PFAM:PF03349"
FT                   /protein_id="ACL63407.1"
FT                   /translation="MRKTFRIAFLAVLAAPAVALASGFEVINVNPRDLALSSSGVAAQE
FT                   DAAATFQNPAALSKLSGLNLSLAGSMLSLRTKWTGTAAYPGKETTKFAPTPPVAMYVAY
FT                   GTKLAGRGLGFGLGVGTPGGGQMKWDDQWEGRGRIITVERRMLGFYLNGGYEIAPWLRV
FT                   GGGAIYYEGIQYLKQGIQPFPDAYAELDTKGGGFAYQLSAEVKPLENLTLGFDYKHKGT
FT                   MHMKGDAHFQVPPSLVGPTTQDQDVKQDLTFPNRIDTGLAWRVAKPVLVTLQYSWSRFV
FT                   VYNQDLFEGETTAITVPRDYRNGNVIRGGVEWTALPTLRLRAGMMRDWSGLRTSTLSPT
FT                   LPDSNTTGYSLGAGWDAGADFGLNAAVFYGDRDKQTSTGTAAFPGSYKTDVWIVALGFT
FT                   WRTDLGNR"
FT   sig_peptide     complement(52698..52763)
FT                   /locus_tag="A2cp1_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 22"
FT   gene            complement(52777..55725)
FT                   /locus_tag="A2cp1_0048"
FT   CDS_pept        complement(52777..55725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63408"
FT                   /db_xref="GOA:B8J7R6"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7R6"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0036"
FT                   /protein_id="ACL63408.1"
FT                   /translation="MSLRRYGPPLALAFASLLACTDVKQEKPAPQLVIATFASPNIPTP
FT                   NDLVLQAVPTLPDSAQKELLQSFIDAGGFPSDQEVAITIPFRAVSWNGSAYVETTPPDL
FT                   DPATVTTSTVALLKVDGAPQAVEFEVGSATAGRLVLRKKADASGSRRFAPGRYVVAVRG
FT                   GASGVKTTAAQGAMPVNPDQAIAIAAQNKDLTVHENQPPGLTPALVAQLEAVRKALWSP
FT                   LTWTDVGGRWTASVDTNVAPAFAAVAPTFAPAEVAAIATFGIAPAAAQPLTDSGSGQIP
FT                   LPSTFLLDGTRPANDPPTRFYVRNVPAFGPAAAGLATLDGFSTTGMMLAPLSAPVAAST
FT                   VNAQTVLLFELPEGAGAPRRMRDVAAALGAGQPATAEYLTQPPALNRTVQVGGADVAVT
FT                   TAIGLQPGVAVPVPGVGIVPTPPLKEKRNYAVVITDGVKDLAGNPLKRSTLGNILFTFT
FT                   NPPAVDGVSQLAGVSNADATALATLRAGLEPLLANLGALTGGAVTRDNVVMAYTVQTQT
FT                   VTDVSVGLSALPYQTPTAFVGQGVAPLDLAALGFDAAAQAALFPNVGGFLTAMVPTVDA
FT                   INPANGALNPDTTQWAPKPIPAVVAYPADAACTTATPCARPLVVFHHGLSGGRLQMLTV
FT                   ANSLAAKGFVVAAIDAPYHGDRAFCMENSECTTDGTADGVCTPDQAKAGQGDAIPPGTC
FT                   TTGHLRGTNLSTVASGNYFISGNFFRIRDAIRQDHIDQAALVLAVARPPAPFPQPAQDP
FT                   LAAALFQRGFVVNPTAVHYEGISLGGIIGTELLATNPRFARGVLNVPGGTLVDVFTNAP
FT                   AFATSVNELFLSLGIDRSQIPTNPAVASRYLQTLILAKWILDPAEPLNYAAHVRTKLAS
FT                   PLLAAPPAGMGGTGLVHAATDVLGQLAKCDAVVPNATTVVGGIPLPYGDELLALAGAPS
FT                   TLYVSASAANNCVPHGVLNDTLLPTPIGGQVRDDAAQFLLDLTVPASPATLP"
FT   sig_peptide     complement(55660..55725)
FT                   /locus_tag="A2cp1_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.455 at
FT                   residue 22"
FT   gene            56004..57635
FT                   /locus_tag="A2cp1_0049"
FT   CDS_pept        56004..57635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0049"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: ank:AnaeK_0037
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63409"
FT                   /db_xref="GOA:B8J7R7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7R7"
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /protein_id="ACL63409.1"
FT                   /translation="MNLELLTLAVGAYAAVLAFLGWLGYRRTRSAADYLVGGREIHPVL
FT                   MALAYGSTFISTSAIVGFAGVAALMGMGLLWLTMLNILLGVFVAFVVFGRPTRRLGAAL
FT                   DAHTFPELLGRRYRSRFIQGFAGGTIALLMPLYAAAVLIGGARFLEVQLHLDYQVALFV
FT                   FAAITVGYVLFGGLKGVVYTDAFQAVLMVCGMLVLLVATYAQVGGLSAHQALTDLADQV
FT                   PPALRAQGHRGWTAMPAAGSPLWWQMVSTIVLGVGIGVLAQPQLTVRFMTVKSGRELHR
FT                   ALVPGGLFLLLMAGVAYVVGSLTNLWYFQRTGKIALAIMTDPATGKPNVDRLMPLYTQA
FT                   AMPEWFAYLFMLALLAAAMSTLSAQFHAIGTAIGRDLYEQAFRLGGGAERTVLLARGGI
FT                   LAGFAGTVLLAWNLGPGVIAIATALFFGMCAATFLPAFVSALFWARSTRAGVIAGMLAG
FT                   FAAWALWVLFVHERESAALGVVKALTGRTSLGAGTTWALVDPIVVALPIAALVTVVGSL
FT                   LGRAAPAADAAGPARTEEGGLDAGLR"
FT   sig_peptide     56004..56099
FT                   /locus_tag="A2cp1_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.743) with cleavage site probability 0.280 at
FT                   residue 32"
FT   gene            57619..57780
FT                   /locus_tag="A2cp1_0050"
FT   CDS_pept        57619..57780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63410"
FT                   /db_xref="GOA:B8J7R8"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7R8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0038"
FT                   /protein_id="ACL63410.1"
FT                   /translation="MLGFGDLGVTAAFVLTLASAALCVVYGLLHWNDDDAPLPPPVHPP
FT                   GEAELDDL"
FT   gene            57830..59101
FT                   /locus_tag="A2cp1_0051"
FT   CDS_pept        57830..59101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63411"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7R9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0039"
FT                   /protein_id="ACL63411.1"
FT                   /translation="MRRIRLALAVLAALAALPPAALAQTPPAPPAAPRASAPAPAPAAK
FT                   PPGVTVDLSGWLIANAYWSDGGLNASDLPQWATPAHSTAGMTVRQSRVRAAAGLPVDGL
FT                   LGGAVLKGLVEADFMGTYVNSDASMPQVRLRHAYLTAACAKGNLTLLVGQTWSLFGGPW
FT                   FAASLGHVALPRFAGAGYLYRRAPQVRLTAEAGRGADLGVTVAVAALASSGDKATSQNQ
FT                   LVGERAGVPDAEGRMALVLRRGGKAWLEVGASGRFGQQLWKLDGLSTPREERLTGWGAA
FT                   ADGRLEVPHLVVQGGTFMGEVLGGYGSVAPVVRQTKNATDPARLDAISPVRTGGFWAQA
FT                   VVTPVPVLQLLGGYGIEEPRTSDLPAGSEATTIERNQQVSGGAILALTSRWKVSLEGTL
FT                   YTTETLDGARRESTQVEVGSLYAF"
FT   sig_peptide     57830..57901
FT                   /locus_tag="A2cp1_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(59300..60625)
FT                   /locus_tag="A2cp1_0052"
FT   CDS_pept        complement(59300..60625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0052"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: ank:AnaeK_0040 phenylacetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63412"
FT                   /db_xref="GOA:B8J7S0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7S0"
FT                   /inference="protein motif:PRIAM:6.2.1.30"
FT                   /protein_id="ACL63412.1"
FT                   /translation="MARFALENRILDPEETLDRDALAALQGRRLAETVRRARAVPHHRK
FT                   ALERAGVRDEDLRGPADVRRLPFTVKDDLRQSYPLGLLAVPREQVVRIHGSSGTTGRPT
FT                   FVAYTRRDLDTWTGLVARFLVAGGLRPEHTVHVAFGYGLFTGGFGLHYGIERVGAAVVP
FT                   SGGGNTPRQVRLICDLSADVLISTPSYALHVGEVARAEGLKPGDLPLRYGHFGGEPWTE
FT                   EMRGEIERSLGILAFNNYGLSEVIGPGVAGECPARDGMHVQEDHFIVECLDPVTLEPVP
FT                   DGEVGELVFTSLTKEAMPVLRYRTRDLAALDRSPCPCGRTGVRMSRVRGRSDDMLIIRG
FT                   VNVFPSQVEEALLRVEGTAPHYLIEVSRPGALDEAVVKVEVRPEDFRDEMREMVGLRDR
FT                   IDREIHAVTGIRMIVELVAPNTLERSAGKARRVLDHRKAGPA"
FT   gene            complement(60629..61072)
FT                   /locus_tag="A2cp1_0053"
FT   CDS_pept        complement(60629..61072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0053"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   ank:AnaeK_0041 amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63413"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7S1"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ACL63413.1"
FT                   /translation="MKIRQLSLFLENRPGQLRVPCQVLGDAGIDILTLSLADTQQFGIL
FT                   RLIVKDPERAKQVLEKAGVVVNVTDVLAVDVPDRPGGLAEVLEGFEACGLGIEYMYAYS
FT                   VRSRGEHATLVFRLSDPDRAAALLQARGVRLVGAAELFARAGA"
FT   gene            complement(61092..62417)
FT                   /locus_tag="A2cp1_0054"
FT   CDS_pept        complement(61092..62417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0054"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: ank:AnaeK_0042 phenylacetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63414"
FT                   /db_xref="GOA:B8J7S2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7S2"
FT                   /inference="protein motif:PRIAM:6.2.1.30"
FT                   /protein_id="ACL63414.1"
FT                   /translation="MTTSWNDAGSAFHPASAPDFLPRRELEKLQLARLRAVVARAYEKV
FT                   PLLRQRMEARGVFPDAIHALEDLARLPFTVKADLRDTYPFGLFASPVEEIVRLHASSGT
FT                   TGKPIVVAYTAADLEVWTSVMVRAFAACGLHQGDLIQNAYGYGLFTGGLGAHYGGEALG
FT                   ATVIPISGGNTERQLMVLQDFGVTAICCTPSYMVHLIERARDAKIGFGRLKVGVFGAEP
FT                   WSESMRAHIEREAGIRAHDIYGLSEIIGPGVGIECVHRDGLHLFEDHFYPEIVDPETGA
FT                   VLPDGAEGELVLTTLSKQAMPMIRYRTRDITAIDPTPCACGRTLRRIRRIGRRSDDMFI
FT                   IRGVNVFPSQVETALLQVEGTLPHYQIVLTRAKGLDEMEVQIEVTPEVFSDEIRGLQRL
FT                   QEHLGAALEQVLGLRAQVTLVAPRTLQRSEGKAKRVIDRRNI"
FT   gene            complement(62431..62919)
FT                   /locus_tag="A2cp1_0055"
FT   CDS_pept        complement(62431..62919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0055"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: ank:AnaeK_0043 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63415"
FT                   /db_xref="GOA:B8J7S3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7S3"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ACL63415.1"
FT                   /translation="MPSRTVNVVVAGLGGQGVIKASEILADTAFRAGLDVKKAEVHGMS
FT                   QRGGSVTTDVRFGAEVLSPMVPAGEADFLLVLAPSELEVTRPLLRPGGLLIPPDAVDEA
FT                   RLPNRRSLNVALLGLLSHHLELDEAHWLAAIHAALPERLHAVNDAAFRLGRETAAAAR"
FT   gene            complement(62912..64552)
FT                   /locus_tag="A2cp1_0056"
FT   CDS_pept        complement(62912..64552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0056"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: ank:AnaeK_0044 thiamine pyrophosphate
FT                   protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63416"
FT                   /db_xref="GOA:B8J7S4"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7S4"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACL63416.1"
FT                   /translation="MERRLLSGDEAVAAAARDAGVRLGTGYPGTPSTEILQALDALGGR
FT                   AQWAPNEKVALEVGLGAAFGGARALVTMKHVGLNVAADPLFTAAYTGVKGGLVVVSADD
FT                   PGMASSQNEQDNRHYAAAAGLPMLEPADSQEAYDLTVTALELSERFAIPVILRMTTRVC
FT                   HSKTLAARRTDLPAPPGPAFVRDIPGRVMIPAYARPAHRRLRKKLEALQAFAEETPLNV
FT                   WVKGDRALGVITSGVTARHVAEAAPSASRLELKTVYPLPIEKIRAFAASVDRCIVVEEG
FT                   DPIFADAIRAAGIAVEAKEAPYRFGELDVQRVRRILARDTSPEPELPKGRPPALCEACP
FT                   YHPVYATLRKLDCIVAGDIGCYTLGVLPPYQGIDTCVAMGASLGVGLGLRHVLPEADAR
FT                   RVVSIIGDSTFVHTGLNGLVEMVYNPPPTGHVLVVLDNGTTAMTGQQEHPGTGRTLDHE
FT                   PTGKVSIEGLARALGVANVDVVDPVADPAGWEKLLKQRLAEPRLSVIIARRPCILAAAD
FT                   IRRYEKAADEKRAALACAGCAGAGEVSDA"
FT   gene            64679..65602
FT                   /locus_tag="A2cp1_0057"
FT   CDS_pept        64679..65602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0057"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; KEGG:
FT                   ank:AnaeK_0045 phosphate butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63417"
FT                   /db_xref="GOA:B8J7S5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7S5"
FT                   /inference="protein motif:PRIAM:2.3.1.19"
FT                   /protein_id="ACL63417.1"
FT                   /translation="MIPIPTLARLTAEARTAGPLRLAVAAAASDSALGAAALARRQRIA
FT                   DAVLVGGRSEIAARLRALGEDPALFELHEAANDEDAARRAVAIVRGGEAAVLMKGRLQT
FT                   AALLAAILDREAGLRDGRLLSDVLVADHPLSAAPRLLGVTDGGVNVAPDLGQKRAIVEN
FT                   AAALFRALGHDRPRVACLCAVETVTEAMPHTRDAAALAAMSARGELTGCVVGGPFALDN
FT                   ALSAEAAREKGIDHPVAGRADLLLAPTIEAGNALGKAFTYLAHRSVAHVIVGARAPVLI
FT                   PSRVERPEDKLCSIALGVLAAARGTR"
FT   gene            65599..66729
FT                   /locus_tag="A2cp1_0058"
FT   CDS_pept        65599..66729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0058"
FT                   /product="butyrate kinase"
FT                   /note="TIGRFAM: butyrate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: ank:AnaeK_0046 butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63418"
FT                   /db_xref="GOA:B8J7S6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7S6"
FT                   /inference="protein motif:TFAM:TIGR02707"
FT                   /protein_id="ACL63418.1"
FT                   /translation="MSAGAGPPGSGAGAGGGPLVLAVNPGAGSTKLGLFRGGLPLREEK
FT                   VLHPEAMARPAARIWDELPGRVAAAEDFLSRAGVRAGELAAVAGRGGLLPPLAAGAYLV
FT                   DDALVAELERAAHGEHASNLGAPMARALAAPHGCPALVVDPVSVDELAPVARVTGLAGV
FT                   ERSSFVHALNLRAVARRHAAGAGRPLEALRLVLAHLGTGISLCALSGGRMVDVVNPRDE
FT                   GPFSGDRAGGVPANALVDLCFAPGADVRTVRRRLFGDGGLYAHLGTRDVREALARAERG
FT                   DARAALLVDAMCYQAAKAVAAMAVALDGRVDAIVLTGGLAHLAPVVEGVRRRVAWIAPV
FT                   EIHPGEDELRALAEGALRVLAGEEPARRYAPLAPAR"
FT   gene            complement(66773..68236)
FT                   /locus_tag="A2cp1_0059"
FT   CDS_pept        complement(66773..68236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0059"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: ank:AnaeK_0047 transcriptional
FT                   regulator, GntR family with aminotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63419"
FT                   /db_xref="GOA:B8J7S7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7S7"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACL63419.1"
FT                   /translation="MRTWQTPLAIDRADPAPLSVQIARALGARIRAGALRPGAPLPSSR
FT                   ALARTLGVHRNTVLAAYGELAAEGWIASDPARATFVSRELPPPPPGAPGRAGPEAGAPA
FT                   ARAGFDLPPAPADATWSTLPPGTLELLGGTPDPRLVPVAALGSAYRRALRRREHLSYGD
FT                   AAGHPRLRAALARMLGEARGLAVAADGILVTRGAQMALSLAGRALLRSGDGVAVEALGY
FT                   RPAWESLRLAGLRTVPVPVDARGLQVERLEALAAAGAVRAVYLTPHHQYPTTVTLAPAR
FT                   RLALLEVARRARLLVLEDDYDAEFHYDGRPVPPLASADGAGVVVYVGTLSKVLAPGLRI
FT                   GWLAGPPDAIERVTAHRRFLDRQGDLAVEAAVAELFEEGEAQRHAWRTRRVYAGRREAL
FT                   AAALRARLPGALSFRMPAGGMALWCRVAPGLDPEAWAARALRAGVAVQPGRLFAHDRRA
FT                   RPFLRLGFGRLDERELAEAVRRLAAALPR"
FT   gene            68302..69387
FT                   /locus_tag="A2cp1_0060"
FT   CDS_pept        68302..69387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0060"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ank:AnaeK_0048 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63420"
FT                   /db_xref="GOA:B8J7S8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7S8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACL63420.1"
FT                   /translation="MRREIFRAGRGEALALLRRAPTVHLATTTPEGAPVLRALDAAVLE
FT                   DGVWFHGARAGEKARCLGRAAVVSAEELVAHLPSWMADPVRACPATTLYRSVQAHGTLE
FT                   ELTDSARKAEVLSALMARWQPEGRYRPLRADDPLYAGELRGILVLGVRLGEALDGKWKL
FT                   LQNRTPEQIGAALEGLWARGAPGDVAAIEAVRAANPHAPEPSFLAAGIPGVRLQVALGE
FT                   ADAPAVRALLAGEYWWEGEPLALAGPSHLASTAWVGARDADGALVASARAMADPRHAWI
FT                   YDVVVAPAWRGRGLGKRLVALLLDHPAVRRTRFVRLVTADAQGLYARFGFVDAAGKRRF
FT                   GTSTEMVLVRDPPAGADAGAP"
FT   gene            complement(69394..69985)
FT                   /pseudo
FT                   /locus_tag="A2cp1_0061"
FT   gene            complement(70022..72028)
FT                   /locus_tag="A2cp1_0062"
FT   CDS_pept        complement(70022..72028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63421"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7S9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0050"
FT                   /protein_id="ACL63421.1"
FT                   /translation="MLGPLALALALASPPGAPAPPSAEPGAPPAAAIASAAAPAAPAAG
FT                   ATAAPDPAYLAELVAKARALRLADDPGWLKLGHWRRRPLGGWKSEADGGKFFRARDGKT
FT                   DPAAELEATLAGFFDAAPKAEELDDAQCRFPARFAFLGGRLGFDLARLPPRRCPKFEDF
FT                   YGKIRPQGVTVVFSSYYLNNPASAFGHTLLRLDKAPEAIGGKHFELLDYGVDYAATVDT
FT                   GNAVLYAAKGLLGFFKGEFKYYPYYYKVREYGDYESRDLWEYDLELTPGEVALLGAHVW
FT                   ELGGTWFDYWYLDENCSYHVLGALEAAAPRLDLLSHVGRAVVLPSDTVVALFENPGLVR
FT                   RVHYRPSIRTQFEARARGLSRAELREVEALSGDPAAPLAPGTPPDGLAKVLDAAVDLLD
FT                   LRHARELIRGLEPKAAQDRQALLERRAALGVPSAPLALPLPEARRPERGHGSLRLGVGG
FT                   GAVDGQGGTVLLDARLALHDLGDPPEGYPPTAQIEFLPTRLRWTPRERRVDLDDVALVR
FT                   IVSLSPVTRFDARPSWKASFGATTVRDRGCDRCLAFASDLGGGLAAALPGGLDLAATGD
FT                   LELRASPGLSGAGGTGWRPGIGPSALARLRLGSRAVLLADARWRWLPDAAPRTTWSWGG
FT                   ALRLHLARDLSLAFEARRQPLATEAAALVLGYF"
FT   sig_peptide     complement(71957..72028)
FT                   /locus_tag="A2cp1_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.990 at
FT                   residue 24"
FT   gene            complement(72103..72600)
FT                   /locus_tag="A2cp1_0063"
FT   CDS_pept        complement(72103..72600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63422"
FT                   /db_xref="InterPro:IPR021383"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7T0"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0051"
FT                   /protein_id="ACL63422.1"
FT                   /translation="MTRITLALVAALLAVPAAAADQTASAIKGTGRYGTAGCGLGSMAF
FT                   GNTPGAVQILAATTNGTFGNQTFGITTGTSNCGSGVFTAGTKNFVDANREALAKDISRG
FT                   EGEAIGALTVINACENSHAVGAALQKNFKAIFPSESASNEDVTKAILDTLHGDAALGCG
FT                   RS"
FT   sig_peptide     complement(72541..72600)
FT                   /locus_tag="A2cp1_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 20"
FT   gene            72825..73628
FT                   /locus_tag="A2cp1_0064"
FT   CDS_pept        72825..73628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0064"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: ank:AnaeK_0052 electron transfer
FT                   flavoprotein alpha/beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63423"
FT                   /db_xref="GOA:B8J7T1"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7T1"
FT                   /inference="protein motif:PFAM:PF01012"
FT                   /protein_id="ACL63423.1"
FT                   /translation="MALKIVVTAKRVEDPESKIRVKPDGSGIVTDGVNYKINPFDEIAV
FT                   EEALRLKERHGGEVVVASIGGEKSQTEIRAALAMGADRGILVRHDGPLDPVVVSALLAK
FT                   VVEQEKPDLVILGKQSIDDDQNQAGQYLAERLGWPQGTFASKTESLESEAEQKKEPGLV
FT                   LSADGKALTVVREVDGGVETLELGLPAVVTTDLRLNKPRFASLPGIMKAKKKPLQELAA
FT                   ASLGVDLAPVVVMKRLAEPPARKGGVKVADVEELWKKLHDEAKVL"
FT   gene            73674..74636
FT                   /locus_tag="A2cp1_0065"
FT   CDS_pept        73674..74636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0065"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: ank:AnaeK_0053 electron transfer
FT                   flavoprotein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63424"
FT                   /db_xref="GOA:B8J7T2"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7T2"
FT                   /inference="protein motif:PFAM:PF00766"
FT                   /protein_id="ACL63424.1"
FT                   /translation="MSNVLIVAEQGGGQLRKATLHAISAGRALAARTGGALHVALLGQG
FT                   VRPLADALAATGAEVHVADAPALEHPLADAWAPVIAEIAKACGAAYVGAAATAQGKDLL
FT                   PRVAARLGAGMATEVLGFGGDGAAVTFRRPMWAGNVLAEVEIATPVKVFTVRATEFPAA
FT                   EPGAGKGAVHEVAVQVPAGLRTRHVAFREVKSERPELTEARVVVSGGRGTKGDFKPVEA
FT                   LADALGAAVGASRAAVDAGWVPNDWQVGQTGKVVAPDLYVAAGISGAIQHLAGMKGSKV
FT                   IVAVNKDPDAPVFQIADYGLVADLFQALPALTEKVKASK"
FT   gene            74665..75669
FT                   /locus_tag="A2cp1_0066"
FT   CDS_pept        74665..75669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0066"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ank:AnaeK_0054 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63425"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7T3"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACL63425.1"
FT                   /translation="MTEADLEGLGVHRIAIPVPFPQAGGPVNAYLVEEAGGGLLMFDSG
FT                   LGTPEAQAALEAGFQRLGRRFDEVGRIVVSHGHVDHYGAARFVQERHGGPDVPVFGHPA
FT                   DAPKMSEQGPRWRELAPRLAAYLARQGVPPEVVELLAKQGEGGFRYARRLPEIRPIAEG
FT                   EVLRTRHLALEVMHMPGHTPGLLCLYDREKRLFLSDDHLLEKVSPNPLIELGPDGQDGF
FT                   FRPLLAYLDSIRRLRALEVDLVLPGHGPPFSGHREIIDALVGFYAKRQARLLELLQAGP
FT                   RTAHELARALWPRARPTDAFLTLSETVANLEVMESRGEVRRDRAAEPWRYLAA"
FT   gene            75724..76485
FT                   /locus_tag="A2cp1_0067"
FT   CDS_pept        75724..76485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0067"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   ank:AnaeK_0055 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63426"
FT                   /db_xref="GOA:B8J7T4"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7T4"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="ACL63426.1"
FT                   /translation="MLELLGQADTWISLVTLSAMEIVLGIDNVVFLTILAGRLPQEQQG
FT                   RARKLGLSFALLTRLGLLFAISWVMGLTRPLFSVLGREVSGRDLILLGGGLFLIAKATH
FT                   EIHDKLEVEHAEERKAGGGAAFWAVIVQIALLDIVFSLDSVITAVGMAKHLPVMVAAMV
FT                   LAVGVMLVFADAIGGFVERHPTIKMLALSFLILIGVMLVAEGLGKHIEKGYVYFAMAFS
FT                   LGVELLNMRVRKTRQAPVHLHGRFEEERAGR"
FT   gene            76504..77418
FT                   /locus_tag="A2cp1_0068"
FT   CDS_pept        76504..77418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0068"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ank:AnaeK_0056 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63427"
FT                   /db_xref="GOA:B8J7T5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7T5"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL63427.1"
FT                   /translation="MADLALLVLTLLWGTTFALVKEALEIASPGVFLTARFGLAAVALL
FT                   VAWALRPRAPLGEGFWRHGVLLGLTMLVGFVLQTVALRHTTPSRSGFITGLNVLVVPIV
FT                   ARWLLGRRVRLAFWVGVTFALAGLVLLTRPFTPGAVTEEVRFGDLLTLFCAVAYGLQVT
FT                   FTSEWAPRHPLAPFVAVQVLVTLAGALVLAPLEGPRFDPAGAGHFLAVVAFTGLVMTAL
FT                   AFFVMNWGQRHTTAVRAALIFSLEPAAAAVFSWLYYGEPLGPLDWAGGGLMVLGVVAGE
FT                   VGGVLEARAAEARARARAGAPAA"
FT   sig_peptide     76504..76566
FT                   /locus_tag="A2cp1_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.762 at
FT                   residue 21"
FT   gene            77480..78667
FT                   /locus_tag="A2cp1_0069"
FT   CDS_pept        77480..78667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0069"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   ank:AnaeK_0057 MltA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63428"
FT                   /db_xref="GOA:B8J7T6"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7T6"
FT                   /inference="protein motif:PFAM:PF03562"
FT                   /protein_id="ACL63428.1"
FT                   /translation="MRRTPLEHALLAALALSVAACRHAPPPAPARTADEALREVPPSDL
FT                   PAFADDLDYAGLEDAIGRSETWLARLAASDPGRTFAYGRERVPLARVQATLARFRTVVA
FT                   ARPAPAALRETLRREFRAFRSAGDGRGTVLFTGYYLPELRGALARGGPYRVPLHRAPDD
FT                   LVVVRARDFPQVAEDLVGRVEQGRLVPYPTRADIARGALDGKGAELCYVDSALDAFFLE
FT                   IQGSGVVRLEDGSSRVVTYAGKNGQRYAAVGAELIRRGALRREEVSMQSIRAWLLAHPE
FT                   EQAAVLATNPSYVFFRFADDAIGALGVPVTPDRTIAADAKVFPKGGLAFLETERPVDAT
FT                   SATLRPFSRFVLDQDAGGAIRTSGRVDLYLGSGPYAANAAGRMKQPGRLWYLLLR"
FT   sig_peptide     77480..77578
FT                   /locus_tag="A2cp1_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.763 at
FT                   residue 33"
FT   gene            complement(78773..80071)
FT                   /locus_tag="A2cp1_0070"
FT   CDS_pept        complement(78773..80071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0070"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: ank:AnaeK_0058
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63429"
FT                   /db_xref="GOA:B8J7T7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7T7"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ACL63429.1"
FT                   /translation="MKRTVDVGERLPLLQSIPLSLQHLFAMFGATVLVPFLVGLDTSVT
FT                   LFTSGVGTLVYIFITKGKIPAYLGSSFAFIAALSAIIGVAPGQAAPADRVAVAMGGCVA
FT                   VGVCYLVVAALIAKFGTGWIDRLLPPVVIGSVVMVIGLGLARVAVVNMAMNGGGPTYRP
FT                   EFFAVALASLAIAILAAVFLKGFLGVIPVLIGIVGGYVVALLAGQVDLSGVAAARPLAV
FT                   PPFVLPRFTWAAIITLAPISLVVITEHIGHLIVTNNVVGRDFVKDPGLHRSLAGDGVAT
FT                   MISGALGGPPNTTYGENIGVMAITRVFSVWVIGGAAVLAVLMSFLPPVGALIRSIPTQV
FT                   MGGICILLFGIIASAGIRMLVEAGIDFSQKRNLIIASVVLVIGVGGAEMHFGSVKIDAM
FT                   PLATYVGILLNLVLPRGMEGTAANGAVAEAPDV"
FT   gene            80323..80466
FT                   /locus_tag="A2cp1_0071"
FT   CDS_pept        80323..80466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63430"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7T8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0059"
FT                   /protein_id="ACL63430.1"
FT                   /translation="MAEEKKKGGFHSLEKRIHQIEEEDRSQAARESKPEEKKAPAKEPP
FT                   KK"
FT   gene            80529..81521
FT                   /locus_tag="A2cp1_0072"
FT   CDS_pept        80529..81521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0072"
FT                   /product="putative mRNA 3'-end processing factor"
FT                   /note="KEGG: ank:AnaeK_0060 putative mRNA 3'-end processing
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63431"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7T9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0060"
FT                   /protein_id="ACL63431.1"
FT                   /translation="MRRPPIELHRGELKVTGSSLHLDATRRVECAFVSHAHGDHIGRHD
FT                   RTIATAATLALMRHRLGEGKRRKTEHLPASYRSPFGLGELTLELFPAGHVLGSAQVRVT
FT                   RNGVSLGYSGDLCTEPTHAAERAEVMGCDVLVIESTFGHPRYVFPPKDETLAAVRRFVD
FT                   GALADGVTPVLLGYALGKAQEILKYLSDLGYACRAHPVVHAVNKVYEAHGVALPNVRPL
FT                   GPEGAGMDEVVVCPPHLARSPAMRGLRKRRTAILTGWAIDGGRFFRGVDAAFPLSDHAD
FT                   FPSLVRYARATGAGRVFTVHGHEDALAAALRKEGIRAEPLREHMQLELI"
FT   gene            81556..82575
FT                   /locus_tag="A2cp1_0073"
FT   CDS_pept        81556..82575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0073"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="KEGG: ank:AnaeK_0061 pseudouridine synthase, RluA
FT                   family; TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63432"
FT                   /db_xref="GOA:B8J7U0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7U0"
FT                   /inference="protein motif:TFAM:TIGR00005"
FT                   /protein_id="ACL63432.1"
FT                   /translation="MIQLTVTADAAGQRLDKLVRKALRDVPLSHVYKMFRTRKVRVNGQ
FT                   RGKADQLVAEGDVVVIRGDEERLLAKAAPAAPGGAPRVTFGVLHEDADLLAVDKPAGLA
FT                   AHPGTGIEGATLVEMARGYLKTPDDLPPTEFKPSPAHRLDRDTSGVVLVAKHRKAMVRL
FT                   TETFTSGEGVHKTYLALVKGKMPREAGTIDLPLSEHEQTSKSKAMRGVNFQEALTRWKV
FT                   VSAAKEISLLAVTIETGRTHQIRRHLEAVGHPVAGDRRYGDFAFNRTARTRWGLRRMGL
FT                   HAWKLEVPHPLTGAPLRLEAPFPAELAEVLSRANLKLPGSPTGAHAPAARRDGPHRER"
FT   gene            82611..85169
FT                   /locus_tag="A2cp1_0074"
FT   CDS_pept        82611..85169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0074"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: ank:AnaeK_0062 penicillin-binding protein, 1A
FT                   family; TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63433"
FT                   /db_xref="GOA:B8J7U1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7U1"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACL63433.1"
FT                   /translation="MREPGDPQQPPEEPSSRVVLDGLPPERPLRRRLLRWGLFAAIAAV
FT                   NAVIVAAVVGWFVFSRGLPDIPTLEQYRPPIITEMISADGQIAGEFFVERRKVVPYARI
FT                   PRRVIQAFIASEDKNFFEHGGIDLLGTLRAAVKTYVLRSRIQGASTLTQQTAKAILISA
FT                   EGFDRGTERSLRRKIRELILARRLEARFTKEQILWMYLNGVYLGHHSYGVQSAAENYYR
FT                   KNVEDLTLEEAALIAGLPQAPSRYSPFSRPEAAAERRRYVLRRMAEEGMITEGERRSAE
FT                   KAEVKVFGVDDVFRETAPFYVETVRRQVVDRYGNDRLLHDGLRVEMAMDLEKQRAAQAA
FT                   VLKGLVEVDQRQGFTGPVAKVAGAERTALAARLAKAWPKGTLRPGDFCVGIVDRVDDKA
FT                   GVVEVEVGETRGVLPISGMRWARRPNPVVSYADSLLSRPSSALHAGDVVVLKRVERAEL
FT                   QRKEAQLGVGRPKDVPEAPVLFSLQQDPTLQGALVAVDPGTAYVTAMVGGYDFEASEFN
FT                   RAFQACRQPGSAFKPVVYSAAVEKLDYTPATILTDAPIVFRDDESSWKPQNYGEDFKGD
FT                   VTLRTALVNSMNIPAVKTAEALNAKLGPAGLGDWAKTLGITTPVKQELGSALGSSCVTP
FT                   WELTNVYALFARYGEKRPSAFVKRVLDRDGRVLEDHADYRDPWVGLDERLAGAVAEVTR
FT                   PREQVMDPRSAYILVRLMREVATVGTGARAAALGKPAAGKTGTTNDSFDTWFMGFTRDL
FT                   ATGVWLGYDVNVTPLGRYETGGHAALPIWLDFMSAALKGRAQPEFEAPSGIVEVRIDPA
FT                   TGKAVADGAGGVPEPFKQGTEPVLADAEKKQVEVQDLFMQ"
FT   gene            85371..87437
FT                   /locus_tag="A2cp1_0075"
FT   CDS_pept        85371..87437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0075"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: ank:AnaeK_0063
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63434"
FT                   /db_xref="GOA:B8J7U2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7U2"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACL63434.1"
FT                   /translation="MRPKLAHLGVKRILFLSIAGALAIAGVLTSIAVNREIHVALERAA
FT                   VHRGEADARVYASALAPALAAGDPARIAARVDEDWDEESFAYVVVVREDWSVAARHLSR
FT                   NLGRSAEEVVAWHQAAGGAAQPQAPGVLAFTRPVEGAGGGARAGYVLLGLDRDPLDGQA
FT                   GRAGWYIFALLVGGGMVLAGLVYVFVSRLVLRPLDEMSAVARRVSDCDLTARSAQLGPD
FT                   ELGTLAESLNRIGENLAATLSRVQNVTGGVATVIDRISRTGSAVSSGAGTVTARVVDTS
FT                   SSMSQMISSLKGIADNVEVLAQSAEESSSSILEMAATNDEVAENIQALAASVEETTAAI
FT                   EQMTYSIKEVAKNIEDLSATTEETSSSMNEMDVSISQVESNANETARLSEQAQRDAESG
FT                   AEALSRTLLGIDKIKESSKEAASVIEALGAKIAAIGNILNVIDDVAEQTNLLALNAAIL
FT                   AAQSGEHGKGFAVVADEIKDLAERTGASTKEISELIRAVQDQSRNAIQAMDRGVRNVEE
FT                   GVRLGQETETALKKIQESSQKSTQMVKAIARATLEQARGSKQVTMAINRIAETVQQIAS
FT                   ATAEQARGSEQIMKSAERMKAITKHVERSAQEQARGSKQITRAIESISEMVHHLNRAQK
FT                   EQTKGSEQVMTAVVQIKQVAEAQTHSVRDLEAAIVDLASQAEVLRGEVRRFRI"
FT   sig_peptide     85371..85469
FT                   /locus_tag="A2cp1_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.761 at
FT                   residue 33"
FT   gene            complement(87542..87982)
FT                   /locus_tag="A2cp1_0076"
FT   CDS_pept        complement(87542..87982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0076"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   ank:AnaeK_0064 protein of unknown function DUF55"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63435"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7U3"
FT                   /inference="protein motif:PFAM:PF01878"
FT                   /protein_id="ACL63435.1"
FT                   /translation="MAYWLLKTEPGTYAWSDLVADGTTPWTGVANPQAQTNLRAMKAGD
FT                   RAIVYHSGEKRAVGIAEVVRTAYPDPTAGGELVCVDVKAVEPLPAPVPLEALKQEPAFE
FT                   GSVLLRQGRLSVVPLAPAEWRDLASLADVIARTGGLRRKARF"
FT   gene            88078..88497
FT                   /locus_tag="A2cp1_0077"
FT   CDS_pept        88078..88497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0077"
FT                   /product="sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /note="PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: ank:AnaeK_0065 sec-independent
FT                   translocation protein MttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63436"
FT                   /db_xref="GOA:B8J7U4"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7U4"
FT                   /inference="protein motif:PFAM:PF02416"
FT                   /protein_id="ACL63436.1"
FT                   /translation="MFGLSFGEIVIIAVLALILLGPDRLPEAAKTIGKGLRQFKQATDD
FT                   LKDQIETEIYKDDRKVARPSLVPPVPNRPVPGPAGPPPAATAENVPGLEAALVDAEPAA
FT                   PPAEPAVPAAAPAPTPSPAPSGEGAPPPGTGGTAA"
FT   gene            88504..89304
FT                   /locus_tag="A2cp1_0078"
FT   CDS_pept        88504..89304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0078"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: ank:AnaeK_0066 sec-independent protein
FT                   translocase, TatC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63437"
FT                   /db_xref="GOA:B8J7U5"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7U5"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ACL63437.1"
FT                   /translation="MSETVPQLPPPPSPEPEGEVKLSFLDHLRDLRVRMVRAMLGIAIG
FT                   MGLVGGFVPQIVDHLMKPVRDALPAGRQQLVYTSAIEPMMVYIKVAMYGGVFVAAPWVL
FT                   WQLWLFIAPGLYKREKKVVFPFLFWGTLLFYLGALFCFELVMPQAFPAMLAFAESDTLS
FT                   PMLSLSEQLSLVLAMLLGFGVVFEVPVVIAFLSMIGLVQWRTLAKYRRIAIIVNVIAAA
FT                   IITPTGDPLNLALMAVPMIVFYEVGIVLARILGKKPAADAAPAA"
FT   gene            89378..89575
FT                   /locus_tag="A2cp1_0079"
FT   CDS_pept        89378..89575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63438"
FT                   /db_xref="GOA:B8J7U6"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7U6"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0067"
FT                   /protein_id="ACL63438.1"
FT                   /translation="MLVFQSVAALFAVYMLARHAPRAYAALRGRAGDRVGALVPALNVA
FT                   LALAILVVAVKGLAGALISR"
FT   sig_peptide     89378..89455
FT                   /locus_tag="A2cp1_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.819 at
FT                   residue 26"
FT   gene            89592..90788
FT                   /locus_tag="A2cp1_0080"
FT   CDS_pept        89592..90788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0080"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: ank:AnaeK_0068 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63439"
FT                   /db_xref="GOA:B8J7U7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7U7"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACL63439.1"
FT                   /translation="MNRAGQQDVVFLAAKRTPFGTFGGSLKDLSATDLAVHAAQAAIEQ
FT                   AGAPPADYGHVVVGNVAQTSPDAIYLARHVGLRAGLPEGVPAVTVNRLCGSGFEAVIEA
FT                   ARLIHGGEAELVLAGGTESMSQAPLVLRGTRFGHAFGKTPPLEDMLWSALTDTYAGMPM
FT                   ALTAEKLAERHGIGQDAVDELAVSSQRRWAAADEAGRFREELAPVELRTRKGTVRFEKD
FT                   EHPRPGTTLEGLRKLPKVFKADGVIHAGAASGIADGAGMLVVASRAYAERRGLRPLGRL
FT                   VNWGHAGVDPTVMGIGPVPAVRNALARAGATLADLDLIEVNEAFAPQVLAVEQELGLPR
FT                   DRTNVDGGAIALGHPLAASGARITMHLLYELRRRKARAGLGSACIGGGQGVAVILEPL"
FT   gene            90860..91057
FT                   /locus_tag="A2cp1_0081"
FT   CDS_pept        90860..91057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63440"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7U8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0069"
FT                   /protein_id="ACL63440.1"
FT                   /translation="MTSFTGVKVFSTTLARDRDAMGETITRWLAGNPELEVVSHEVRQS
FT                   SDKEFHCLTITLFYRERKKG"
FT   gene            91064..91804
FT                   /locus_tag="A2cp1_0082"
FT   CDS_pept        91064..91804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0082"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: ank:AnaeK_0070
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63441"
FT                   /db_xref="GOA:B8J7U9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7U9"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACL63441.1"
FT                   /translation="MRSRRSPDLGSAFTFGGRIPSGLGLLLVLILVATVGSWVTRDDTW
FT                   AALVPGLVLRGQVWRLVSWAFVQNDPLTLLFGGFMLYSIGQQLAFTWSERRLVGTFLGL
FT                   AAGATAVTVVAALLWFPADRPHLGMWPVVNALLLMWAMMYPDRQVSIWGVLPLTGKTLA
FT                   LLVVFGTVLYGLAGGGLPGLGAFVPHFAALALGFALSRGGRMPTRRWKLQAREWWAERE
FT                   FRRRSKHLKVIGKDGKGEPPRWMN"
FT   gene            complement(91870..95073)
FT                   /locus_tag="A2cp1_0083"
FT   CDS_pept        complement(91870..95073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0083"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ank:AnaeK_0071 putative CheA signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63442"
FT                   /db_xref="GOA:B8J7V0"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7V0"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0071"
FT                   /protein_id="ACL63442.1"
FT                   /translation="MPDPRSALKEFRQLDRKRLSEGLTAEEERRHAELRDLVEPELQAS
FT                   GSGFDVGAAADRLRASLEPAGLRRAPAEAPPAAPAAEAGPAPLFEDVAPDAGLAEAFEG
FT                   QAFEALEVPAPDAPAWEAAAQPAAAEAAEGWDPEAPASDPDAAPAWDANAQPFDPNAAQ
FT                   AWDPSAQPFDPNAAQAWDPNAQPLDPNAAQGWDPNAQPYDPNAAQAWDANAQPFDPNAA
FT                   QAWDPNAQPFDPNAAQAWDPNAQPYDPNAAQAWDPNAQPYDPNAAQAWDPNAQPYDPNA
FT                   AQGWDPNAPPYDPNAAQAYDPNAQPYDPNSQPYDPNAAAWDPNATPYDPGAAQAWDPSA
FT                   QPYDPDAAQPAWNPDTTATFGEPEAQPSAEAAPADGAPGYEAWTTPADEPETVDLATEA
FT                   VIEELEPLSADGLALEGDPSAEPPAPLAGGDAASLPPDGWEVTAPPPDAPVAAVLGEYD
FT                   EAGAAPAALSPEDLGAEPAPEPEAPGAPLELGEYDDTSGFAAPAAEGVLEVAPPGAAPA
FT                   ADAGWAEEVALDQGFELESGGSFDAAAEATVPEWAREAGLPPWDAPAPDALEAGSLGLD
FT                   GDVEAPVEPAAEPIALGDEAGEDGEPIALEPTLDLGAPVEPTLELAELEEPAAGEAGAS
FT                   PGDDPFALRAPEPEPTGARDLSALDFAAGELGEDADAWAAAETAPGEPEPFTMGDVGPQ
FT                   AEPLAGPDPEAELPAWDAGAAPALELEPSRWDEAAAVDLVGGGAAIAAAEPSALLAEAA
FT                   EALPPLELDGPAAPEPFADAEPAADAAASLTAAAGTLLDAGAEAPPAIDDLLGDLPAAP
FT                   GADATEVAEVAEVADLAAMPPPDADDLPTLDGEDILEEIPADELVPLPPDEEAGGGVEL
FT                   GEVSLAPAPVSASVSAPAPAPAPEPAAEPEPAAVPAPPAAAAAIPDAAFEPLPVEEVSF
FT                   TPPPAVEAAPAPAGAWQVPGAHRVVIHTLEGLVKRGLIEDAALDAPALDVVAQGPLPER
FT                   IPTDKVKAIFFMLAPGEAAPAPEGKRVRVTFRDGRQVAGFSPDYREDGPGFFMIPADTR
FT                   TSTARIWIYRSAVRQVAVS"
FT   gene            95202..97148
FT                   /locus_tag="A2cp1_0084"
FT   CDS_pept        95202..97148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0084"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   ank:AnaeK_0072 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63443"
FT                   /db_xref="GOA:B8J7V1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7V1"
FT                   /inference="protein motif:PFAM:PF08497"
FT                   /protein_id="ACL63443.1"
FT                   /translation="MARLPVLQGDRARRPAPPGPEAFLPMFPEHLRARGWADLDVLLVS
FT                   GDAYVDHPSFGAAVIGRVLEAAGYKVGVVAQPDWRSPAELLRLGRPRLFVGITSGAMDS
FT                   MVNHYTAHKRRRSEDAYTPDGAAGRRPDRATTVYARLARAAFGATTPIVLGGIEASLRR
FT                   IAHYDYWDDRVLPSVLVPSGADLLVYGQGEKPILEIARRLASGEDICGLTDVPGTALAV
FT                   PDLGMAMLDGRDRKVLELPAYEEIVLDKRRFAEFSRLYHLEHNEANARILVQRHGRGPA
FT                   QRHVVVNPPMRPPSTEELDRIAELPYVREAHPAYGGAHIPALEQIRWSVQILRGCAAGC
FT                   AFCCITEHQGRDIASRSEASVLREIATLASKDSFRGTITDVGGATANMWRMECTSAAAH
FT                   AACRRASCVYPSVCQFFSVDHGPLVDLYEKARKVPGVKHVFVGSGVRYDLAQADEKNGA
FT                   RYLEALVANHVSGQLKVAPEHVCEPVLKVMKKPGVESFERFRKDFERYTRKAGKEQYLV
FT                   PYFISSHPGASLEEAADLMEYLQANRWKPQQVQDFMPTPMTLASDIFWSGYHPMTGKPV
FT                   HVTRDMEEKRMQKALLRWGDPANRPLIEKALRKIGRLRPGERLGPGMRPGRRGAGRPGP
FT                   GARGGAGPGRGPR"
FT   gene            97209..97814
FT                   /locus_tag="A2cp1_0085"
FT   CDS_pept        97209..97814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63444"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7V2"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0073"
FT                   /protein_id="ACL63444.1"
FT                   /translation="MPQIRLFPAAALLSLALAQPARAADPAPAPAKPAAPAAAPAPAAK
FT                   PSPAAMDLARTLATQETWKRGMDGLTQSLVGQFRGHPGSELSMPKDFQAKARTEVEALL
FT                   PYEDLVNIHARQLSAAYSEQELKDLVAFYKSPLGQKALKAMPEVQEKVAMETQQRIEPK
FT                   LPQVMQKLAKDVKPPAGGAKAPASPHGGAAPAKPAPKK"
FT   sig_peptide     97209..97280
FT                   /locus_tag="A2cp1_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            97927..98649
FT                   /locus_tag="A2cp1_0086"
FT   CDS_pept        97927..98649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0086"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   ank:AnaeK_0074 lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63445"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7V3"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACL63445.1"
FT                   /translation="MRPAVALAVVLHALGASAARAAGNAPAPLVYVALGDSTAAGQGGG
FT                   PGGGYPPRLARRLEAAGLGVKLVNLGVAGATAGDLRRDQLPRALEARPGLVTVGIGIND
FT                   LVQGRPLREFARDLEIVADFLKQTRATVVISSLPDLVDSPSAKGAPAALARRLDQFNAA
FT                   IERVAERHGFLVADAFGETRRAVRRLGAAAVFSGDGFHPSAAGYDAWADALRQPVERAL
FT                   GARLQGRRPPAPPAAARP"
FT   sig_peptide     97927..97992
FT                   /locus_tag="A2cp1_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.874 at
FT                   residue 22"
FT   gene            98684..100057
FT                   /locus_tag="A2cp1_0087"
FT   CDS_pept        98684..100057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0087"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   ank:AnaeK_0075 adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63446"
FT                   /db_xref="GOA:B8J7V4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7V4"
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /protein_id="ACL63446.1"
FT                   /translation="MDDRERRERHRRLWEADHRHLWHPFTQMRDWLREEPLIVDAAEGV
FT                   HLVDTLGNRYLDGVSSLWCNVHGHRVPELDAAVRAQLERVAHSTLLGLASTASIECAEE
FT                   LVRHLPSGLTRVFFSDAGATAVEIAIKMAFQHHQLRGDERRTEFVALHGGYHGDTLGSV
FT                   SVGGIDLFHRIFKPLLFDVHHAPQPYCYRCPLGKALPGCGMACADEVERILAAREGRVA
FT                   ALVVEPLVQGADGMITQPPGYLRRLRELCDRHGALLVCDEVATGWGRTGTTFAVEQEGV
FT                   LPDILTMAKGLTGGYLPLAATVTTEQVFESFLGEHAEKRTFFHGHTYAGNPLACAAATA
FT                   SMTLFRERGVGAAVPAKAAALARALAPAARLPHVGEVRQRGLMVGIELVRDRATKEEYA
FT                   YALQAGHRVILEARKLGAILRPLGNVVVLMPPLAMTEAELTRLAGITLAAIEAATARL"
FT   gene            100057..100728
FT                   /locus_tag="A2cp1_0088"
FT   CDS_pept        100057..100728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0088"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: ank:AnaeK_0076
FT                   dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63447"
FT                   /db_xref="GOA:B8J7V5"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J7V5"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ACL63447.1"
FT                   /translation="MRGLFVTGTDTGVGKTEVACALVRAARAAGLDAVGMKPAQSGHVP
FT                   GEPSDAERLREASDRVEPLEAICPYTFGAPLAPAAAARLEGREVSLARVVEAARALAAR
FT                   HAAVVVEGAGGLLVPLTARETHADLAAALGLPVLVVARAGLGTVNHTALTVEALERRGL
FT                   AVAGIVLNRTGPEDDPSVPLNAAEIARLTYREPLALLPWEPDIARRARSLGSILGAKIQ
FT                   F"
FT   gene            100781..101053
FT                   /locus_tag="A2cp1_0089"
FT   CDS_pept        100781..101053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63448"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7V6"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0077"
FT                   /protein_id="ACL63448.1"
FT                   /translation="MPNVVDLTLVSRARRALHAVLEERGLGFFLAAGSRTPRLDPRRIA
FT                   WVVEVARRQVSLRARRDPDALSRTRRVLRRELIRRLTEAMLQAGL"
FT   gene            complement(101228..101500)
FT                   /locus_tag="A2cp1_0090"
FT   CDS_pept        complement(101228..101500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0090"
FT                   /product="Domain of unknown function DUF1844"
FT                   /note="PFAM: Domain of unknown function DUF1844; KEGG:
FT                   ank:AnaeK_0078 domain of unknown function DUF1844"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63449"
FT                   /db_xref="InterPro:IPR014995"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7V7"
FT                   /inference="protein motif:PFAM:PF08899"
FT                   /protein_id="ACL63449.1"
FT                   /translation="MADEKQPAPIDFYTFVLSLGSSAFVHLGDAPHPETGEIAEANLLL
FT                   AKQTIDILSMLAEKTKGNLTDEEARFLENLLTDLRLRYVGKSSGR"
FT   gene            complement(101522..102946)
FT                   /locus_tag="A2cp1_0091"
FT   CDS_pept        complement(101522..102946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0091"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: ank:AnaeK_0079 2-alkenal
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63450"
FT                   /db_xref="GOA:B8J7V8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7V8"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACL63450.1"
FT                   /translation="MVRSRRSSSRSAVRGAGRALALAAALAAGLPAPAAARPPAALPRA
FT                   DERPSANRRTPVVIAVEKVRGAVVNVSAEELVRIRVPSQPRGGSMGDLLFGDLFERPRY
FT                   RKGYATTSLGSGVIVSPDGYVLTNNHVVERGARFRVGLLDGRELMAKVVGTDPSSDLAV
FT                   LKLDTREKLPYVTTGRSDDLLIGETVIAIGNPFGLAHTVTTGVVSAVHRNFKAGERMMF
FT                   DFIQTDASINPGNSGGPLLDIDGRLVGVNTAILGDRSAGIGFAIPIDRARRVAEDLIAH
FT                   GEVREGYLGVSVDDLPRKDGTVDGGSGGVRVTGVDPGSPGERAGVRAGDVVEAVDGTPP
FT                   GSAAELLFRLRDLPIGRAARLDLSRRGARVQAAVTAVELTPQRAAELVQRRVGLRVSEE
FT                   RVSGGTLVVVRSVTGRSPAAEAGLQPGDLVREVNSSEVSSVAAFQRAAARARRGGRLVL
FT                   LVQRGYAADRIAFDFD"
FT   sig_peptide     complement(102836..102946)
FT                   /locus_tag="A2cp1_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 37"
FT   gene            complement(102915..103154)
FT                   /locus_tag="A2cp1_0092"
FT   CDS_pept        complement(102915..103154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63451"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7V9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0080"
FT                   /protein_id="ACL63451.1"
FT                   /translation="MADPFENKLVDKRVVQRYLRKGKVDEKEYEKFQKALPDLADQAMP
FT                   IEASMSGVEEPDDLDDDEPEEDVGGGEVPPQQQP"
FT   gene            103237..103905
FT                   /locus_tag="A2cp1_0093"
FT   CDS_pept        103237..103905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0093"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: ank:AnaeK_0081 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63452"
FT                   /db_xref="GOA:B8J7W0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7W0"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ACL63452.1"
FT                   /translation="MPVSEASVGAGRRARLGGLYVIVGGADPVAQAHAAIGGGARAVQV
FT                   RMKDAPAGAVLEATRRILALAAGRALVLVNDRADLALLAGADGVHLGDDDLPVPEARRL
FT                   LGPDLLVGRTTRTLEEARAALAEGADHVGYGPIFASRSKALPVPPRGLQALAEVARALP
FT                   APVVAIGGIGLDDVGAVARAGAACAAVIEAVVGAADPEAAAARMQAAFEAGRAARGANP
FT                   "
FT   gene            103902..104612
FT                   /locus_tag="A2cp1_0094"
FT   CDS_pept        103902..104612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0094"
FT                   /product="peptidase C26"
FT                   /note="PFAM: glutamine amidotransferase class-I; peptidase
FT                   C26; KEGG: ank:AnaeK_0082 peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63453"
FT                   /db_xref="GOA:B8J7W1"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7W1"
FT                   /inference="protein motif:PFAM:PF07722"
FT                   /protein_id="ACL63453.1"
FT                   /translation="MSPRPRIGITLDADASGRRYELPRGYVEAVLDAGGLPILLPHAVD
FT                   VAGAYLSLLDGLVVSGGDFDLPPELYGEARRPGCGPSRPERTRFEKDLLEAALAARLPV
FT                   LGVCGGMQLLDVVRGGTLWQDLPGEAGLHGHEQPAPKDVPSHEVTIAPGTQLAALAGAG
FT                   PLMVNSTHHQAVREPGPGVLVSARAPDGVVEAIELPDLPFALGVQWHPEATRDDPRHAA
FT                   IYRGLVDAARSLRR"
FT   gene            104609..105370
FT                   /locus_tag="A2cp1_0095"
FT   CDS_pept        104609..105370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0095"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="PFAM: Phosphomethylpyrimidine kinase type-1; KEGG:
FT                   ank:AnaeK_0083 phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63454"
FT                   /db_xref="GOA:B8J7W2"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7W2"
FT                   /inference="protein motif:PRIAM:2.7.4.7"
FT                   /protein_id="ACL63454.1"
FT                   /translation="MIPRVLVVAGLDPSGGAGLTADLEALAAVGARGWAVATALTAQGP
FT                   RGARGVSPASEAFLRLQIDALLEGRERPHAVKTGMLGTAGLARALAARLAEPPIARVPL
FT                   VVDPVLLASSGAPLLDPGGVPPGEALAPLLGRARLVTPNLPELAALTGVEVADDEAAVR
FT                   AARMLPARAVLVKGGHREGAPVDLLVEGRRRVTRFTGRRRAGTARGTGCRLASAIAGLL
FT                   AGGASLEEAVRGGKRVVERYLDACGRGAVGR"
FT   gene            106205..106927
FT                   /locus_tag="A2cp1_0096"
FT   CDS_pept        106205..106927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0096"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="KEGG: ank:AnaeK_4066 protein of unknown function
FT                   DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63455"
FT                   /db_xref="GOA:B8J7W3"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7W3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_4066"
FT                   /protein_id="ACL63455.1"
FT                   /translation="MMRGARQLRFRLSPPRAHGGRRAGAGRKPSGARAGVSHQGRPAVT
FT                   GSSPVHVTLRVLPHVWNLRSQRALRVIEGALEAATAARSTFRVVHFSLQVNHLHLLAEA
FT                   DGSRALSSGMQGLCIRLAKGLNRMMGRRGKVFADRYHARVLGTPTEVRIALAYVLLNHR
FT                   SHLARMGKPVGHGGVDRFSSGGWFDGWRGGEAGVAAAVAAREGARRPTAAPRTWLLSTG
FT                   WRCRGLLSLDEVPRAVGG"
FT   gene            complement(106949..108370)
FT                   /locus_tag="A2cp1_0097"
FT   CDS_pept        complement(106949..108370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0097"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: ank:AnaeK_0085
FT                   replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63456"
FT                   /db_xref="GOA:B8J7W4"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7W4"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ACL63456.1"
FT                   /translation="MAESDPARRVAEAGVSPLRSARDLPHSLEAEQAVLGAILVEETAF
FT                   DQVAALLRAGDFYLLAHQHVYGACEELARESKTLDPILIQQRLDAKGLLGSAVPHELPL
FT                   TLARAIGTASNVGHYARTVQDLARLRVMMLTAQRLVERGYEAGANVQHFLDAAQQEVFG
FT                   AAQGTSVDTLKKISEPVLRALENLEAVQKRVQAGLSPITGVPTGIQTLDRNTLGLQPGT
FT                   LTVLAARPSVGKTAFALNIATHAATKAQRKVAFFSLEMPADQLALRMLASEGKLDWRKL
FT                   SQGQLSRHDWDKLATQADRIGAASLWLDDNFVLTPVELRSKCRKLKRENGGLDLVMIDY
FT                   LQLMHAPSDRSNQSREQEIATISRSLKSLAKELECPIVALSQLNRSVEKRKGEPPMLSD
FT                   LRESGAIEQDADIVMFLHRAEEDNKDVQQGTAAGDTLPVQLIVAKQRQGPTCTIDLVFF
FT                   KSTTYFAEMDRRPQQ"
FT   gene            108587..109420
FT                   /locus_tag="A2cp1_0098"
FT   CDS_pept        108587..109420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0098"
FT                   /product="Late embryogenesis abundant protein 2"
FT                   /note="PFAM: Late embryogenesis abundant protein 2; SMART:
FT                   Water Stress and Hypersensitive response domain protein;
FT                   KEGG: ank:AnaeK_0086 late embryogenesis abundant protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63457"
FT                   /db_xref="GOA:B8J7W5"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7W5"
FT                   /inference="protein motif:PFAM:PF03168"
FT                   /protein_id="ACL63457.1"
FT                   /translation="MRSLRLLALTSIVALSGCAALNQLAASAFEKPKLTFRSATLQSLD
FT                   LEGATLGFQFDLENPNGFGLTLARLGYGVEVEGTRIAAGDMPGGLKIPAAGKAPVTFPV
FT                   RVRFKDVPGIVSLLGRQQESIRYKLGGTVGVSTPVGVVDLPISHEDSLKLPRLPGFTLE
FT                   GLSVRSVSLSDLALDVKLRVKNPNAFAIPSGTLDSAVSLAGSQVGRIDGRALAAVPAQG
FT                   STVLTIPLKVDLVRAGRAASELMRGAPVDVGMHGTADLGGLPLPLDLGGRVPVAK"
FT   sig_peptide     108587..108664
FT                   /locus_tag="A2cp1_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.686 at
FT                   residue 26"
FT   gene            complement(109623..110297)
FT                   /locus_tag="A2cp1_0099"
FT   CDS_pept        complement(109623..110297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0099"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: ank:AnaeK_0089 LrgB
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63458"
FT                   /db_xref="GOA:B8J7W6"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7W6"
FT                   /inference="protein motif:PFAM:PF04172"
FT                   /protein_id="ACL63458.1"
FT                   /translation="MIAAAWIAVTAALYAAARALHRRFPRPWLTPLLVVPGALAALLLA
FT                   ARVPYPGYMQGGRLLVDLLGPATVAFALPLHRHAGLLRRHAAELCAGILAGCAVAVGSS
FT                   FLLARALGLARPLALSLAPRSITTPFAMQVAGDLGGVPALAAVFVILTAVVGLVVGQLL
FT                   VRWLPLRSPVARGALFGMGAHAAGTAQAMELGRVEGAVAGVVMIVAGLGVLVATPLLRL
FT                   AL"
FT   gene            complement(110294..110710)
FT                   /locus_tag="A2cp1_0100"
FT   CDS_pept        complement(110294..110710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0100"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: ank:AnaeK_0090 LrgA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63459"
FT                   /db_xref="GOA:B8J7W7"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7W7"
FT                   /inference="protein motif:PFAM:PF03788"
FT                   /protein_id="ACL63459.1"
FT                   /translation="MPRAVPAASPAAPPPRTAALLALPLQLLALGAFWGAGALAARALR
FT                   LPLPGGVVGMLLLLAALRLGVVRAEWLERGAAWLFRHMLLFFIPAAVGAIQYPELLGGE
FT                   GARALAVVAVSTVLVMAVTGATVEWLARRREEAP"
FT   sig_peptide     complement(110654..110710)
FT                   /locus_tag="A2cp1_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.476 at
FT                   residue 19"
FT   gene            110793..111728
FT                   /locus_tag="A2cp1_0101"
FT   CDS_pept        110793..111728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0101"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ank:AnaeK_0091 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63460"
FT                   /db_xref="GOA:B8J7W8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7W8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL63460.1"
FT                   /translation="MDLRGLGAFVEVVRQGGFTRAAAALHVTQPAVSKAVRALEDEIGV
FT                   PLLERGARRTVPTDAGRAVLGRAEGVLAAVRAIEDEVADLGALRRGRARVGLPPMVSGA
FT                   FFPPVLAAYRQRYPGIQLELREEGAREVEALVASGALDVGVTVLPTDEARFEALPFVHD
FT                   VLAAVLHPASPLARRPRLALADLAGTPFLLYRADFALRGRILDACRAAGFLPQVASETG
FT                   QWDFMAAMAAADVGVALLPRTICRRLDPAQVAVVPLAAPAIGWNLGLVWRREGTLSAAA
FT                   RAFVETAREVLLPRRAAGYPAARSRPRTRK"
FT   gene            complement(111689..115141)
FT                   /locus_tag="A2cp1_0102"
FT   CDS_pept        complement(111689..115141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0102"
FT                   /product="methionine synthase"
FT                   /note="TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase DHPS; homocysteine S-methyltransferase; Methionine
FT                   synthase B12-binding module cap domain protein; Vitamin B12
FT                   dependent methionine synthase activation region; cobalamin
FT                   B12-binding domain protein; KEGG: ank:AnaeK_0092 methionine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63461"
FT                   /db_xref="GOA:B8J7W9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7W9"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ACL63461.1"
FT                   /translation="MNFREALERRPLVFDGAMGTQIQRHQLTAAEFGGKEGANDLLTLT
FT                   RPDLIEEIHARYFAVGCDVVETNTFGSSRLKLDEYGLGHRTYEVNCRAAILARRAADRY
FT                   STPDHPRFVAGSIGPTGMLPSSSDPALGNITSDALERIFFEQAKGLVEGGVDALIIETQ
FT                   QDMLELRAAVLACDAVRREALRDVFVIAQPTLIDANGRMLLGTDIGSAVATLERLPVDA
FT                   VGLNCSTGPDEMRASVKALAEKCSHFVSVLPNAGMPENVDGRAVYKLSPDDLARALVGF
FT                   VAEYGVDIVGGCCGTTPEHLRKVVEALRARPAPRRRRPAPAAELSSAMKAVPLAMEPRP
FT                   LVVGERLNSQGSRKVKELLLADDYAGLVQIARGQVEAGAHVLDVCVALNERDDEAAQMR
FT                   TLAKLLAQSVDAPLMIDSTEPDVIEGALKVYPGRCIVNSVNLEKSGERVRRVLPLVRRY
FT                   GAAVVAMTIDEKGMAQTAERKAEVARRIVAVAKDHGIPPDSLVFDALTFTLATGGEEYR
FT                   RSAVETLEGIRRIKAENPGVLTTLGVSNVSFGLAKSAREVVNSVFLYHAVQAGLDLAIV
FT                   NPKDILPYPAIDAAERALAEDLVFDRRPDALARLIAHFGAKGAPEKAAVDPLAGAGGKS
FT                   AEERIHLQILHRRPEGIEALIDEALTRRSAVDVLNQVLLPAMKDVGDRFGAGELILPFV
FT                   LQSAEVMKKAVAHLEQFLEKKAGATKGNVVLATVYGDVHDIGKNLVKTILSNNGFTVHD
FT                   LGKQVPVATVLDKALQVNADAIGLSALLVSTSKQMPFCVEELHRRNLSFPVIIGGAAIN
FT                   RRFGYRTHFAQDGTPYAGGVFYAKDAFEGLEVVEALVDPARREALRREVLQKAVAEKSR
FT                   PAAEPVAQAPARRTGSVAPAARVPAPPFWGPRVVPSGSIALADVWPHLDLAELFKLQWG
FT                   VKAKGAEYERLIREEFGPKLEELKAEAQAQGWLVPKVVYGYFPCHAEGNDLVVLDPAHR
FT                   KAEVARLQFPRQPDDRNLCLADYFREERGADVCALQVVTVGDQATHLAEQAQERGDYTR
FT                   ALFLHGLAVETAEALAEYWHRQVRGELGLADGQGKRYSPGYPSWPELSDQRQVWKLLDP
FT                   VRTIGVSLTDACQMVPEQSTSAIVLHHPDAIYFLVRGLERAAG"
FT   gene            115316..116386
FT                   /locus_tag="A2cp1_0103"
FT   CDS_pept        115316..116386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0103"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ank:AnaeK_0093 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63462"
FT                   /db_xref="GOA:B8J7X0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7X0"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACL63462.1"
FT                   /translation="MIHEARYWEPAAAGKVRCTLCPRDCRIGEGQAGFCFVRRNEGGKL
FT                   VTSAWGRSTGFAVDPIEKKPLAHFHPGARVLSFGTAGCNLGCRFCQNWDISKARLDELH
FT                   SEVDWTPERVVALAREAGCPGIAFTYNDPIIWAEYAIDVADAARAAGLFTVLVTNGYVS
FT                   PDARRDLFARADATNVDLKAFTEEFYRRQTFSHLAPVLETLEWLARETDVWTEVTTLLI
FT                   PGLNDGDAELRDLAGWIRDHMGREVPLHFSAFHPAYKLTDRPRTPPATLTRARAIARAE
FT                   GLRHVYTGNVHDPEGDTTFCPGCGARVIERDGFAVRAVRMKGGACAACGTRIAGRFGDE
FT                   GVRLDDGIPLPLGVPV"
FT   gene            complement(116723..117529)
FT                   /locus_tag="A2cp1_0104"
FT   CDS_pept        complement(116723..117529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0104"
FT                   /product="pseudouridine synthase"
FT                   /note="KEGG: rsp:RSP_2266 pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63463"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7X1"
FT                   /inference="similar to AA sequence:KEGG:RSP_2266"
FT                   /protein_id="ACL63463.1"
FT                   /translation="MPHGLWPPAVIFSGRERTRRAAGGEAGPKSTLAAADGPRSAGPGR
FT                   APGSRHLDVGRAAGPVGVLRRDRVARQQCWAASDGPGGAARAVAVRQLGGRGERAVARA
FT                   AVRAGRALPLDLRRGAGEPPYARRLSRGAREEARPAHDAGAGRAHEGRRGAAPARGAGR
FT                   DEGPGERRRGELPASSVTGALPQRSRGTGPKAQARDRERSVSFDEACSGCEGAGRASSA
FT                   RCRRGRTCGGRSRREAARRARREEALVLLAAISFNIMRLIASRLSA"
FT   gene            complement(117552..117914)
FT                   /locus_tag="A2cp1_0105"
FT   CDS_pept        complement(117552..117914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63464"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7X2"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0094"
FT                   /protein_id="ACL63464.1"
FT                   /translation="MRRLLLVPIALTFALAGCSGPCQDLGDRLCRCVGVGTTRDACERS
FT                   VKEQLQNHNPSKDVEHLCDQRLKTCRAPDGAEFCEWINTACGKASCGLSSDEPETACIP
FT                   AAAAALEGEPVQSVEP"
FT   sig_peptide     complement(117843..117914)
FT                   /locus_tag="A2cp1_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.351 at
FT                   residue 24"
FT   gene            118178..118858
FT                   /locus_tag="A2cp1_0106"
FT   CDS_pept        118178..118858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0106"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: ank:AnaeK_0095 outer membrane lipoprotein
FT                   carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63465"
FT                   /db_xref="GOA:B8J7X3"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7X3"
FT                   /inference="protein motif:PFAM:PF03548"
FT                   /protein_id="ACL63465.1"
FT                   /translation="MTSSFLLALPVALALAASGPAPAAAEPGGAAAARTLEDPRALARK
FT                   VQAFYERTRDLEARFRQAYTYAGFGRRQTSSGTLRVKKPGMMRWDYEKPAAKTVAVKGS
FT                   RLVQYEPEENQAYVDEAFDSSAMSAAVTFLLGKGDLLREFDVSLDGSGALLLRPKESDP
FT                   RVESIALTVAADGQVTATRVVDGAGNANEIRFEDVRRNVGLPDAAFEVKLPRDVRRIAA
FT                   PKAQ"
FT   sig_peptide     118178..118255
FT                   /locus_tag="A2cp1_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 26"
FT   gene            118875..120347
FT                   /locus_tag="A2cp1_0107"
FT   CDS_pept        118875..120347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0107"
FT                   /product="protein of unknown function DUF853 NPT hydrolase
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF853 NPT
FT                   hydrolase putative; KEGG: ank:AnaeK_0096 protein of unknown
FT                   function DUF853 NPT hydrolase putative"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63466"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7X4"
FT                   /inference="protein motif:PFAM:PF05872"
FT                   /protein_id="ACL63466.1"
FT                   /translation="MSDPILVAKAARAGAGFTDLALLPRLANRHGLVAGATGTGKTVTL
FT                   RVLAEGFSRLGVPVFLADVKGDLSGMARPGGEAPKLAERAQQLGIALAPEACPVAFLDV
FT                   YGEAGHPLRTTISEMGPLLLARVLGLNDVQAGVLNVAFRAADEGGLLLLDLKDLRAMLE
FT                   HVSENAAALRARYGNVSPTSVGAIQRALLALESQGADRLFGEPALALEDLLRTDLSGRG
FT                   QVTILHAEKLIRAPTLYATLLLWLLSELFEQLPEVGDPEKPRLVFFFDEAHLLFDDAPD
FT                   ELRQKVEQVVRLVRSKGVGVYFVTQNPLDVPDVVLGQLGNRVQHALRAFTPRDQKAVRA
FT                   AAETFRANPGVDVERAITELGVGEALVSFLDEKGTPHPVERAWVLPPRSRLAPLTAEER
FT                   AQVVASSPLRGRYDAPVDRESAYELLQRRARATVAEPAPGGRAAPAPRTVGTEAASALG
FT                   KMAQSAMRAAGTQLGREIMRGILGSMFGGRRR"
FT   gene            120448..121866
FT                   /locus_tag="A2cp1_0108"
FT   CDS_pept        120448..121866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0108"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ank:AnaeK_0097
FT                   integral membrane sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63467"
FT                   /db_xref="GOA:B8J7X5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7X5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL63467.1"
FT                   /translation="MLEAADAALRAAVADAVREARRRSAEAVAWMRVALRGAILLVYLP
FT                   GWHEPAPWHAAALRVSVAYLAFAGGVLALLRRRWRWEAVALGAAAIDLAVVAVGSWRVV
FT                   ALAGGNLALAVAAGAGNGMMLMVILFAALALPAAPAAAISAVAVANQMALAAHSDVSWR
FT                   LVLVVGLMLSAAAFVAIRNTMRATALAARLAAETYTASLCRAHGEAMARASAEAVAQRD
FT                   EVVAAHRQARDLVRLMVHDLKNPLAALLQYLRLAEVELRGQPGAGPVREDLAQAEGEGQ
FT                   RLSEMIGDLLAISRLETGPVRLAADPVSVGDLLQAVARSCAPHARERGVTLSVRGGEDL
FT                   VVRIDRDLSRRLLENLVSNALRHCRTGDRVELAGEADGEGVRLAVRNSGPPVPAAIRAH
FT                   LFEKFAPGEAREWTSAGLGLYLCRLVAEAHGGGVALVDTPGWTVSFEARLAPPQAGGEA
FT                   APHAAALAPERRPG"
FT   gene            121876..122730
FT                   /locus_tag="A2cp1_0109"
FT   CDS_pept        121876..122730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0109"
FT                   /product="protein of unknown function DUF1684"
FT                   /note="PFAM: protein of unknown function DUF1684; KEGG:
FT                   ank:AnaeK_0098 protein of unknown function DUF1684"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63468"
FT                   /db_xref="InterPro:IPR012467"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7X6"
FT                   /inference="protein motif:PFAM:PF07920"
FT                   /protein_id="ACL63468.1"
FT                   /translation="MPGNLAPLSLVLLPLVLAACNRRPPADPAFAAEWKAWHDRREERL
FT                   RTPTGWLALTGLHWLEPGENRIPGLPGTFTLEAGRVTLAAARSDGYVLGGAPVERRALA
FT                   PDSAGEPDRVQVGSVTLAVIERSGRFAVRVWDAAAPARTGFRGIEAYPPDPRWRIEARW
FT                   EAYPSPREVEVPSVIGVATRELAPGRAHFTVEGRELTLEPTAEEDGGLFFVFKDATSRD
FT                   ATYGAGRFLSAGAPREGKVVLDFNRSVNPPCAFSAFATCPLPTPENVLPVRIEAGEKRY
FT                   SDH"
FT   sig_peptide     121876..121935
FT                   /locus_tag="A2cp1_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.705 at
FT                   residue 20"
FT   gene            122981..123421
FT                   /locus_tag="A2cp1_0110"
FT   CDS_pept        122981..123421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0110"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   ank:AnaeK_0099 hemerythrin-like metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63469"
FT                   /db_xref="GOA:B8J7X7"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7X7"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ACL63469.1"
FT                   /translation="MGMEWTARLAVGIDDIDAQHRELFRRVNGLVTAMGERRGREELAE
FT                   VVAFLRAYVDVHFEAEARLMARTRYPGRAFHAAEHAHFRAQVEEVASRIAADGAESHHA
FT                   VKLAGLLCEWLRQHVLLTDRQLADHVRAEDLLDDRWRGGGEG"
FT   gene            complement(123434..124843)
FT                   /locus_tag="A2cp1_0111"
FT   CDS_pept        complement(123434..124843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0111"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: ank:AnaeK_0100 MiaB-like tRNA modifying enzyme
FT                   YliG; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   MiaB-like tRNA modifying enzyme YliG; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; Radical SAM
FT                   domain protein; Protein of unknown function UPF0004; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63470"
FT                   /db_xref="GOA:B8J7X8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7X8"
FT                   /inference="protein motif:TFAM:TIGR01125"
FT                   /protein_id="ACL63470.1"
FT                   /translation="MATRVYMHTLGCPKNRVDSEVMLGTLAEAGYRLVQDPAQAEVIVV
FT                   NTCGFIESAKEESVEAIVELADQKREGRCRKLVVTGCLVQRHAEELARELPEVDHFLGT
FT                   GAYQDVARIVSDAQAKRLVVPDPDFVHSSATPRVNSLPSHTAYLKIAEGCDNACAFCII
FT                   PKLRGGQRSRPIDDLVAEAAALAAQGTVELSLVAQDLTAYGQDLPGKVRLHHLLPELAK
FT                   VDGIRWIRLHYAYPRDVPDALVAAIADEPKIVKYLDMPLQHSSDRLLRAMKRGRDSVFL
FT                   RDLLARLRSRIPGLALRTALIVGLPGETEADFEDLLRFVEEQRFERLGVFEYSAEEGTP
FT                   AAEMADQVPDALKRERRDRIMAVQQAISRAHQQAMIGRRVEVLVEGRAEETEHLLAGRH
FT                   AQQAPEIDGLTYINDGVAYPGEIVTVEITDAAEYDLVGRVVARDPSRAARPLPAAPRPP
FT                   APRKGGLNVLG"
FT   gene            complement(124928..125416)
FT                   /locus_tag="A2cp1_0112"
FT   CDS_pept        complement(124928..125416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0112"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   ank:AnaeK_0101 protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63471"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J7X9"
FT                   /inference="protein motif:PFAM:PF04461"
FT                   /protein_id="ACL63471.1"
FT                   /translation="MPSFDVVSEVDLMEVENAFNQARKEIAQRFDFKGTHTELERDKEQ
FT                   NVLIRAGSEGRAEAALQVLMEKLAKRGVALESLDPQKLEPASGGHVRQLVKLKRGLKIE
FT                   DARKIVAKVKESGIKVQAAIQGEAVRVTGKKRDDLQAAIHAIRAAAFPIPLQFQNFRD"
FT   gene            complement(125456..127096)
FT                   /locus_tag="A2cp1_0113"
FT   CDS_pept        complement(125456..127096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0113"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG:
FT                   ank:AnaeK_0102 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63472"
FT                   /db_xref="GOA:B8J7Y0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Y0"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACL63472.1"
FT                   /translation="MRIVPLGGLGEIGMNCMAVECDGRIAVVDCGVLFPNESLGVDLIA
FT                   PDLSWLRERREQVGAVFLTHGHEDHLGALPFLLREVPVPVYGTRFTLALLRPRLDEAGV
FT                   RADLREVRPGDVRPAGDASPIAAEFFSVTHSIPDACGLALSTPQGTLLHSGDFKIDPAP
FT                   VRGPGMDLGRIEALGRKGVRLLLSDSTNAEREGTSLSESQVGPALEQAFELARGRVFVA
FT                   CFASNVHRLQQIVDAARAFGRRVAFLGRSMEANARLAQELGYLELPGWMPVSPEEARTL
FT                   PPRELCVLTTGTQGEPRSALARLARGEHPDLAVSPGDLVVLSSRFIPGNEIAIGQVVNE
FT                   LCRRGAEVAYEGLAPLHVSGHAQADEQRRLIRLARPAHFVPIHGEYRHLSRHAAHAAAE
FT                   GVAGRDVLVDGQVLELADAGVRVLDEPVATGRVYTDRDALLGADIGALVVRDRRLLAET
FT                   GLCIAVLAIERTTGAVVRGPELFARGVAGFEGAEEELRAEILAGLGDLSPKARTDPAEV
FT                   QEAVRLAVRRFFRRTTGKKPPVLPVVLEL"
FT   gene            127205..128332
FT                   /locus_tag="A2cp1_0114"
FT   CDS_pept        127205..128332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63473"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Y1"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0103"
FT                   /protein_id="ACL63473.1"
FT                   /translation="MVAARRILALPLAFALAALPAAPGADGPARGATPAPPAAEAEPRA
FT                   AGPELVRLRWAWPAPLEAQVTCRRTRVRTGAPPSVFTARYRQRAALAGAGEPGLAISTR
FT                   GTTWEGDLPWAPPVARQALHASEQLVQRIGPDGAFAALEGAEALRPALRSLVDGAGVQG
FT                   AQAERAVARAEAAARGEAEELWNLSVGFWIDADLVLGQEYVMPSETELPLLPGVRGPAS
FT                   VEFAVRRRVPCAAAERAARCVEIVLHATPEPAALARHAAALRARLAEGAEGPVAVPAAH
FT                   GRDGGELEAEGTLVLVTDPATLVPRRVAWTRAVRLATGDDGAPALEHVDRVEYDYRYPG
FT                   KAPAAPPAHRRRRVPGTPLEPAPVPAPVPVQLPAA"
FT   sig_peptide     127205..127282
FT                   /locus_tag="A2cp1_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.978 at
FT                   residue 26"
FT   gene            128355..130748
FT                   /locus_tag="A2cp1_0115"
FT   CDS_pept        128355..130748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0115"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: ank:AnaeK_0104
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63474"
FT                   /db_xref="GOA:B8J7Y2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Y2"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACL63474.1"
FT                   /translation="MGYLPAPVAEDLLQDLNDAQREAVLHDDGPLLVLAGAGSGKTRVI
FT                   VHRIARLVRDRGVVPWHVLAVTFTNKAAGEMRERLERLLGPLARELWVQTFHAFGARFL
FT                   RREAARAGLSPSFAIYDDDDQLRLVKGLLSELGLDEGEGLTPRQVLSQIDRWKNQALRA
FT                   AEVKVAGLDPEAARTKEVYHRYEQALARAGAVDFGDLLLRPVRLLEEDAALRARWAGRF
FT                   RYLLVDEFQDTNPVQYRLLQLLTGPRRNVCVVGDDDQAIYRWRGADVSNILGFDGDFPG
FT                   TKVVKLEQNYRSTRTILDAAHAVISRARRRRDKRLWTESGAGAPLALLVGEDEHAEAER
FT                   IARAVAAERGRGTSGDEIAVLYRTNAQSRPLEAAMRAARIPYVIVRGTSFYERAEVRDA
FT                   AAYLRLALSPASDLDLERVVNRPPRGIGDKTVERLRAHAAARGLPLVEAVAERDAVAEL
FT                   KPAARRALAEFHALVTGLAADVPALDAGVAVQEVLKRSGMLARLEEEHTDEAVERAENL
FT                   AELVAAAREFDESIAGEPPPGDPEEVRPPPLARFLEQIALLGEADAATPEGRVALMTLH
FT                   AAKGLEFEAVFLAGMEDGTLPYERPWADQTASERDESLDEERRLCYVGMTRAKRRLTIS
FT                   LARRRIGYGENGPSYRNMEPSRFLRDLPPELFGDAVAREVRAREAARAAPVARPPTIRR
FT                   LPGALEGEPHIELDGDELSQPAAPAPRARPAAPRGEPTVDYSFDQRGDAGAAAFSRGER
FT                   VAHASLGEGVVLACDAGGADAKATVRFASAGDKRVLARFLRRAF"
FT   gene            130845..131975
FT                   /locus_tag="A2cp1_0116"
FT   CDS_pept        130845..131975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0116"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: ank:AnaeK_0105 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63475"
FT                   /db_xref="GOA:B8J7Y3"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Y3"
FT                   /inference="protein motif:TFAM:TIGR01430"
FT                   /protein_id="ACL63475.1"
FT                   /translation="MAQAAATTLPQVTEALVRDLPKTDLHCHLDGSVRLATVLDLAAQQ
FT                   GVRLPAETPEGLAKAIHMGEVCASLEDYLTAFDVTLAVLQTEEALYRTAYELALDAAAE
FT                   NVRYLEVRYSPVLHTRKGLKPTSIVDAVLAGLRAARRETGIESNVIICGIRHIDPMTSV
FT                   RLAELAVAYKGKGVVGFDLAGAEEGHPARRHRDAVQLILDNNVNVTIHAGEAFGPESIA
FT                   QAVHWCGAHRIGHGVRLRENGDLLNYLNDHRIPLEMCPSSNVQTGSVQGFASHPLKFYF
FT                   DFGLRVSVNTDNRLITDTTVTKELLVAHREMGFTLEDLCTVLVQGFKSAFLPFRDKQEL
FT                   LRRVNLEIAQVLARHGAPAPVAGDGAARAAVEAGTP"
FT   gene            131972..132457
FT                   /locus_tag="A2cp1_0117"
FT   CDS_pept        131972..132457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0117"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: ank:AnaeK_0106
FT                   methylated-DNA/protein-cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63476"
FT                   /db_xref="GOA:B8J7Y4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Y4"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACL63476.1"
FT                   /translation="MTARLRYRSPVGILTVEASDEGVFGLSFGDRGPSRPGPSARARAH
FT                   LDAAARALDDYFAGRPPSLPPLVLQGSPFQKRVWDALLAIPWGDTRTYGEVAEALGAAG
FT                   GARAVGGANHENPVAILVPCHRVVQARGRLGGYGGGVEVKRWLLAHEAAHGPALRPA"
FT   gene            132605..133846
FT                   /locus_tag="A2cp1_0118"
FT   CDS_pept        132605..133846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0118"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="KEGG: ank:AnaeK_0107 glucose-1-phosphate
FT                   adenylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63477"
FT                   /db_xref="GOA:B8J7Y5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J7Y5"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ACL63477.1"
FT                   /translation="MAKLLAMILAGGEGRRLDPLTRDRAKPAVPFGGRYRIVDFVLSNM
FT                   ANSGILKMKVVVQYKSESLNTHVQRAWRLTSLLNQYVELVPAQMRVGPKWFEGSADAIY
FT                   QNLNIITDEEPDFTFVFGADHVYRMDARQMLEFHLDRKAELTVAAVPIPVQEASEFGII
FT                   EVDADGRMIGFVEKPQSAPKTIPGDPTRCLASMGNYLFSTDALVQEIVRDAGDPSSAHD
FT                   FGKSIVASMYQRKRVYVYDFARNVVPGQTERERGYWRDVGSIDAYFQANMDLVAVDPVF
FT                   SLYNDEWPIFTVQYNYPPAKFVFNNESDHRVGRATDSLVSEGCIISGSHVHHSILSPKV
FT                   RVNSYATVDESIVFENVNIGRHCRIRRAIIDKHVDIPAHTTIGYDHEKDRKHFHVTESG
FT                   IVIIPKGMRIEAGR"
FT   gene            complement(133977..134363)
FT                   /locus_tag="A2cp1_0119"
FT   CDS_pept        complement(133977..134363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0119"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ank:AnaeK_0108 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63478"
FT                   /db_xref="GOA:B8J7Y6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Y6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL63478.1"
FT                   /translation="MAPEPSPLRILVAEDDPAVARLYTAYAQSRGHTVLVAHDGAEAFS
FT                   AAADQGPDLILLDVAMPKVDGRDALRRLKADPRTQGIPVLVISAHGSDQNLRELMLGLG
FT                   AWDVMEKPVDLQIAFNKAERLARR"
FT   gene            134502..135878
FT                   /locus_tag="A2cp1_0120"
FT   CDS_pept        134502..135878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0120"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ank:AnaeK_0109 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63479"
FT                   /db_xref="GOA:B8J7Y7"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Y7"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL63479.1"
FT                   /translation="MIASPLLVAALLTAAPAAAAPPPGDAPEIPYTMFTLGNGLTVILH
FT                   EDHTAPLVGVHVQYDVGSKDERPGRTGFAHLFEHLMFQGSAHLPKGEADRLVDAAGGEA
FT                   NGGTSPDSTVYWEQVPSGALEQMLFIEADRMGWMFPTLTQEKLDNQRDVVRNERRQSYE
FT                   MQPYGLVFEKLLANLWDPEFPYHWQTIGTHEDLEAATLADVKQFFERWYGPENAVLAIA
FT                   GDIDPARTRALVEKWFGPIPGKARPAHQPPAPKPLAAEQRVSMDDRVQLPRLYLAWQTP
FT                   RVFAPGDAALDVLSSVLSDGKSARLVKRLVMDEQIAQGVSAGQMSQALASMYLVVATPK
FT                   PGIPLERLEREIDEELARIAREPPSAEEVQRAKNKIEAGAVFGLEPVGGFGGRAASLAG
FT                   YYVRTGDPGYLAKDLARYRAVTPADVSEAARRFLRKDARVVLTVHPRPAAAGAAAGSAR
FT                   "
FT   sig_peptide     134502..134561
FT                   /locus_tag="A2cp1_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            135875..137437
FT                   /locus_tag="A2cp1_0121"
FT   CDS_pept        135875..137437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0121"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ank:AnaeK_0110 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63480"
FT                   /db_xref="GOA:B8J7Y8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Y8"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL63480.1"
FT                   /translation="MTRSLRLLAVLLAAALGCAGSRPAPAPAAPAAAPQPQAAAAPAGA
FT                   DRTQVPAAGEAPELHLPRQQHFALANGLRVRLVEHRRLPIVALNLVVRAGAVNDPAGLP
FT                   GLASFTASMLTEGGTRSRTATRLSDEVGFLGASLGAGTGQDAASLSGSSLSRHLPKLLD
FT                   LFADVAMNPAFRAKDFARVQDQRKVTLLQQRDQPATIAGKAFLKAYWGEGHPYGHYVLG
FT                   DEASVAATRPADLAAFHARFWRPANAELVVVGDVSEAELRPLLERTLGKWPAGTAAAAP
FT                   RAPAPAAPHVTLLLDKPDAPQTLVMLGMPGLARASPDYVAATVAFQVLGGGMSSRLFRT
FT                   LREEKGYTYGMGAGADARRLGGVSIVHGNVKAEVTGAALGDLLGEIRKLRDQPVGDAEL
FT                   ADARNALVRSLPADFATVGGIAGRVAELVIHGLPDDYWNGYADAVRDVAPADVQRIAER
FT                   YLDPARATLVLVGTPAAVRPQLEGLAIGKVEVRPVPGAAPVRAPPRSPRVRTQRPPTSS
FT                   PAP"
FT   sig_peptide     135875..135973
FT                   /locus_tag="A2cp1_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.806 at
FT                   residue 33"
FT   gene            137669..138598
FT                   /locus_tag="A2cp1_0122"
FT   CDS_pept        137669..138598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63481"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Y9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0111"
FT                   /protein_id="ACL63481.1"
FT                   /translation="MADLQNEFSWSKSRHEKFAECRRAYFYAYYGSWGGWEAAHGTPVR
FT                   ELYVLKKLSSRWQWAGSVVHGALKQMLSAARVSGTFWPAEKLLDRTRRKARAEWASSRD
FT                   KSYWREASRITGLVEHEYGEPVSDADWKRLFEQVVDGGLRGFYASEAFEAIRATPRDRW
FT                   LSVDELDAWDFEGTKIWVAVDFAYRDAESRVQILDWKTGRERTVDHTQLGIYSLYAQRK
FT                   WGAAPDAVVGGLVYLAAPEDGGAGRVSVAVDPAALSACQDAMRGSIASMRAALADPARN
FT                   VAVEDAFPRPDDRVACRRCPFRRPCGRL"
FT   gene            complement(138595..139014)
FT                   /locus_tag="A2cp1_0123"
FT   CDS_pept        complement(138595..139014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0123"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ank:AnaeK_0112 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63482"
FT                   /db_xref="GOA:B8J7Z0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Z0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACL63482.1"
FT                   /translation="MRAAVRGVPAGALPDRLRAAWASLPPLYHLWAMSAGGERYLVAER
FT                   GGRVAGYAAWRGAELTAVFVRPSAAGRGVGAALVAAVERRARNDGFRALRVLAAAPAIG
FT                   FYARLGFRPGRAARAPLPGGLGLPARWMRKPLATG"
FT   gene            complement(139089..140468)
FT                   /locus_tag="A2cp1_0124"
FT   CDS_pept        complement(139089..140468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0124"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: ank:AnaeK_0113
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63483"
FT                   /db_xref="GOA:B8J7Z1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Z1"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACL63483.1"
FT                   /translation="MASAKKPNLMVIDDLDSARQMMKRTLARSYDVYDFPSVAEAVPAV
FT                   ERADFDCIVTDLRMPGIDGIEGLRRFQAKVPEIPVILVTAFATVETAVEAMKAGAFDYL
FT                   KKPFEPEELELVVARAVEHARVKKENARLRSALAGQFSVHGIVGKSQSMKDLVSMLERI
FT                   APSDVPILIEGESGTGKDLLARAAHALSSRAQGPYVALNMSAIPENLAESELFGHEKGA
FT                   FTGADQPRAGFFAAAEGGTLFLDEIGLLPPALQPKLLRVLQDGEFIPVGSRKARKANVR
FT                   VVAATNEDLLRRVKEGKFREDLWFRLRVVPLRLPPLRERREDIPLLVEHLVQKHALRLS
FT                   RPPLQPDAEAMRALLDHPWPGNIRELEHAIERGLLLARGEAIALADLPPELTPSGDAAG
FT                   GADEGRYRRARDAWEKRFLEDVLREAGGQVARAAELSGLHRSTFYEKLARHGLADKDAK
FT                   P"
FT   gene            complement(140471..141967)
FT                   /locus_tag="A2cp1_0125"
FT   CDS_pept        complement(140471..141967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0125"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ank:AnaeK_0114 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63484"
FT                   /db_xref="GOA:B8J7Z2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Z2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL63484.1"
FT                   /translation="MTLRLKLFVLIAGVIIFAMSGVTAVALWRELVRGQELLLREGVAL
FT                   ASTTATGASHWVREGGVDPGGPEALPALLERLVSSAPLDRAWIVDSAGKVLACVSRTGE
FT                   PCPEGVPPSEFQAADWPLQTLSRLVRPEGIVASAPIVRAGAVVGAVRVDFTHEEVVGAA
FT                   RDLAWGAAAVAAFWIALGHLLAAIFIRQVTQPLVSLASAAESLAEERGVRLEEPEDREL
FT                   VDLVRAFNHMSARLDERRAENQRLIAELEERVAQKTREVLRADRLATLGGIAAGFAHEL
FT                   GNSLNVIRGYAAVTSRELPDDSPHRSDVEAIRREVTRAAGLIERFLVFARARTVHPLVQ
FT                   PVEPILREAVEVLGPAAAHAKVERAVEVEPGLPEVLADAELLRQAFLNLGVNAVQAMQD
FT                   RGGGKLTVRALREPGGLVVEFHDTGPGIDAEAAAHVFEPFFTTKASGTGLGLAIVRQAA
FT                   EAHGGTVEVAGAPGAGATFRVHLPAAEAGAAADAAAGGAG"
FT   sig_peptide     complement(141893..141967)
FT                   /locus_tag="A2cp1_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.818 at
FT                   residue 25"
FT   gene            complement(141964..142893)
FT                   /locus_tag="A2cp1_0126"
FT   CDS_pept        complement(141964..142893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63485"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Z3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0115"
FT                   /protein_id="ACL63485.1"
FT                   /translation="MRLSRNAKTILAGLAALALVGLVAGFLRFKEFVDEDPRLCATCHR
FT                   ASPEFALWMGGTHRSVSCQRCHHSTPEQGLAMLRAFLAGQKPKGKHAEVEVGACAQCHF
FT                   SHDPRWPQVGNSRGHRIHYQERGIACVRCHAASMHGFEPVAKKCEECHPRHAVGVEKMA
FT                   ALHCFACHEFLGSEQGLRPTRRDCMRCHTAQGIHAPMNEHGATHGAPMEMSCSACHRPH
FT                   RPAGQTLAACAECHGSDAMAKGGLHAIPGHRTCLECHKPHTWTAEQADCLRCHPSGKAH
FT                   AEGTACTTCHAFVGAPLPTFPTDEGGAR"
FT   sig_peptide     complement(142792..142893)
FT                   /locus_tag="A2cp1_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.246 at
FT                   residue 34"
FT   gene            complement(143011..144711)
FT                   /locus_tag="A2cp1_0127"
FT   CDS_pept        complement(143011..144711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63486"
FT                   /db_xref="GOA:B8J7Z4"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Z4"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0116"
FT                   /protein_id="ACL63486.1"
FT                   /translation="MRATLLAIALLLSTAARAEEAKPAPALPADAESCLMCHDKGGGAP
FT                   EVDFKAFPGSVHGQNEVGCTDCHAGYKEGPHEGELPALSAAEQATVARLAKGAWGEGEA
FT                   KHGVTAPRAYLACQNCHTTEAEAFATSVHGKWLAGDTRAPGATCASCHGSPHAIPAKLA
FT                   EYAPKDGKRVPVPADRREMTKRCEACHGNEAFAEAAGLDPEAVITYHDSIHGRLTRVGN
FT                   AAAPTCVSCHAAAKDAGGTHAIVSKTDPASTVSAANKKQACARCHAGATDTFAGLVAHK
FT                   PLHETGGSVIPHIVHVAFSWLTTLTLLFFAFHVLVDFIYELRSRLAKKAGHGPSADAIR
FT                   SVIRFDLHQRIQHWFMLSGVILLGITGWPLRGAGDAEAAAYSRAFMKVFGGAEGAATWH
FT                   RVGAVLIIISSVYHLFYLTFLASKKRLPLSMLPVPKDALDMRDNLLFMMGVKKERPKFD
FT                   RYMYLEKFDYWAVFWGIVMMVGTGFIFWFPVWFASWAPGWLITAAQIIHGEEATLAILF
FT                   LFTVHFYNVHLKPSIFPMNWAWLNGRISIEAMKHEHPLEYDRLKDEQNG"
FT   sig_peptide     complement(144655..144711)
FT                   /locus_tag="A2cp1_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 19"
FT   gene            complement(144966..145274)
FT                   /locus_tag="A2cp1_0128"
FT   CDS_pept        complement(144966..145274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63487"
FT                   /db_xref="GOA:B8J7Z5"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Z5"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0117"
FT                   /protein_id="ACL63487.1"
FT                   /translation="MAQNKLPSLIGAGIGLALFLAIALLPALLYGGYAGLLLAGGIVGT
FT                   PVQPTLLVRGLIVFGMGLGVVGVASLFAVSGAAAGAAVGALLAIAGRRPVAQEQSGR"
FT   sig_peptide     complement(145155..145274)
FT                   /locus_tag="A2cp1_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.593 at
FT                   residue 40"
FT   gene            complement(145470..147215)
FT                   /locus_tag="A2cp1_0129"
FT   CDS_pept        complement(145470..147215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0129"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; KEGG:
FT                   ank:AnaeK_0118 peptidase M14 carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63488"
FT                   /db_xref="GOA:B8J7Z6"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Z6"
FT                   /inference="protein motif:PFAM:PF00246"
FT                   /protein_id="ACL63488.1"
FT                   /translation="MLAPTLAPLLALALSAGPDLTTTAERTGFRETGRYDEAVRLCRGL
FT                   AAAYPARARCLTFGETPEGRPLVALVASAGGGLDARAARAARRPVVLLQGGIHAAEIDG
FT                   KDAGFLVLRELLASRDGGPLAKVTALFVPVLNADGHERFGPNHRPNQRGPETSGWRTTA
FT                   QNLNLNRDYVAAQAPETQAVLRLMDAWDPIALGDLHVTDGAQFQHDLAVMVEPRQGYSP
FT                   AMREEGAALSAALVERLAAAGHLPLDFYPSLREDGDPASGFAPYPAPIRFGHGYWAARN
FT                   RFGILLETHSWRPYPHRVKATAHFVRALLDLAAERGGRWRAAADRADREGAAARGREVE
FT                   LGWAPGSRTRPLAFQGYAYVREDSPVLGKKVPRYDETRPEVWNVPVVDELVVTARARVP
FT                   VGGWIVPAAHAGWVAGKLRLHGIAFERMASRRAAAQVEAFRATGVEVKAQSFEGRHQTA
FT                   LTGAWAPEARDLAAGWLWIPSAQPLGTLAAMLLDPAGPDAFVAWGAFATAFEKKEYIED
FT                   YVLEPWARALLARDPAVKAEFERRLADPAFAKDPAARLDFFWRRHPAHDEAYRLYPVLR
FT                   ADRRP"
FT   sig_peptide     complement(147150..147215)
FT                   /locus_tag="A2cp1_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.709 at
FT                   residue 22"
FT   gene            complement(147474..148508)
FT                   /locus_tag="A2cp1_0130"
FT   CDS_pept        complement(147474..148508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0130"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: ank:AnaeK_0119 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63489"
FT                   /db_xref="GOA:B8J7Z7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Z7"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACL63489.1"
FT                   /translation="MLNFVHNILSRDLAIDLGTANTLIYIRGMGIVSNEPSVVAVQADG
FT                   RGSRRVLAVGKEAKEMLGRTPGNIVAIRPMKDGVIADFEVTAAMLKYFIQAAHNRKSFV
FT                   KPRIIIGIPSGITEVEKRAVREAAESAGAREVYLIEQPMAAAIGAGLPITEPSGNMIVD
FT                   IGGGTSDVAVISLGGIVYSRSVRVAGDKMDEAIIQHVKRKYNLLIGERTAELIKMGIGT
FT                   AYPTEEELTMDITGRDLVAGVPRTLTVTSSEIREALAEPINGVVEAVKVTLERTPPELA
FT                   GDIADRGIVLAGGGALLKNLDVLLREETGLPVFLAEDPLSAVVIGAGKALEELDILRQV
FT                   TAQG"
FT   gene            complement(148641..149675)
FT                   /locus_tag="A2cp1_0131"
FT   CDS_pept        complement(148641..149675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0131"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: ank:AnaeK_0120 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63490"
FT                   /db_xref="GOA:B8J7Z8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Z8"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACL63490.1"
FT                   /translation="MLDWLHNMMSRDLAIDLGTANTLIYIRGMGIVSNEPSVVAVQQES
FT                   RSGRKVLAVGKEAKEMLGRTPGNIVAIRPMKDGVIADFEVTAAMLKYFIQAAHNRKSFV
FT                   KPRIIIGIPSGITEVEKRAVREAAESAGAREVYLIEQPMAAAIGAGLPITEPSGNMIVD
FT                   IGGGTSDVAVISLGGIVYSRSVRVAGDKMDEAIIQHVKRKYNLLIGERTAELIKMGIGT
FT                   AYPTEEELTMDIKGRDLVAGVPRTLTVTSSEIREALAEPINGVVEAVKVTLERTPPELA
FT                   GDIADRGIVLAGGGALLKNLDVLLREETGLPVFLAEDPLSAVVIGAGKALEELDILRQV
FT                   TAQG"
FT   gene            complement(149726..151750)
FT                   /locus_tag="A2cp1_0132"
FT   CDS_pept        complement(149726..151750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0132"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; WD40 domain protein beta Propeller; KEGG:
FT                   ank:AnaeK_0121 peptidase S9 prolyl oligopeptidase active
FT                   site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63491"
FT                   /db_xref="GOA:B8J7Z9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8J7Z9"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACL63491.1"
FT                   /translation="MLTAALVALALASVPRPFTVDDLLALERAGDAAVSPDGASVAYTV
FT                   ATSSAGGEKLVSALHLVPAAGGAARRLTFGEERVTSPAFSPDGRRIAFLSNRKGGTQAW
FT                   VLDLQGGEARRVTDLPGGVSELRFTPDGAALVVASDVDPACGADAACNRKADAAAEVRP
FT                   HLTDRLLFRHWNEWRERVRTHLVRVPLDGGPAVDLTPGDRDAPPVQRGSGDDLAFSPDG
FT                   KTLYYVAVSDPVEATSTNGDVYAVPLAGGTPRRVTTAPGWDGSPRPSPDGKRLAWLAQP
FT                   RAGYEADRFHVMVAAADGSGARDLTAGFDRSAADLEWARGGKALRFTAESEGVHAVYEV
FT                   DLAGKVTELYRGRNLARVSWSRDGARLAALVDGLAAPPEVAVLEPGARGPQPRLLTGFG
FT                   AKGLTGVALGEVRPLAATGKDGQALHGWMVLPPGHRDGQRHPAVVLVHGGPQGAWNDAW
FT                   SFRWNPMLYAARGWTVVLPNPRGSTGFGQAYTDAVRGNWGGTPYDDIMRLTDAAVATGA
FT                   ADGDRMCAAGASYGGYMVNWINGQTDRFRCLVAHAGNFDLRMAYYDTEELWFPEWELGR
FT                   PWEASEAFERWSPSAFVGRWRTPTLISHGEKDFRVTVTQGFAAFTALQRRGVPSRLMVF
FT                   PDEGHWVLKPRNAKVFHDEVLGWIGRWLESPAPQASAPR"
FT   sig_peptide     complement(151691..151750)
FT                   /locus_tag="A2cp1_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.734) with cleavage site probability 0.732 at
FT                   residue 20"
FT   gene            151847..153619
FT                   /locus_tag="A2cp1_0133"
FT   CDS_pept        151847..153619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0133"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; Serine/threonine
FT                   protein kinase-related; SMART: serine/threonine protein
FT                   kinase; KEGG: ank:AnaeK_0122 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63492"
FT                   /db_xref="GOA:B8J800"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B8J800"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACL63492.1"
FT                   /translation="MPGPLAIPDLRAPCPGCGHLAEPTGGPLNFCPRCGLDLRETARRA
FT                   PPADPLVGRVIADRYRLVSLLGEGGMGAVYRAEHVQMGKALAVKVLRGDFARDPSAAER
FT                   FRAEARIVSRLSHPHTIAVFDFGELPERGFYLAMEYVPGQDLARALREGGALSEARAVG
FT                   IAQQVLGSLAEAHESGVVHRDMKPANVMLMQARPGEDFAKVLDFGIAKLRDEAGGATTG
FT                   AGAVVGTPSCLAPEQARGGPVDARADLYAMGCLLYELVSGRPPFTAASPVAVITAHLHD
FT                   APPPLREVAPGVSRRLAEVVHRALRKDPAERFPSADAMRDALAGPGHAARPSRRPALPR
FT                   AAGELELASREDFRDGLEQGALERQVGVLRPPRLVTPARAALAIAAALAAGAAWRWDDL
FT                   YAALAAAAPAIATQVPAALRPDAAAWVEREPNDGAAEATPLPLLPRADGVPAAEVRGAI
FT                   GAPRRPDEGDLDVYRLVVPDGAGGRVLRARWHAAGAAPDQGIPGLAVTLSLNRAPAGAE
FT                   RAPLVAAAGEGGPGAAEALSAEVEPGTYWLSVRERHAAGAAPAARPEAPYALEVELAPR
FT                   AASEAAGEGDGPHK"
FT   gene            complement(153671..154120)
FT                   /locus_tag="A2cp1_0134"
FT   CDS_pept        complement(153671..154120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0134"
FT                   /product="ribosomal protein L9"
FT                   /note="PFAM: ribosomal protein L9; KEGG: ank:AnaeK_0123
FT                   ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63493"
FT                   /db_xref="GOA:B8J801"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J801"
FT                   /inference="protein motif:PFAM:PF01281"
FT                   /protein_id="ACL63493.1"
FT                   /translation="MKLILREDVENLGKGGDLVDVKPGYGRNFLLPRGLAVTANPKNVK
FT                   ELEHQKAVAAAKAAKLKASAQAVAKRLSETPVTLKRKVGEQDKLYGSVTALDVAEALAA
FT                   RGVQLDRRSIVLDEPIKTVGEFEVPVKLHSEVAGKVKVTVEAEAE"
FT   gene            complement(154133..154534)
FT                   /locus_tag="A2cp1_0135"
FT   CDS_pept        complement(154133..154534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0135"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: ank:AnaeK_0124
FT                   ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63494"
FT                   /db_xref="GOA:B8J802"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J802"
FT                   /inference="protein motif:PFAM:PF01084"
FT                   /protein_id="ACL63494.1"
FT                   /translation="MARPDMGGPKTGGFGGPRSGGFGGGGGGGFGGGGFGGGRGGDRGD
FT                   RGDRDDRGGDEGGGRRGFGRRKVCRFCADKALKVDYKDQGQMKYFLTERGKIIPRRISG
FT                   NCAKHQREVATAIKRGRMLAILPYTVGQM"
FT   gene            complement(154537..154983)
FT                   /locus_tag="A2cp1_0136"
FT   CDS_pept        complement(154537..154983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0136"
FT                   /product="ribosomal protein S6"
FT                   /note="PFAM: ribosomal protein S6; KEGG: ank:AnaeK_0125
FT                   ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63495"
FT                   /db_xref="GOA:B8J803"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:B8J803"
FT                   /inference="protein motif:PFAM:PF01250"
FT                   /protein_id="ACL63495.1"
FT                   /translation="MAETKQLVREYETIYLLKAETPDEQVDEIKERLRGVVSRQGGKVI
FT                   RFTNQGKRKTAFPVAKNAKALYMHCLYVGKPGLVTELERNLKMIDVVTKFQSVKLADGV
FT                   DFDARQVEADVKVQAVEDEQKPREERPEGGEEPFEAEAPEGQEE"
FT   gene            complement(155090..155668)
FT                   /locus_tag="A2cp1_0137"
FT   CDS_pept        complement(155090..155668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0137"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: ank:AnaeK_0126
FT                   aminoacyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63496"
FT                   /db_xref="GOA:B8J804"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J804"
FT                   /inference="protein motif:PRIAM:3.1.1.29"
FT                   /protein_id="ACL63496.1"
FT                   /translation="MKLVVGLGNPGEEYARTRHNVGFVVADRLAQLAGASFSAKKFAAE
FT                   LAEARLGPERVWIMKPQTYMNHSGEAVGAALRFWKLGLDDLVVVHDDLELDPYRVQLKV
FT                   GGGHGGHNGVKSVNAHVGSPEYARVRVGVGRPPPRMDPADYVLGKFAKGEDAELDLCVE
FT                   QAVEATRLAVELGAARAMNQVNRRSRAAD"
FT   gene            complement(155678..156400)
FT                   /locus_tag="A2cp1_0138"
FT   CDS_pept        complement(155678..156400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0138"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   ank:AnaeK_0127 ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63497"
FT                   /db_xref="GOA:B8J805"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J805"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ACL63497.1"
FT                   /translation="MAENVLSAQKRTEQGKGPARRLRQQGLIPAVVYGGKREPTHVALD
FT                   PATLLKAIETPHKFNTLLELQVDGASKHVLFKDYTVDPVTRKLLHADFLEVSMDQPVKV
FT                   NVPVVTVGRAAGVAEGGILSVATHAIVVEALPNKIPVRIEVDVTELKIGRSLHVSELKA
FT                   PEGCKFKFQTDYVVVFVAVPEKEEVAAPVAAAVPGAAPAEGAAPAAGAAAPAGGAAPAA
FT                   GAAPAKGGEAKGGDKAKK"
FT   gene            complement(156780..157745)
FT                   /locus_tag="A2cp1_0139"
FT   CDS_pept        complement(156780..157745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0139"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: ank:AnaeK_0128 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63498"
FT                   /db_xref="GOA:B8J806"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B8J806"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACL63498.1"
FT                   /translation="MASNGHYPDYRVFCGNANRPLAEAIAKELGRPLARATVGRFSDGE
FT                   IQVEIGENVRGLDTFIIQSTSPDANTNLMELLIMIDALKRASAGSINAVLPYYGYARQD
FT                   RKVAPRVPITAKLIADLIEAAGATRVVSMDMHAGQIQGFFNVPFDHLYAAPVLLEHMRK
FT                   RFDGSAHDLVIVSPDAGGVERARAYSKRLGAGLGIVDKRRTKPNVAEIMNVIGDVNGKV
FT                   AVLLDDMIDTAGTLTQAANALVDKGATRVFAYATHAVLSGPAVDRIMKSPIEEVVVTDS
FT                   IQLAPPAAACPKIRTLSVAGLLAEAIRRIHSADSLSSLFV"
FT   gene            complement(157893..158198)
FT                   /locus_tag="A2cp1_0140"
FT   CDS_pept        complement(157893..158198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0140"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: ank:AnaeK_0129
FT                   SpoVG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63499"
FT                   /db_xref="GOA:B8J807"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J807"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ACL63499.1"
FT                   /translation="MEITEVRVFPVNEEKLKAYVTITLDHCFVIRDLKVIHGNTGLFIA
FT                   MPAKRRKDGTFKDIAHPLNSDTREKMERTILAEYDRELKKGGAAPARATGTDPHED"
FT   gene            complement(158138..159079)
FT                   /locus_tag="A2cp1_0141"
FT   CDS_pept        complement(158138..159079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0141"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: ank:AnaeK_0130
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63500"
FT                   /db_xref="GOA:B8J808"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J808"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACL63500.1"
FT                   /translation="MRLVTLAPAKVNLVLRVGPVRADGYHDLRTLMVPLDLGDRVDVRV
FT                   SPRRGPVRCTVPGRPELDGPENLAARAAEAFRRRFGVDRAVSIRIEKRTPVTAGLGGGS
FT                   SDAAAVLRCLARALRVRDGAALAALALEIGSDVPFFLGPGPAWAAGRGERLSRAEVPPL
FT                   DLVLVYPADPSLAIRAGDAYRWLDEARASGSQAPRRLGRPGRWRPTLLGNDLQAPCVAR
FT                   KPALQALLGLLVGAGATAAIMSGSGPTVFGIFPGRGAARGAALAIQGRAKGGAAGVQVL
FT                   LARTVRRHPRVSPWRSPRSASSRSTRRSSRPT"
FT   gene            159229..159582
FT                   /locus_tag="A2cp1_0142"
FT   CDS_pept        159229..159582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63501"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:B8J809"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0131"
FT                   /protein_id="ACL63501.1"
FT                   /translation="MNPTFARAAACAALLAAAGCRSAFAPEPVLKLSSAPAAEHPATVV
FT                   QAAELRSGPDGLAKVLGTVAAGTTVTASDKPIRGFLRVRTADGKSGYVPQAAVSATAAA
FT                   SAPASAPTGAAAP"
FT   sig_peptide     159229..159300
FT                   /locus_tag="A2cp1_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.913 at
FT                   residue 24"
FT   gene            159744..160091
FT                   /locus_tag="A2cp1_0143"
FT   CDS_pept        159744..160091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63502"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:B8J810"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0132"
FT                   /protein_id="ACL63502.1"
FT                   /translation="MSRTAILPLAALAAVLALAPACKGDDAKEQVVKITVTKNGYEPWR
FT                   IEAKAGRPLTLVMTRVTDQTCATEIVIPDLGMNVPLPLNETVMVRVVPQKTGELRFSCG
FT                   MKMFQGVIDVR"
FT   sig_peptide     159744..159818
FT                   /locus_tag="A2cp1_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.709 at
FT                   residue 25"
FT   gene            160186..161001
FT                   /locus_tag="A2cp1_0144"
FT   CDS_pept        160186..161001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63503"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8J811"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0133"
FT                   /protein_id="ACL63503.1"
FT                   /translation="MRDLSYDHVPYRMSEIEHRYGENVHIVANPFLLGALATLCSKETR
FT                   QPAINRLVRLLYEDLIRTVMNHEFPRRRVAVPTRMIDSSPQAIFEGEVVDRQVRAVTVN
FT                   IARAGAVPSQLVYDLLNETLEPSLVRQDHIIMSRMLGENEEVVGAGIGGMKIGGDVDDA
FT                   FLLFPDPMGATGSSLATAIETYKKKVPGKARRIVNIHLIVTPEYLRNMTKAHPDVRIYA
FT                   IRLDRGLSPPDVLATVPGTRWDEERGLDDHQYIVPGGGGFGEIMNNAYV"
FT   gene            160994..161521
FT                   /locus_tag="A2cp1_0145"
FT   CDS_pept        160994..161521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0145"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: ank:AnaeK_0134 hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63504"
FT                   /db_xref="GOA:B8J812"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8J812"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ACL63504.1"
FT                   /translation="MSSSRAGLDVLISEADLRARVAQMGADITRDYAGKNLVVIGVLKG
FT                   SFIFLADLVRAVDLPLSVDFIGISSYQGTRTTGVVQITSDLTRPIDGKDVLLVEDIIDT
FT                   GLTMRYLLENLSTRKPASVRIAALLEKPARAQVKIPIDYRGFVIGDEFVVGYGLDWDGK
FT                   MRNLPFIGVPRT"
FT   gene            161581..162387
FT                   /locus_tag="A2cp1_0146"
FT   CDS_pept        161581..162387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63505"
FT                   /db_xref="GOA:B8J813"
FT                   /db_xref="UniProtKB/TrEMBL:B8J813"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0135"
FT                   /protein_id="ACL63505.1"
FT                   /translation="MADETPRARAGSGVKALLAWVAILGLAGVVAWLASERNARTWYLV
FT                   PDEGRLVVMKGLMLPMGRQAFSTDDPALAAAYAPLVPPPGKPLPAERAFEERSLLDQGL
FT                   FDLLAGWAREEVATGDPARLERGLGYLGRAERLAGISPAQRDELGAIRAESGYHEARRL
FT                   LERAAAELRDAAEKLRVTAGSRSSRAMDAQLLLKQLEPAVDATLGAIRTAARSEPAAAE
FT                   KGAGPPPAAGEPAPAAAPEPGQAPAAQPSAAPVAPAGQPPPPGDGR"
FT   gene            162477..165314
FT                   /locus_tag="A2cp1_0147"
FT   CDS_pept        162477..165314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0147"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   ank:AnaeK_0136 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63506"
FT                   /db_xref="GOA:B8J8Q8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Q8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL63506.1"
FT                   /translation="MASFHARNGTGELLARYAFVEPLLEGRRILEIGAAAATEGATAAF
FT                   LAERGAAEVLSIEDDGAALAAAVRGPHEPYVQFRAARPEDLPAGAFDVVLLADGAALAA
FT                   EPARAAALARLLAPGGRLVTAVDAGGPGLAELAGEPRRAAPPGYEAFVGALLGRFAQVE
FT                   VAAQSATLGWVFGMGGGDEPELAMDGSLAGTAETAAYVAVCGDAPCGLSGFTLVALPAG
FT                   PLLEEGAAGAASAAARALAADALRERAEALAARDLALGERDAAAEAREQLRAELDAAAA
FT                   AALDAARARDRVLADAAADRDRAACAEQAAAAAAEARDEALAARDGLARELEALRAGVD
FT                   DLRRSRQAVEAEVDRLRAGAELSAARARELEATLDAERGGGADARAELERAEGVIAERT
FT                   HELAEARAALATQAAAVAQADEARARADAALAERREAAAEAEAALQAARSEAQAAKAAL
FT                   EAALERASVGEARLPELEEAVEARAHEAAEAQAALREARDRISALEAEAERGRETLAEA
FT                   RAAEEVARLDAGSARAEADRALVDAEAAREETARRAAELRTLEAARAQVAAEADTLRAE
FT                   AGAARARAERLAGEAEAARARAAELEGADAARDAEQREAAEARAEALAARAGEVEKLTA
FT                   ELAGASAAAGEAAALREALEARVAELEARLESEAERAGLVEARAAEALARLESLEEAGA
FT                   AREAEQTAAVRAVTARAEAAEAAARDAEARAAAAEARPAAPAPDAGLEAELAAARSAAD
FT                   VAGAQAAELEAELQAVRWEKDEIEQRLQSLTASGALGGAGEVSRLRDELAARAGDGALL
FT                   RKELQRLEAQVAELTARPLAAPAPAEEAEAVRRAAAHAAELEERLAEALRRAADAEAAA
FT                   EAARAAPAPIPAVAAGEALKRVAQEKDAIAAQVAERDQKIARLQREVADKTERLGRLAK
FT                   EMGELKARGFGKIFR"
FT   gene            165327..165860
FT                   /locus_tag="A2cp1_0148"
FT   CDS_pept        165327..165860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0148"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   ank:AnaeK_0137 type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63507"
FT                   /db_xref="GOA:B8J8Q9"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Q9"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ACL63507.1"
FT                   /translation="MTEPRRYERIDVELPCRLYVPGERGLKFEAHCTSRNLGLGGVFLS
FT                   SSFLLREGLELFVELGLPAGPLAIRARVAHTVPGDHPELEGGFGVEFLDVDAAGRETLL
FT                   RYFTPLRYHEFYRAFAGEFPHLRDRVPVADVALLLNLWEEWKAVGEGGPAFTASGAPPA
FT                   PARAGAGPARRGRR"
FT   gene            165911..168091
FT                   /locus_tag="A2cp1_0149"
FT   CDS_pept        165911..168091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0149"
FT                   /product="glycoside hydrolase family 57"
FT                   /note="PFAM: glycoside hydrolase family 57; KEGG:
FT                   ank:AnaeK_0138 glycoside hydrolase family 57"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63508"
FT                   /db_xref="GOA:B8J8R0"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8R0"
FT                   /inference="protein motif:PFAM:PF03065"
FT                   /protein_id="ACL63508.1"
FT                   /translation="MTPVRLAFLWHMHQPPYREPETGAYLMPWVRLHATRAYHDMAWML
FT                   ERHPGVRCTVNFTPVLLEQLEDYAQGTAQDRLLELSARPPADLGAEDRQQILRSFFMVG
FT                   WETNVKPLPRYWELLQKRGRELRGVDLARLAHSFGDQELQDLQALFNLAWMGFAAQADE
FT                   PAVRALREKGRGYTRADVDALLEVQRRIAAGVVPRWRALQDRGQVELSTTPYYHPILPL
FT                   LCDTDAAHRALPGIPLPPRFAHPEDARWHVREAIAAHARRFGRPPAGMWPAEGSVSPEA
FT                   LEILASEGVGWAASDEGVLLQSLPAAAPRLRSVYRPWRVAAGAGREVRMLFRDRALSDV
FT                   IGFTYAKVPARDAVADFTAHVRAVADAWARDGQPGAPTLGVFLDGENAWEHYPSSGHEF
FT                   LDRLYDALERSDRVQTVTLSEATAAAEGPPIARVHTGSWIEASFRIWIGHREDREAWAA
FT                   LGRVRDALAQAEERGEVPAERLARARQHLYAAEASDWYWWYGEDFTTEQAAEFDALFRA
FT                   HVNRAALLCGVDPPPETQAPIKRAGAPAPGALEAKPLREPVMLLTPTLDGRETTYFEWQ
FT                   GAGLYRPGQHRGSMYGGAQAFHVLRFGFDLAALYLRLDPAESAARAAEVATHVRVSVRS
FT                   RDGQRWVDFPLEPDGAPRPGAWRGQALGRLAFAQVAELELPFAALGLAPGDRVDLAVHA
FT                   LRGEVEVERLPRYGYLALTVPDQDFERIHWRV"
FT   gene            168139..169008
FT                   /locus_tag="A2cp1_0150"
FT   CDS_pept        168139..169008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0150"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Forkhead-associated protein; KEGG:
FT                   ank:AnaeK_0139 diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63509"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8R1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACL63509.1"
FT                   /translation="MGDDPTRVRTPEERAAAAAGHCLVFVAGDGALGLRVPLDGEVVLG
FT                   RDPSCAVALPASDVSRRHARVVPDGDGHLVLDLGSTNGTWVNGREVAVHRLAPGDRVQV
FT                   GAFVARYLRAGDAEESELAALADLALRDPLTGLPNRRAFEESLRREVARARRGGDRLAV
FT                   AVLDVDRFKDVNDRHGHAAGDVALAEVARRASAALRAGDLLARIGGEELAAILPGADVA
FT                   AAAEVAERVRRAVGTEPVQAGGQAIRVTVSLGCAELAPDDADGADLFARADGHLYRAKH
FT                   AGRDRVEF"
FT   gene            169140..170336
FT                   /locus_tag="A2cp1_0151"
FT   CDS_pept        169140..170336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0151"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ank:AnaeK_0140 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63510"
FT                   /db_xref="GOA:B8J8R2"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8R2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL63510.1"
FT                   /translation="MKNRSALAILFVIVFIDLLGFGMVIPVMALYAERLGAPDAQIGWL
FT                   MTGYSAMQFVFTPIWGRLSDRHGRRPLLLLSIVMTAVGFLGYALAPSFAWLLVSRLFAG
FT                   AATANIAIAQAYIADVTPPEGRARGMGLIGAAFGLGFVLGPAIGGLLSAISLSAPGYAA
FT                   AALAAANGVAAFFVLPEPAAHVQAERRPHLEALLGGVSRPGIRRLILIYFIAILAFSGM
FT                   EATFALLAVHRYGLDQRQVSYVFALIGVVATVVQGGLIGPLSRRFGERALLVAGLLLQA
FT                   AALAALPYAGSVAGLLVATVPLAFGSSLTTPSLTSLVSRSARAEDQGGTLGIGQSAAAL
FT                   GRIAGPISATHAYSQLWFAAPYLGGAALMLAGAAVGSTLRRPPRHEPVEPGAAPAEEG"
FT   sig_peptide     169140..169229
FT                   /locus_tag="A2cp1_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.740) with cleavage site probability 0.540 at
FT                   residue 30"
FT   gene            170343..171344
FT                   /locus_tag="A2cp1_0152"
FT   CDS_pept        170343..171344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0152"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="KEGG: ank:AnaeK_0141 galactose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: galactose-1-phosphate
FT                   uridylyltransferase; PFAM: galactose-1-phosphate uridyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63511"
FT                   /db_xref="GOA:B8J8R3"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8R3"
FT                   /inference="protein motif:TFAM:TIGR00209"
FT                   /protein_id="ACL63511.1"
FT                   /translation="MPDLRRDPIVGRWVIIATERARRPSDMQRTAPAPQGGLCPFDPGN
FT                   EGMTPREVYVAGRPPSAPPNAPGWKVRVVPNRFPALKIEGELDRQAEGIYDRMNGIGAH
FT                   EVIVETPDHDRAMEDLTPAELTEVLFAFKARILDLRNDLRFKYILLFKNHGHLAGASLE
FT                   HAHSQLIALPVVPRQVIEEIEGARRHFDLKERCIFCDIVGQERKERARLVLENDEFVVF
FT                   APWAPRSPFETWIMPKRHQSNYEAEPKERLALCAEALGSTLRRLGGALGKPAYNFMVHS
FT                   NPLRDAQSPSYHWHIEVMPALTQVAGFEWGSGFHINPVPPEEAAEFLRKVPG"
FT   gene            171373..172806
FT                   /locus_tag="A2cp1_0153"
FT   CDS_pept        171373..172806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0153"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="KEGG: ank:AnaeK_0142 glycogen/starch synthase,
FT                   ADP-glucose type; TIGRFAM: glycogen/starch synthase,
FT                   ADP-glucose type; PFAM: glycosyl transferase group 1;
FT                   Starch synthase catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63512"
FT                   /db_xref="GOA:B8J8R4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J8R4"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ACL63512.1"
FT                   /translation="MQILFVASEVGPWSKTGGLGDVAGALPQALAERGNEVAVVTPRHG
FT                   SIDPHAAGLQPVRTALHVRGEPVALWVKRGPAPVYFVEHPHLFGSRRGLYGEGGRDHGD
FT                   NAERFAFLTRAALALPAALGLRPRILHLNDWQCGLGPWLLRHEHARDPALAGARTVFTI
FT                   HNLAYQGLFPKQVLPALGLPWEVFRWEAMEFFDQLSFMKAGLAFADALTTVSPTYAREI
FT                   LTPEGGASLDALLRHRARDLHGILNGIDVHAWDPARDPHLPAHFGAGDLTGKAACKAAL
FT                   QREVGLPVRPEVPVAGLVTRLAEQKGIDLVAAALPALLARDVQVVLLGSGDAAYEQAFA
FT                   RAAREHPDRVAARIGFDEGLAHRIEAGADLFLMPSRFEPCGLNQMYSLRYGTVPVVRAV
FT                   GGLADTVEDFDGFARGTGFRFSEYTPQALLTATRRALDVFRDRRAWRGLVERGMAEDNS
FT                   WERSAARYEALYRTLAPGR"
FT   gene            172857..173186
FT                   /locus_tag="A2cp1_0154"
FT   CDS_pept        172857..173186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63513"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8R5"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0143"
FT                   /protein_id="ACL63513.1"
FT                   /translation="MATAPHDDPEPTARPTDRLPRELLEEEDEKLVPASNVGGAAPTAL
FT                   GADSGGDLPGSEDDLANMSEPEPPEPPEVGAVHVRRGAAGEEEGEGGEAGDDEEAGPGA
FT                   PRTRH"
FT   gene            complement(173205..174446)
FT                   /locus_tag="A2cp1_0155"
FT   CDS_pept        complement(173205..174446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0155"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: TPR repeat-containing protein; protein of
FT                   unknown function DUF1025; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   ank:AnaeK_0144 tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63514"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8R6"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ACL63514.1"
FT                   /translation="MSLPFRRAAVLLLAAACTPSTAPAPAPAAPQANHVARGTITPARY
FT                   VPPPARGSRARPEACLPGEPFAAPSALAEEAVAALDAGARERALACADEALRLAPRMVP
FT                   ALTARGAALAALDRLDEARLAFARALAVDPDEPEALLGAAELHVRRLGAARDALEAGLE
FT                   YAVRGARSATRPPRKDKDLAARLELVAGMAENDLGRSHLALAHLERALAARPRDPDALY
FT                   ERGVALFELCRFGEARRAFERALAIAPDDAWAIHQLGLVAERSGDGRRAAALLARARTL
FT                   APDDFRDELAVDAGAFRAEVEAAVAALPAAEREALKLAPVEIQDLPDTEDLTAVEPPLS
FT                   PSILGLYRGPPADEACTEADGPRCRSIVFYRKNLLRFARDRAELTEQVRVTLLHELGHL
FT                   HGESDDELRDRGLE"
FT   sig_peptide     complement(174348..174446)
FT                   /locus_tag="A2cp1_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.541 at
FT                   residue 33"
FT   gene            complement(174656..175576)
FT                   /locus_tag="A2cp1_0156"
FT   CDS_pept        complement(174656..175576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63515"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8R7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0145"
FT                   /protein_id="ACL63515.1"
FT                   /translation="MRGAPDIREVQDHLFDRLAQGQLLLLVGAGASRWAGLPSWREAVV
FT                   ALARDLVPVLRERLPDAPARFSPPGPDDPVALETLLRVPEAHRALCGEARLVERLAGLF
FT                   DTSRIDPAALPLHRLLVRLAAFVPALYTTNFDDLLERTFAWAGRACQVVAAADDLQRWR
FT                   LDPAGGRFVSRFPVYKLHGTLDRPATLVVSETDFQRRASLAANAIDLRFCSDAVGRELL
FT                   LVGYGFNDPNLRWIWTKLRDLEVLPVAWFLELGTSTDLDLATFELDRIARVDLRASDPV
FT                   HPPELLAFLGALADRCEAALGPFPR"
FT   gene            complement(175634..176764)
FT                   /locus_tag="A2cp1_0157"
FT   CDS_pept        complement(175634..176764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0157"
FT                   /product="glycine oxidase ThiO"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: ank:AnaeK_0146 glycine oxidase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63516"
FT                   /db_xref="GOA:B8J8R8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8R8"
FT                   /inference="protein motif:TFAM:TIGR02352"
FT                   /protein_id="ACL63516.1"
FT                   /translation="MKTDVVVVGAGLQGASVALRLAQAGKQVVVLERAVPGAEASYAAG
FT                   GILSPGVEALEPGPFYALCAASLARYPAFAREVEAASGMWVGLRGGGTLEIAVDDPEAR
FT                   LLAGRAEKLHKAGLAVEVLDDAEVRRLEPGVSPETRGALYFADEASVDPRLLGRAVYVA
FT                   AARAGARFVTGKVERIVHAGGRAVGVDHDAGRIEADAVVLAAGSWSMQVEGNGLPPGAV
FT                   RPVRGQIALLDTRPPLLSRVVFSANGYVVPRADGRILCGSTMEEVGHEKAVTAGGLRRV
FT                   LDIALEIAPALAAAPVVETWSNFRPASPDGSPILGAGTVPGLYYATGHTRNGILLAPVT
FT                   ADAVAAAVLGTPPPVDLAPFSPARLGAGRPQAAGRR"
FT   gene            complement(176858..177481)
FT                   /locus_tag="A2cp1_0158"
FT   CDS_pept        complement(176858..177481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0158"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ank:AnaeK_0147
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63517"
FT                   /db_xref="GOA:B8J8R9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8R9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL63517.1"
FT                   /translation="MDGSVATRRIGPPRAGIAERIWDAARAEFSKRGYHGARVQGIARG
FT                   ASCNVALIYRHWASKRALYLDILRAVWLSAANELSRFVENGSGGPEAVIAAYLDAMMHD
FT                   AMGAQILVREYLDGAPYLSQLTTAEPALLDPLRRAAAVIAEGTDGGVDPVLAVVTVGGL
FT                   AALVASSREAMLPMVGQQLAPEAWRAHVLHVLANGLAPRAGPRG"
FT   gene            177561..178817
FT                   /locus_tag="A2cp1_0159"
FT   CDS_pept        177561..178817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0159"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   ank:AnaeK_0148 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63518"
FT                   /db_xref="GOA:B8J8S0"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8S0"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ACL63518.1"
FT                   /translation="MYRAMDPGPRTILHLDLDAFYASVEQLDHPELRGRPVIVGGTGNR
FT                   GVVCAASYEARKFGVRSALPTARARRLCPDGVFLPPRFGRYSELSRRVFDVYRRYTPLV
FT                   EPLSLDEAFLDVSASRALHGTGPEIARAIKVAVRGECGLAVSAGVAEVKMAAKIATDLG
FT                   KPDGLVVVPAGGVAAFLAPLPVGRLWGVGEVTEATLRRIGVATIGDLARMPESALAAAL
FT                   GPNHARGLRALARGEDAREVVPDEEAKSVGAEDTFDHDLLGRTALERELLAQAGTVGRR
FT                   LRAAGLAGHVVTLKVKYADFTLVTRRVTLERATDDDRAIFEAARAQLERVDLRRPVRLT
FT                   GISVSGFAGDEERGQLGLFGGAPAPPPPEASRRKALNAALDALAGRFGEGAVTRADLAG
FT                   RPPRRRHGDPGDGGEDPDR"
FT   gene            178866..179729
FT                   /locus_tag="A2cp1_0160"
FT   CDS_pept        178866..179729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63519"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8S1"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0149"
FT                   /protein_id="ACL63519.1"
FT                   /translation="MAAAIRPGEDLAIRERSQGELDARATALRALAGSGVPFLVAGAYA
FT                   FFEYTGIFRDTKDLDLFLREKDLEAAFRVLEEAGFRTELTDAGWIGKAWQGEWFVDLIF
FT                   SSGNGVAVVDDLWFTHARPGRVMDVEVLLAPPEEIIWSKSFVLERERYDGADVNHLLHV
FT                   CGPGMDWDRLLQRFDRYWEVLFSHLLLFQFAYPGARSTVPDWVTEELVGRTLENLRSGD
FT                   HPVAMCRGSLMSRVQYQHDVDRLGLHDGRRWDEAERGPAGRAGHGGAAGTDAAAGGADV
FT                   SPGGGG"
FT   gene            179662..180417
FT                   /locus_tag="A2cp1_0161"
FT   CDS_pept        179662..180417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0161"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ank:AnaeK_0150
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63520"
FT                   /db_xref="GOA:B8J8S2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8S2"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACL63520.1"
FT                   /translation="MAEQQAPTQQQAERTFRLAAAADLHCRSDQHGRFRELVRMVNGEA
FT                   EGLVLAGDLTDHGTLDEAKTLAEVLSQLRVPCAAVLGNHDYEGGVVRDICRVLTEAKVT
FT                   LLDGDHAVFDRRLGIAGVKGFGGGFERGMLQAFGEPAIKAFVQEAVNEALKLEAALAQL
FT                   EIQKKVVIMHYAPVFETTEGEDLQLRPFLGSSRLIGPCEAFGARAVFHGHSHHGTLEAR
FT                   TPKGVPVYNVAMPLLRKLMDDRRFRVFEL"
FT   gene            complement(180557..180937)
FT                   /locus_tag="A2cp1_0162"
FT   CDS_pept        complement(180557..180937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0162"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ank:AnaeK_0151 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63521"
FT                   /db_xref="GOA:B8J8S3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8S3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL63521.1"
FT                   /translation="MTPGQYILVVDDDDDFREALSEVLVDAGYPVQQAENGEVALAKVD
FT                   EEAPGIVLLDLKMPVLDGWGVMERMRGDAKSAAIPILILSAYGFEWEAELLGAQGYIPK
FT                   SVGMDEILERVRKAAGPPPMRH"
FT   gene            complement(180934..181899)
FT                   /locus_tag="A2cp1_0163"
FT   CDS_pept        complement(180934..181899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0163"
FT                   /product="phosphoesterase DHHA1"
FT                   /note="PFAM: phosphoesterase DHHA1; KEGG: ank:AnaeK_0152
FT                   phosphoesterase DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63522"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8S4"
FT                   /inference="protein motif:PFAM:PF02272"
FT                   /protein_id="ACL63522.1"
FT                   /translation="MQLELLYHGNCFDGCASAALFGRWFQEREGARLAGVRYRPVQHQQ
FT                   GDAFPADAFGADVNACVDFRYSPRLDWWFDHHASAFPTPADRASFERDATGRKFWDPAA
FT                   PSCTGFIARTLADRFGWRAAELDELVRWADVIDAARFESAAVAVRLEAPALRIMTLLEA
FT                   TKDPALPTRLIGAMQRLPLAEIAAQDWVTGPLAPILERHRGAIDVVRRQARVRDGVVEI
FT                   DLGDTGLEAANKFIAYDLFPEARYTVVVSKDPKRTKVSVGSNPWAREQRTHDISKLCER
FT                   YGGGGHPVVGAVSLAPDRLADARRIAAEIASALRGEPNAP"
FT   gene            182198..183163
FT                   /locus_tag="A2cp1_0164"
FT   CDS_pept        182198..183163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0164"
FT                   /product="HPr kinase"
FT                   /note="TIGRFAM: HPr(Ser) kinase/phosphatase; PFAM: HPr
FT                   serine kinase domain protein; KEGG: ank:AnaeK_0153 HPr
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63523"
FT                   /db_xref="GOA:B8J8S5"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8S5"
FT                   /inference="protein motif:TFAM:TIGR00679"
FT                   /protein_id="ACL63523.1"
FT                   /translation="MDAIRVGALLDDTKFDLRLTLVAGKQGLSRRISSSRIQKPGLVLA
FT                   GFTEYLHKERVQVFGNTEMSYLATLPRERSVEVLRSFFGQDVSCLVVTKGLQPPPEMMA
FT                   AADEAGVPLLRTSHLSSNFIESVQNCLEDVLTAQTSMHGVLLDVFGVGILLLGKSGIGK
FT                   SEIALDLIMRGHRLVADDIVDVKRKTPESVFGAGSEIIKHHMEIRGLGIINIKDLFGVA
FT                   AIRERKKIEIVLELVEWDPNVEYDRLGVEERKFRILDVEIPMLVVPVRPGRNMTTIVEV
FT                   AARNHLLKLQGHHSAREFQERLNRAIALAPGGRVGEIDVE"
FT   gene            183160..184044
FT                   /locus_tag="A2cp1_0165"
FT   CDS_pept        183160..184044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ank:AnaeK_0154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63524"
FT                   /db_xref="GOA:B8J8S6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J8S6"
FT                   /inference="protein motif:PFAM:PF03668"
FT                   /protein_id="ACL63524.1"
FT                   /translation="MTATVSHAGPQVVILTGVSGSGKSTALRALEDAGFYCVDNLPIVF
FT                   LEKLLELSGHTAGEVSRMALVVDAREGRFLVEAPRIIRELRQKGADVEVLFLDASDEAL
FT                   VRRYSETRRRHPLAGEGGTVPDGIAAERLALADVRGIADEVIDTTTLNVHELKRLVTRR
FT                   FVAGEGAKLGVTLVSFGFRFGIPTHADLVLDVRFLPNPFFVPELKPHPGTDPRVAEFVL
FT                   GQADAKAFLERLTDLLGFLLPRYRNEGKSYLTIAIGCTGGKHRSVALAAALAERLEGSG
FT                   QPVRLWHRDVEKE"
FT   gene            184157..184573
FT                   /locus_tag="A2cp1_0166"
FT   CDS_pept        184157..184573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0166"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: ank:AnaeK_0155 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63525"
FT                   /db_xref="GOA:B8J8S7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8S7"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ACL63525.1"
FT                   /translation="MVGLVVATHGRLAEELLLTAEGIVGRLERCEAVSIVAGASMDEAR
FT                   QHIAEAVKRVDQGSGVLVLTDMFGGTPANLALTFLGDKLEVVTGVNLPMIMKLATARGE
FT                   DVSLHSVAELVTAYGQKNITLASELLRTRARSRT"
FT   gene            184617..185111
FT                   /locus_tag="A2cp1_0167"
FT   CDS_pept        184617..185111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0167"
FT                   /product="PTS system sorbose subfamily IIB component"
FT                   /note="PFAM: PTS system sorbose subfamily IIB component;
FT                   KEGG: ank:AnaeK_0156 PTS system sorbose subfamily IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63526"
FT                   /db_xref="GOA:B8J8S8"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8S8"
FT                   /inference="protein motif:PFAM:PF03830"
FT                   /protein_id="ACL63526.1"
FT                   /translation="MIPLVRVDNRLLHGQILETWVPRLRIDQVMVADDEAAASSLAQAA
FT                   MTLCVPPELPVRIRRVAEVDYAGLAAGGAKVLLLVRDVPGLAAARAAGLGAALAPRVNL
FT                   GNLHFGPGRRLVTPSVFVSEEDLSVLRRLAAEGFEVEARAIPSESPTGLVEIERRYAAG
FT                   H"
FT   gene            185128..185823
FT                   /locus_tag="A2cp1_0168"
FT   CDS_pept        185128..185823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0168"
FT                   /product="phosphotransferase system PTS sorbose-specific
FT                   IIC subunit"
FT                   /note="PFAM: phosphotransferase system PTS sorbose-specific
FT                   IIC subunit; KEGG: ank:AnaeK_0157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63527"
FT                   /db_xref="GOA:B8J8S9"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8S9"
FT                   /inference="protein motif:PFAM:PF03609"
FT                   /protein_id="ACL63527.1"
FT                   /translation="MGLLFLGLVAGLAAVERKGFLQAMLSRPIALAPVAGWVLGDAAGG
FT                   LVVAAPLELLWLGAVNLGAAVPVHEALGAAAIAGGAVLAGRAAGSGVTPEIAVLAVLLA
FT                   APVALLGRRADKAVEGWNERLARHAEAALARHRVAEAARSNLYGLAAPFAIAAVLAPLS
FT                   AWLAEALIPRFLAAAPGAAAPLRVGWFAFAALACAAGAKALRSRAAPRLFFAAFAAAFA
FT                   ALLTWRLLG"
FT   gene            185820..186587
FT                   /locus_tag="A2cp1_0169"
FT   CDS_pept        185820..186587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0169"
FT                   /product="PTS system mannose/fructose/sorbose family IID
FT                   component"
FT                   /note="PFAM: PTS system mannose/fructose/sorbose family IID
FT                   component; KEGG: ank:AnaeK_0158 PTS system
FT                   mannose/fructose/sorbose family IID component"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63528"
FT                   /db_xref="GOA:B8J8T0"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8T0"
FT                   /inference="protein motif:PFAM:PF03613"
FT                   /protein_id="ACL63528.1"
FT                   /translation="MSARVPRATLVRVFWRCLFLQAAWNRRGMQNLGFAYAIDPALRAL
FT                   YPDPARREEALGRHLGFFNCHPYMAAAIVGGAIHHEERVAAGAEPGQAPLAYKATLQGP
FT                   LAALGDGFFWTALRPFFGALAVVGALLLGVPALVAALLVYNAIHLALRIGLFRAGYLRG
FT                   DALVGTIAHLNLPVVADRLRAGGAALCGVAGAVFLMRGAAVGGPPAAALAAAAAAGGYA
FT                   ALARGARLLPTAYVATLAGVGAALLLGHLHGSS"
FT   gene            186590..186862
FT                   /locus_tag="A2cp1_0170"
FT   CDS_pept        186590..186862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0170"
FT                   /product="phosphocarrier, HPr family"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: ank:AnaeK_0159
FT                   phosphotransferase system, phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63529"
FT                   /db_xref="GOA:B8J8T1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8T1"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ACL63529.1"
FT                   /translation="MPHQERTFVIVNTLGLHARAAAQLVQTSNRYRSEIHVEKDGMQVN
FT                   GKSIMGVLTLAAAKGSQITVTCDGDDADQAMTALAKVIENGFGET"
FT   gene            186859..188655
FT                   /locus_tag="A2cp1_0171"
FT   CDS_pept        186859..188655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0171"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein; KEGG: ank:AnaeK_0160
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63530"
FT                   /db_xref="GOA:B8J8T2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8T2"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ACL63530.1"
FT                   /translation="MSRSSATTLVGIGASPGIAIGRCWTIERRRVRTPKRRLTPEEVEA
FT                   ELARLRTSLEISDVQLAEVRGKVEESQAPGSAEHTAIIDMHRMMLKDEMLVLEAQRQIR
FT                   EERLNAEWAVKRATRKIKNAFHEQADDYFKERRADVDFVGERIIKNLLGQAPDVEDVPP
FT                   EGVIVVAHDLSPADTALLLHEHKVAAFVTDAGAKTSHTAIVARALEVPAVVGVGRVTAV
FT                   ADRGDWIVVDGGRGLVVINPSPGERAGYEAAREKQLAGEQALLATRDLPARTLDDLTVR
FT                   LAGNIEFAEEVPSLIAHGGEAVGLYRTEFLFMGRSDLPGEEEHYQNYRRILEALAPRPV
FT                   TIRTFDLGGDKLPAGMRVTAENPALGLRAIRYCLRQPEMFRAQLRALLRASVHGNLRVM
FT                   FPMISGVAELRAAKHALRQAADELRAEGVAFRQVPVGIMVELPSAAMIADRLAAECDFF
FT                   SIGTNDLIQYTIGIDRQDKDVAYLYKPLHLAVLRLLKLVCDAGRAAGVPVSMCGEMAGE
FT                   PVNALVLLGLGVAELSMNGPSIPLVKRVVRAARAEDGRALVDRLLALTTADDIEHEVQA
FT                   EMARRFPGLLDGDDDAEPAGQG"
FT   gene            188813..189985
FT                   /locus_tag="A2cp1_0172"
FT   CDS_pept        188813..189985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0172"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   ank:AnaeK_0161 methionine adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63531"
FT                   /db_xref="GOA:B8J8T3"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J8T3"
FT                   /inference="protein motif:PRIAM:2.5.1.6"
FT                   /protein_id="ACL63531.1"
FT                   /translation="MPLQDFLFTSESVTEGHPDKMADQISDAVLDAVLRQDPKGRVACE
FT                   TLLKTGYVMIAGEITTKARIDYPKLARETVRRIGYTSGDMGFDANTCAVLVAVDQQSPD
FT                   IGQGVDTGGAGDQGMMFGYACDETPELMPAPIQYAHAVTKQLAKARRAGLDFLRPDGKS
FT                   QVSVEYRDGRPVRIDTVVVSTQHAESVSNKRLHEAVREQVIAKALPKRLLDRKTRILIN
FT                   PTGRFVIGGPMGDTGVTGRKIIVDTYGGMGRHGGGAFSGKDPSKVDRSAAYMGRYIAKN
FT                   VVAAGLASRCEVQVAYAIGVAEPVSVMVDTFGTAKVPEGKIARAVREVFGLTPRAIIEG
FT                   LDLLRPVYEKTAAYGHFGRTEKTFTWERTDKKDALADAAGLSKIRAVASV"
FT   gene            190253..191233
FT                   /locus_tag="A2cp1_0173"
FT   CDS_pept        190253..191233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0173"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; UbiE/COQ5
FT                   methyltransferase; methyltransferase small;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ank:AnaeK_0162 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63532"
FT                   /db_xref="GOA:B8J8T4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8T4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL63532.1"
FT                   /translation="MPRPAPARPAAPSRRPEALLGWMELLSDPIRLRALRALEPRELSV
FT                   LELREVLALPQSTVSRHLKTLSDAGWLSARREGTQSLYGWAAELAPGARKLWQLARAES
FT                   DGWAVVRADAVRLRAVRARRDEAQRFFAGAAGAWDGLRARVYGRGVAAEALLALVPPGW
FT                   TVADLGCGTGAVAAELAPRVRRVIAVDRSAAMLRAARRRTARFDNVELHEADLAALPLE
FT                   DGGCDAALLVLVLAYLDDPAPALAEAVRVLRPGGRLVILDAARHQDEALRRRMGQAHPG
FT                   FEPDALAALVRRAGAAGVTARALPPEPGARGPGLVACTGERPARP"
FT   gene            191286..192761
FT                   /locus_tag="A2cp1_0174"
FT   CDS_pept        191286..192761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0174"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: ank:AnaeK_0163 adenosylhomocysteinase;
FT                   TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; TrkA-N domain protein;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63533"
FT                   /db_xref="GOA:B8J8T5"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8T5"
FT                   /inference="protein motif:TFAM:TIGR00936"
FT                   /protein_id="ACL63533.1"
FT                   /translation="MAVSAAKKKPTPSAPAPLEHKVKDLSLAGWGRKEIELAEKEMPGL
FT                   MALRREHARQRPLAGQRITGSLHMTIQTAVLIETLVDLGADVRWASCNIFSTQDHAAAA
FT                   IVVGREGTPEAPRGVPVFAWKGETLEEYWDCTERALDFGGGKGPTQIVDDGGDATLLIH
FT                   KGVEYEKAGKVPPPSSADSEELEVVLRLLAREQKKDPRRWTRVAKACAGVTEETTTGVH
FT                   RLYEMQKAGTLLFPAINVNDSVTKSKFDNLYGCRHSLVDGLNRATDVMLAGKLCVVCGY
FT                   GDVGKGCAQALRGQGARVVVTEIDPINALQASMEGYQVVRLEDVVKDADVFVTATGNLD
FT                   VVTVEHMKAMKDCAIVGNIGHFDNEIDMAGLRKLTTRVNIKPQYDAFVFPDGHRVLVLA
FT                   EGRLLNLGCATGHPSFVMSNSFTNQTLAQIELAVNRAAYAKQVYVLPKHLDEKVAALHL
FT                   EQIGARLTKLTKKQAAYIGVPQSGPFKPDHYRY"
FT   gene            192774..193652
FT                   /locus_tag="A2cp1_0175"
FT   CDS_pept        192774..193652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0175"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   ank:AnaeK_0164 undecaprenyl-diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63534"
FT                   /db_xref="GOA:B8J8T6"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J8T6"
FT                   /inference="protein motif:PRIAM:3.6.1.27"
FT                   /protein_id="ACL63534.1"
FT                   /translation="MSLVSAALFGLLQALTEFLPVSSTAHLLVFGELLGHSLDDRRFRA
FT                   FVTIIQAGTTLAVLVYFRADIARLVAAAARGLARGRPFGTPEARLGWYIVLGTVPAALA
FT                   GKLLEHRIEALGNWVIAGSLVALGLVLLAAERLASHRRRVEDVGAGDALLIGVAQALAL
FT                   VPGSSRSGTTITGGMLLGFTREAAARFSFLLSVPITLAAGAYKLWSTVPDLRGEAAWTV
FT                   ATVVGTVVSAVAGYLVIDWLLAWLRTRTTYVFVVWRLAAGAAIAALILSGVLPAGAEAP
FT                   PPPPPALHAAP"
FT   gene            193649..194239
FT                   /locus_tag="A2cp1_0176"
FT   CDS_pept        193649..194239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0176"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ank:AnaeK_0165 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63535"
FT                   /db_xref="GOA:B8J8T7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8T7"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACL63535.1"
FT                   /translation="MTLDDLAAALVAREPGIAPVDRIAQEHLPRGGFASAAVLVPLHVL
FT                   DGEVHVLMIRRPMKMSRHAGQIAFPGGKIDPGEESLAAALREAHEEVGLEPARADVMGQ
FT                   LSETLVLASAFRLTPWVASVPYPYPYAAAPHEVDEILHVPLSALSRPGAHRVEWREVYG
FT                   LRLDVHFFSVGKDVIWGATGRVLAELLSIWRAS"
FT   gene            194236..195324
FT                   /locus_tag="A2cp1_0177"
FT   CDS_pept        194236..195324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0177"
FT                   /product="Mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: ank:AnaeK_0166
FT                   mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63536"
FT                   /db_xref="GOA:B8J8T8"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8T8"
FT                   /inference="protein motif:PRIAM:2.7.7.22"
FT                   /protein_id="ACL63536.1"
FT                   /translation="MKIYPVIMAGGSGTRFWPLSRRNRPKQFLALAGDAPLLAATVSRL
FT                   PPLSRPRDTFVVCGPKHAAAARRMVAQLPKENFIVEPCARNTAPCVGLAAIHVAAKDPR
FT                   GVIAMLPADHHIGRPPAFRDALAAAAQLAEAGSIATIGIRPSRPETGYGYLKLGPRLAA
FT                   RAKGKKRLVAHKVERFVEKPDVVTAARYLADGSYLWNSGIFVFRADVILDEIRRAMPVL
FT                   GEQLEAIRRTLGTPNYARTLKRVFPDCPSISIDYGVMEKSQRIAVVPAEFGWSDVGSFA
FT                   ALSDVRVTDDLGNVAEGDALVIDGRNNVVLAGKDRPIALIGLDDVIVVDSGDALLVCRR
FT                   DRAQDVRKAVEELGRRGREELL"
FT   gene            195494..196864
FT                   /locus_tag="A2cp1_0178"
FT   CDS_pept        195494..196864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0178"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: ank:AnaeK_0167 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63537"
FT                   /db_xref="GOA:B8J8T9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8T9"
FT                   /inference="protein motif:PRIAM:5.4.2.8"
FT                   /protein_id="ACL63537.1"
FT                   /translation="MAKLSPTIFREYDIRGLVDQDLPEEAVSLVGKALGTRIRGAGGKR
FT                   AAVGWDARLSGPKFAKAMIEALTSTGVDVVSLGVVPTPLTYFAAHTLDVDGICMITGSH
FT                   NPPEYNGLKVGLGSATYYGEEIQALRREAEAGRFATGQGTVRAHDIVTPYREHVRQNLR
FT                   LGKRRLKVVVDAGNGTGGVVAVPLFEALGFEVVPLFIEMDGNFPNHHPDPTVEKNLEHL
FT                   RRKVLETGADVGIAYDGDADRVGAVDEKGNVLWGDQIMILFSRALLAEEPGAAIVGEVK
FT                   CSFTLYDDIAARGGRAIMWKAGHSLIKAKMKEEHALLAGEMSGHIFFAHRWFGFDDGIY
FT                   SSARLLELLTHTDLPMSALLADVPRTFSTPELRVDCPEEKKFEVVRRAQEFFAARYDAV
FT                   TVDGVRVVFPDGWGLVRASNTQPLLVLRFEAKTEARLAEIQALVRGKVDELLRELGA"
FT   gene            196868..197830
FT                   /locus_tag="A2cp1_0179"
FT   CDS_pept        196868..197830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0179"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: ank:AnaeK_0168 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63538"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8U0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACL63538.1"
FT                   /translation="MKGLALGVDLGGTNARAAVVDRATGEIVASHKEPLRERGPEAVVA
FT                   TVLHALGQAAGAAGIAPASAGRVGVGVAGQVLGATGVVMNAPNLGWRDVAFGTLLEKAL
FT                   GVPVRVANDLSVAAWGEKRFGAARGIEDVVLVFVGSGVGSGLILGGRLHDGAQGVAGEL
FT                   GHIKVRLPRPGFTPRRCGCGQLGCLEAYTSGVNVAARVREEIAAGAATRVLELVEGDLA
FT                   RVTASVVEEAHALGDAYAVALWDEVAELLGLSVANLVTLLNPARLILGGGVLLGAPRLA
FT                   DLTLRRFDEAVSRSATRGLTVERAWLGDDAGVIGAAVLE"
FT   gene            198193..198303
FT                   /locus_tag="A2cp1_0180"
FT   CDS_pept        198193..198303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63539"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8U1"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0169"
FT                   /protein_id="ACL63539.1"
FT                   /translation="MDVPRREQMAAKKKTAKKTAAKKPAAKKKVAKKGKK"
FT   gene            198380..199924
FT                   /locus_tag="A2cp1_0181"
FT   CDS_pept        198380..199924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0181"
FT                   /product="Fibronectin-binding A domain protein"
FT                   /note="PFAM: protein of unknown function DUF814;
FT                   Fibronectin-binding A domain protein; KEGG: ank:AnaeK_0170
FT                   protein of unknown function DUF814"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63540"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8U2"
FT                   /inference="protein motif:PFAM:PF05833"
FT                   /protein_id="ACL63540.1"
FT                   /translation="MSLTARELAEVVAELAPLAGAHVDAVRMHAERALTLSLRGRAGDA
FT                   LLLLSAEPDVTRLHAVGRRPPQPDTPYAAQAVLRRELEGARLAGLETLPGDRVVALSFE
FT                   RAPARGGPVRLVAELTGRHGNLFLVDAAGVIRAAAARNLSQRRDLAVGRPYQAPSLPPG
FT                   GAGTDAGQGALRFPPVPGARFPLSAAIEAAYLAREEARRLAEARRRLREPVRAALARAG
FT                   RALVKLADEAARVPAAEADRRAADLLKTHLRAVRRGATEVTVTEWTEEGPREVRVAVDP
FT                   ALTPQANLERYYRRYRRIVESAARVEARAAEVRAREAALRALLARIDAAGAADLPRLER
FT                   EARRLAAGPRPAAPPRRKHDEPAPPYRTFRSLSGATVLVGRGAAENDALTLRVARGNDL
FT                   WLHARGLPGAHVVVRLEKGKAPDADTLVDAAHLALHFSDARGAPQADVAYTRARFVKKP
FT                   KGSAPGAVTYSQEKVMLLRTEPGRVERLLAEEEGEQGERGTPVCPRPARPPGARQR"
FT   gene            199966..200709
FT                   /locus_tag="A2cp1_0182"
FT   CDS_pept        199966..200709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63541"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8U3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0171"
FT                   /protein_id="ACL63541.1"
FT                   /translation="MRPKESSRQLTLFSPEARRSAAHLLADALSGILTERVRLTVHDNR
FT                   STMVSFRRRPGEIHYRVHHMFLEAPGEVVSALAAFAVAGRGAAGARRRQAGSRIDAYVK
FT                   EHRARIAAPRAERLQPRGRVHDLQALFDRLNAEHFGGAIEARIGWGPVRLGRRRRTVKT
FT                   GVYVQDARLIRIHPTLDRPEVPEFYVAAVVFHEMLHQAVPAVEVNGRRVVHGTAFRRRE
FT                   RAYPDHERAKAWEDRNLALLLSSPA"
FT   gene            200826..202859
FT                   /locus_tag="A2cp1_0183"
FT   CDS_pept        200826..202859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0183"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: ank:AnaeK_0172
FT                   surface antigen (D15)"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63542"
FT                   /db_xref="GOA:B8J8U4"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8U4"
FT                   /inference="protein motif:PFAM:PF01103"
FT                   /protein_id="ACL63542.1"
FT                   /translation="MPRRLALPLVALLALSAAGCMAARAKPGEEPVLYGLEIQGTHALD
FT                   GDDIAEKLATQPSDRWAWQEVRRLDADALAVDRKRVEAYYRERGFYDAKVVDVQVRPDG
FT                   PGRAKVVMRVEEGEPILVRSVEVSGLDAAPEAKARVGALPIRPGERFTERDYDGARGAL
FT                   LHALRNTGWADGAVTQRAQILPAEHAAEVRYEVTPGTRYRFGPVFVAGTAAVPRDRVRE
FT                   QAGIEIHPGDWFAEDRLAKAQARVFDLGVFGAVRVTRGAPDPQRAVVPIVVAVREVPFR
FT                   TLRAGPGVGVQANTRWDVNGTVGWSHRNFMGDLRKLQLELRAGYAWLVARPRKEGPIAL
FT                   ATAEFSQPGAISRRIDATARLEIERGLEQAYDFWSERLRVGFPFRLARRLTLVPSWNLE
FT                   VYQLQNAVSTFDPTQPAKQGPELQNCQGSVCLLSYLEQRVGWDGRNDPLNPRRGVWVML
FT                   AVQEGFNVGGYGYRYLRFLPEARGFVPLGQKLVLAARARVGALVPVNQAGEPPIVARFT
FT                   AGGPQSMRGYYTGRLAPMVLRDGDWVPVGGNGLADGSLELRLDLTRSWGAALFVDGGNV
FT                   SRPSGVPTAYRDVLDPTQVQWAGGLGLRYRTPFGPVRFDVGVQLPTNLAAGVPFHQRFP
FT                   TVPSVENAGAPIYDKAGNLVGTVPATHREPWIAFHLSIGEAF"
FT   sig_peptide     200826..200903
FT                   /locus_tag="A2cp1_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.821 at
FT                   residue 26"
FT   gene            202859..207382
FT                   /locus_tag="A2cp1_0184"
FT   CDS_pept        202859..207382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0184"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   ank:AnaeK_0173 protein of unknown function DUF490"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63543"
FT                   /db_xref="GOA:B8J8U5"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8U5"
FT                   /inference="protein motif:PFAM:PF04357"
FT                   /protein_id="ACL63543.1"
FT                   /translation="MGRGASIGAALGAVAGAVGWLLLGLAALAGVALSGAVLVASWGVG
FT                   RPVVANALVRVADDALAGSFQLERITVLPRGGIELHGLRVFDPEGRLVLEVGRAAVFAD
FT                   LTRLRNRVIGVTAELDRPSVLVEEGEGGLSIARAFAPSHPSPPRPPGAPAPRDDGSGWT
FT                   LRVERLTLRGGDLWWVDGDGATRLEAQALDLDARGVIGPRRARVQLRLRGAADLPVPGA
FT                   LALDVRLARDGDLLRVSVLRARHGDTVLEAIGEGDLARRSGRLAITRLGVDSEKLRALA
FT                   PGVALGGDLAAAGYAESDGDVATAALHVAPRAGESRGGGDAAVAVRLDGSRSLGAEVAL
FT                   DALDPSRIWSGLPRGAVTLRARGGLSGTTLDDLRGRAQVSLARSTLRGGELGPGELTAR
FT                   ADRGSWEVERLTLQAPGVAVLGSGRWREGAGVSGRISADAGDLARLAANLERLLGQALP
FT                   PLAGRARVEATLSGTSRAPVLDGTVEGPHLAVGSFALHGAKGSGHVAGPFRAVTGRLHL
FT                   TADRVRSGGAELARALLLDAELAAADARLDASADVPALGREPVAVQARALRTERGDEVI
FT                   LRELAIAYPGTRYALTAPARLSLTGPRVDRLELASGAQRIRLEGGIGARGALDARAEVE
FT                   ALRLEGLPVGVLPSGAGLAGELSAQASASGTTRRPVAQAHLTLAGARFRGLDGLRAVAD
FT                   AAWDGGARRARLELSAARAAGGTADVRLDLPLPLKGRPGEPVSARVRGEALPLGPILQA
FT                   GGAALPASGEVSLEVALEGAIGAPSLRAEASLTGGAWDDLSAIGLGLTAEAPGERLTAR
FT                   LEATLEGRPAVSVRGEVPLDLSDLLTPPAAALRALRAGHAAVDARVPGLDLAALAGRLG
FT                   LPDDLAGRLSGDARLEGTLSAPRGRAAFQVDGGAASGVSGLEVALEAEAGAHRVGATVR
FT                   LAMGGVEVLRGEGSLAAAPERLLARGGLRSAPLSVVLVVPHASLARTSTSTLLVEGTVD
FT                   ARLTADGTLALPRLSLEAQGRGLQIEGRPLGDVTSQARWADGRGSARVTLAARAGGTLE
FT                   ATAAVDAPLGLDTRAADLRRAPAELALRARDLDLGFLPAVLSGWVRTASGKLQADVTAR
FT                   GPLARPSPRGTVRLADGRLAVSEYGDWTQIQVDASVTDDAVEIRRVAARRAHGSFEAHG
FT                   ALRGMGGPDARLEGRIVSRELPIMRAGMELATLDLQVDATGGYQPGALQVKLTVPRGTI
FT                   RLPKRAPRALQPLERRRDIVVGRQPEPKRAPLPVPRGPGDRPFTLTAQLVAPGRLMVVS
FT                   DNPRIRVELKANVTYELSGANDFATGTIEVVRGEVEPIGGRNFQIERGKVTFTGGPPRA
FT                   ALLDVEATYDNPVAKVTVAVAGPVSDPEIRLSSQPPMDDGQIALLIATGRTELKPGSGG
FT                   VGTLTGEEAGRAALGAVATQAFKNLVADKLPLDTVAVDAGALRAGKYVTDKIYVGYTRR
FT                   FDVQLEQGQNVNEVRVEYQITRRWTFESRYGDAQSGGASLIWSRDY"
FT   sig_peptide     202859..202948
FT                   /locus_tag="A2cp1_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.784 at
FT                   residue 30"
FT   gene            complement(207360..208550)
FT                   /locus_tag="A2cp1_0185"
FT   CDS_pept        complement(207360..208550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0185"
FT                   /product="integral membrane protein-like protein"
FT                   /note="KEGG: ank:AnaeK_0174 integral membrane protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63544"
FT                   /db_xref="GOA:B8J8U6"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8U6"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0174"
FT                   /protein_id="ACL63544.1"
FT                   /translation="MTSRARLLTFGLAAAWLAIGYLNVARGTSHAGAGYRFWSFQHHCY
FT                   SDVIALHGDRYLGGGRPLPYLEDRIEYPVLLGIALWLPSFAPGGALGHFTVSYAVLALC
FT                   LFAALLALERLPGARPFWLGATPALVYYAGLNWDLLPIALLCGALLALARDRPGAGGAL
FT                   TALGTSAKLFPGVLAPPALLALAGDGARAPLLRFGAGLAAALLAVNLPFALAAPAGWSW
FT                   FFRFNAGRGAENSIWDALGVGRGPLLEVLSTGPMLLAVALACAAAWRAARSGGDAGRAV
FT                   RLGVALALTAWIATNKVWSPQYALYGFLAGALAAAPAGLFLVLCAASVADFHIAFEVRA
FT                   RRWEPWFRDHVFHPDGVVRSLLWLLLAAWIARELWRCARAAPAEAHAEAVSSPSTR"
FT   sig_peptide     complement(208455..208550)
FT                   /locus_tag="A2cp1_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.568 at
FT                   residue 32"
FT   gene            208653..208805
FT                   /locus_tag="A2cp1_0186"
FT   CDS_pept        208653..208805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63545"
FT                   /db_xref="GOA:B8J8U7"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8U7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0175"
FT                   /protein_id="ACL63545.1"
FT                   /translation="MLWLLASVLLLVWIVSLAFKVTVGAIHLLLVAALVLYVLGFVRGR
FT                   HRTVT"
FT   sig_peptide     208653..208715
FT                   /locus_tag="A2cp1_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.694 at
FT                   residue 21"
FT   gene            208877..209539
FT                   /locus_tag="A2cp1_0187"
FT   CDS_pept        208877..209539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0187"
FT                   /product="DedA"
FT                   /note="KEGG: ank:AnaeK_0176 DedA"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63546"
FT                   /db_xref="GOA:B8J8U8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8U8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0176"
FT                   /protein_id="ACL63546.1"
FT                   /translation="MTPLQRLADALAALVSTTGPYAPGILFLATLVEYVFPPFPGDLLV
FT                   VLGAWYAVEGAISWPVTFVSVTAGGLAGAWLDHRVGAALGRRLDARAARHGALSVQARR
FT                   LARFEASYRRWGGWLLVANRFLPGVRAFIFIGAGASRIPLRRVLLLGGLSAALWNAVLL
FT                   AAGAFLAHNQEELIQLVQRYTNAAWAALAACALLWVLGLAWRRAARRRAAADGEEEA"
FT   gene            209536..210519
FT                   /locus_tag="A2cp1_0188"
FT   CDS_pept        209536..210519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0188"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   ank:AnaeK_0177 transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63547"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8U9"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ACL63547.1"
FT                   /translation="MIALAAAALLAALPEGQARYRVELSGEPVGAAELRVACAGARCVL
FT                   SFGTWLRAPEEAGGAVRVRRIEAEVDREGRLSGAVRRTEDGAPRAASAPPGRVPASAAE
FT                   LALLAASARAARGTAACLAAFDEEGGRAGLACAGPALADGAVVLDVLGEREEVRPGPDG
FT                   FPDEVRLPEQGARFVRDPAAAPPARAPRLPVRVAGPADPGRARAFCGRAVDAPAPAPPP
FT                   AAAPPARPGPGDCRAQAAAWIAAARRAGLEARQAVGVAHDGAGFTWHAWAEVRGPSGWI
FT                   AIDPAFGEAPARGPRFTVARFTMGDEAARAAAGREILACWGRGRVR"
FT   gene            210587..211258
FT                   /locus_tag="A2cp1_0189"
FT   CDS_pept        210587..211258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63548"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8V0"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0178"
FT                   /protein_id="ACL63548.1"
FT                   /translation="MRSRTAHRPARKAPPTIDRTATLALADRARARGRRRKAVALYQRV
FT                   LAQHPDDLAVHGKVAPLLAARGDRDGALRSFRAAIDGHRRAGFVDRALAVLAQATEAFP
FT                   RDDALWDEMANLELSRGRRADAVAALVRGGRTLLAARALGPAERLLHAAGRLEPWHGEA
FT                   TLLLARAWARSGRRRDAVRLLEGLAERTGGRTRAAARALALRLSPTPSRLWRWLRRGAA
FT                   A"
FT   gene            complement(211354..212502)
FT                   /locus_tag="A2cp1_0190"
FT   CDS_pept        complement(211354..212502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0190"
FT                   /product="peptidase dimerisation domain protein"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: ank:AnaeK_0179 peptidase dimerisation domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63549"
FT                   /db_xref="GOA:B8J8V1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8V1"
FT                   /inference="protein motif:PFAM:PF07687"
FT                   /protein_id="ACL63549.1"
FT                   /translation="MAARIEDALTWLQGQRGAMEALLERLVAQNSFTQNRAGVEAVANV
FT                   VAGQLRTLAMDVELRPSHHYGPHVLFTGRAAGAPVFLLGHTDTVFPPGTFEGFRRDGDR
FT                   ARGPGAFDMKGGIVAMLFGLAAAKRAGLLERVAVRGVLVSEEEVGSPESQAVIRAHAAG
FT                   AACALGFESGRPGDLVVTRRKGVASVRVEARGVAAHSGNEHEKGRSAIWSLARFVDRAQ
FT                   ALTDYARGLTVNVGTIAGGTTKNTVPASASCEVDLRFETVADGQALREAVEAAAREAAI
FT                   PGTELEVTAGAWRDPLERTPASSALAKEYGDCQRECGLGQGEAPLAGGGSDACTTGALG
FT                   IPTIDALGPRGKAFHTPGEEVDLGSLVPKASALARFLARRAG"
FT   gene            212618..213682
FT                   /locus_tag="A2cp1_0191"
FT   CDS_pept        212618..213682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0191"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: ank:AnaeK_0180
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63550"
FT                   /db_xref="GOA:B8J8V2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8V2"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ACL63550.1"
FT                   /translation="MATGKRFKAAVIGGSGYGGAEMIRRLLVHPDVELVRVASIDFVGE
FT                   PLSAADPALEAVTDLTFEGIPPAQAAAGMDVVLLGLPHTVAASKVPELAALPGVKVVDM
FT                   SGDFRLKDAAAYERWYKHVHPCPDRLADFVYGLPELNRERIRSARFVASPGCFATTIEL
FT                   ALLPLARAGLLEGVVHVQGITGSSGSGVAPSAGTHHPVRAGNLKTYKPLEHQHVPEITE
FT                   TLAAAGARDLALRFVPVSAPLSRGILATAFLELPEQWTQDRLDRLYREAYAGEPFVRVP
FT                   RKRLPEVAAVSGSNYAEVGVAVGSALRGRRTVTLFGATDNLVKGGAGQAIQNMNLVLGL
FT                   DEKASLADPGPWPP"
FT   gene            213679..214497
FT                   /locus_tag="A2cp1_0192"
FT   CDS_pept        213679..214497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0192"
FT                   /product="acetylglutamate kinase"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: ank:AnaeK_0181
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63551"
FT                   /db_xref="GOA:B8J8V3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J8V3"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACL63551.1"
FT                   /translation="MKTIVLKLGGEIVHSPELDLVARDLRTLVDGWNRVAIVHGGGPQA
FT                   TALQKRLGLETRMVAGRRFTDEATLEVMKYVVAGRLNVDLCGRLLANGVMPVGLHGASG
FT                   HAIQATRRPPRVMQGAGPEPVDLGLVGDVVGFNLPLLGDLFERRYVPVLACLGCDDAGQ
FT                   ALNINGDTVASQLAGALRADALVLVTSTPGVLRDVKDPSSRIPRITRAEFERLVADGTI
FT                   SGGMIPKLEESFEVLRGGARSVVILGKLAPGDLEAALLEPGSAGTVLVAD"
FT   gene            complement(214520..215053)
FT                   /locus_tag="A2cp1_0193"
FT   CDS_pept        complement(214520..215053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63552"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8V4"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0182"
FT                   /protein_id="ACL63552.1"
FT                   /translation="MRRLALAALALSLASACASREALWRYREEGTFGDGAPPLHAEPIG
FT                   GGAEYRLVSASLGEADLSLERSVAALGDAPVRVDLGRVRLRSASGEELPLVRACLLEAT
FT                   PRCAAGGASRGFVATLSPGEVIRFRADFGPVDVLGPDRAPNPEVLKVTLAEEGVYVGGR
FT                   LQPVTVVLEKVPAR"
FT   sig_peptide     complement(214994..215053)
FT                   /locus_tag="A2cp1_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.330 at
FT                   residue 20"
FT   gene            complement(215136..217001)
FT                   /locus_tag="A2cp1_0194"
FT   CDS_pept        complement(215136..217001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0194"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: ank:AnaeK_0183 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63553"
FT                   /db_xref="GOA:B8J8V5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8V5"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACL63553.1"
FT                   /translation="MLLHPAGAPRGGPSGLRFPAFLWALLHVPVFLALYATSIGQAVQA
FT                   TPAPYRAWLWPTFVPQALLLALVAFALALPFSLAPRAYRFAVGAAAGLLTGGLAVDAKV
FT                   LQSVGFHLNGFFLRVMLQPNALRETGVPLSDVLLFLGGALALVAVDVLAGAWFVRRFAA
FT                   PARRAWPWALALLLLSAAERVYGGGLTYFAGSSVFAASTTLPLQVPIRMQGLARSVFGD
FT                   RTNDPFEGANASKRLPAGVDPAELRFEHRPDVLFVVAESLPAEHLDARTMPRLWARAEH
FT                   GARFTRHYAAASSTNYTLFSLVYGLQAQKLEAVVGAGRQPTLFPALTENGYQVKVSAAS
FT                   CVDWMDLQKTVFGGVSDLETWCDGNDPSTRDAQMLKSARAFTARADPARPVFLFLFFFG
FT                   THFNYFHDPEDQVFAPAWDGAGGLKATRAPGVEIEHRARNAAHALDRALDAFLDDFTRT
FT                   RGREPLVVFTGDHGEEFRQKGHLGHGSAVTDEQIHVPAVWLGPGVPAGVRDAVTSHVDV
FT                   VPTLFSLLGERHPASLYADGLSMFEAPEDRFVVSTVGWEPRYAAIGKDLKVTMYAGMGG
FT                   AQITDPDDRPLPDGPARMARQAGRILRALRGEAEPAPRAAAAPAP"
FT   gene            complement(217014..218168)
FT                   /locus_tag="A2cp1_0195"
FT   CDS_pept        complement(217014..218168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0195"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ank:AnaeK_0184
FT                   integral membrane sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63554"
FT                   /db_xref="GOA:B8J8V6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8V6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL63554.1"
FT                   /translation="MISSAASRGPVRPETVEPGRGNGEDGEAVPGRQITTPRAVAAAVR
FT                   PEAWPALAMFGLCALLAAETALLAAFGLGGGEALLPGGDHDGVLFGASLAAAVLGGALA
FT                   SVTLVRAIRASRADRDGRAQAEAALRARDEFLGLAAHELKTPLTALFLELGAAGREATR
FT                   RGDEPVQGHLARADRAARRLAELVSRLLVDARAAAEPLALEEVELGSLANDAVDARREL
FT                   FDRARCDVTVRAEGPVSGRWDRTRVDRALASLLANAAKYGQGRPIEVTVRAEGAQARLS
FT                   VRDHGIGIPPERRAAIFDRYARAVSARHYGGLGLGLWIARREALALGGTVTVESRPGHG
FT                   AEFTLRLPAGAAPPLRRLPRAAGGALARAPARALRWLAWRSRRC"
FT   gene            complement(218353..218781)
FT                   /locus_tag="A2cp1_0196"
FT   CDS_pept        complement(218353..218781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63555"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8V7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0185"
FT                   /protein_id="ACL63555.1"
FT                   /translation="MPFEPAFMSRLEAFQAELAEVRAPAGWMAFRARWFTDLPWPRRTP
FT                   EALAAARGDGAPWVVAGRTFRRAPLPDDLTPEARYAYFSALARGFAAMYPHDAPGTGGS
FT                   AVRHHCPACELFSDEPGDPTCPGCGRPLLAMRLAPPAR"
FT   gene            218859..219452
FT                   /locus_tag="A2cp1_0197"
FT   CDS_pept        218859..219452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0197"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: thiopurine S-methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ank:AnaeK_0186 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63556"
FT                   /db_xref="GOA:B8J8V8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8V8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL63556.1"
FT                   /translation="MADSQRRVFDDRYREGTPPWDIGRPQAELVALAEAGEIVGDVLDV
FT                   GCGTGENALHLAALGKRVLGVDGSPTAIARALEKAAARGLQVPFLVADALDLKALHRRF
FT                   ETAVDCGLFHVFDRADRRTYAQSLTEVLSPGSTLHLLCFSDEEPPGPGPRRISESDVRD
FT                   AFRSIFALTRLREARFERLGADPARAWLATLVRI"
FT   gene            complement(219683..220480)
FT                   /locus_tag="A2cp1_0198"
FT   CDS_pept        complement(219683..220480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0198"
FT                   /product="nucleoside-specific channel-forming protein Tsx"
FT                   /note="PFAM: nucleoside-specific channel-forming protein
FT                   Tsx; KEGG: ank:AnaeK_0187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63557"
FT                   /db_xref="GOA:B8J8V9"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8V9"
FT                   /inference="protein motif:PFAM:PF03502"
FT                   /protein_id="ACL63557.1"
FT                   /translation="MTLRSLLRASFLLALVAAAPAARAGGFSTTNVQLLQGWNFDKAID
FT                   TSFAGKLKDGTKTTLTLNHFSTWEYGDNFAFFDLSRGRFEADDSQWTDAYVEWHPRLFV
FT                   NQLLGQKEPLFGVIRNWGFAGEVNQGAGFYAYMGGLGLDFAVPAGWVLGLNTYYRYDNF
FT                   NRHGWQVSPFWTVPFAVGKVPFLFTGFIDVNGLKDEGGFYTGSDNGVEIWSQPQLLVDA
FT                   LAPFGGKAGKLYVGVEWWLHYYSLGSFEETTSAPQAMVQWTVF"
FT   sig_peptide     complement(220406..220480)
FT                   /locus_tag="A2cp1_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            complement(220526..221572)
FT                   /locus_tag="A2cp1_0199"
FT   CDS_pept        complement(220526..221572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0199"
FT                   /product="Arginine N-succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /note="PFAM: arginine N-succinyltransferase beta subunit;
FT                   KEGG: ank:AnaeK_0188 arginine N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63558"
FT                   /db_xref="GOA:B8J8W0"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8W0"
FT                   /inference="protein motif:PRIAM:2.3.1.109"
FT                   /protein_id="ACL63558.1"
FT                   /translation="MLLLRDAQKTDLAGLAALAKVLNTVNLPYDERALSGIVDRSVRSF
FT                   AGKIRDPLERAYVFVAEEPRTRRIVGTSMIIAQHGTRESPCTFFDVSEREHYSSTIDRH
FT                   FKHQVLSIGYHFDGPTEIGGLVVHPGLRGGEARAGKQLAFVRFLYMAMFRDRFRERVLA
FT                   ELMPPLTKDGRSLFWEAFGKRFTDLDYQEADKKSRENKEFIQQLFPPSDVYATLFPPAV
FT                   RRLLGKVGPDTEPVRRMLEKIGFRYVDRIDPFDGGPHYEATLADITLVRAYRRARLAPE
FT                   PLDGELHGGEDCLIAVTRGEGRTRFRAVRTGARLDGTNVWIPQRAREVLDGRPGERVHV
FT                   VPFDGGAR"
FT   gene            221716..222177
FT                   /locus_tag="A2cp1_0200"
FT   CDS_pept        221716..222177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0200"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   ank:AnaeK_0189 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63559"
FT                   /db_xref="GOA:B8J8W1"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8W1"
FT                   /inference="protein motif:PFAM:PF02580"
FT                   /protein_id="ACL63559.1"
FT                   /translation="MEGRVRAVIQRVSRAEVRVGGAATGAIGRGLLVLLGVARDDGAPD
FT                   ARLLADKIAALRIFEDAAGKMNLAVAEVGGAVLVVSQFTLLGDARRGNRPGFSDAAPPE
FT                   AANALYESVCGMLREKGLRVETGVFRAEMEVELVNDGPVTILLDSRRLF"
FT   gene            222190..222534
FT                   /locus_tag="A2cp1_0201"
FT   CDS_pept        222190..222534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0201"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   ank:AnaeK_0190 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63560"
FT                   /db_xref="GOA:B8J8W2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8W2"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ACL63560.1"
FT                   /translation="MSDCLFCRIVRGEIPAKLVHQDADTVAFVDINPQAPTHLLVIPRK
FT                   HIPTANDLAPEDEALMGKLYRVAAALAKERGIDGSGWRAVVNTHGDAGQTVFHVHLHLL
FT                   GGRRMGWPPG"
FT   gene            complement(222551..223369)
FT                   /locus_tag="A2cp1_0202"
FT   CDS_pept        complement(222551..223369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0202"
FT                   /product="SNF2 superfamily protein"
FT                   /note="KEGG: ank:AnaeK_0191 SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63561"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8W3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0191"
FT                   /protein_id="ACL63561.1"
FT                   /translation="MTALPAIALGLGLALGQAAPERGGDAGQAASPAPPAASAAQGTAP
FT                   PAAGPRPREATEEPGAGGSRDAQRRLDAPARDDAAAQPDPAAAAAQAEPAADAAQAERA
FT                   AAAAQAELDQLRTQVEALRAEVEALRASGAEADAHTAAVEQELAEARARRAAEADAAAR
FT                   SPAERAQATGGALQRMDGALRALAAGDASGVDAALAGDAAALEAARAEAGRRGSAEEAA
FT                   QAEAGARSLAAAREALARGDLYQARLLLANAARSAAAANRLARQGAAPAP"
FT   sig_peptide     complement(223313..223369)
FT                   /locus_tag="A2cp1_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.488 at
FT                   residue 19"
FT   gene            223476..224369
FT                   /locus_tag="A2cp1_0203"
FT   CDS_pept        223476..224369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0203"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: ank:AnaeK_0192
FT                   citryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63562"
FT                   /db_xref="GOA:B8J8W4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8W4"
FT                   /inference="protein motif:PRIAM:4.1.3.6"
FT                   /protein_id="ACL63562.1"
FT                   /translation="MPVVRPRRSALYLPGSNARALEKARTLPADALLLDLEDAVAPAAK
FT                   DAARAQVVAALAQGGFGRRERVVRVNGLGTPWGAADLAALARAGADAICLPKVERAAEV
FT                   HAAVQALAAGHAPAGLALWCMVETPRGVLAADEIAGASPRVACLVAGTSDLVKDLGARH
FT                   TAGRAEVLTSLSLVLLAARAHGLAALDGVFLDLEDAAGLEAACRQGRDLGFDGKTLIHP
FT                   KQLEAANRAFAPDDAELERARRVIAAHAEAEAAGLGVTVVDGRLVEALHVAAARRTVAL
FT                   AEAVAAGHGGPDPHGG"
FT   gene            224442..224795
FT                   /locus_tag="A2cp1_0204"
FT   CDS_pept        224442..224795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0204"
FT                   /product="chorismate mutase"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase
FT                   of the AroH class; KEGG: ank:AnaeK_0193 chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63563"
FT                   /db_xref="GOA:B8J8W5"
FT                   /db_xref="InterPro:IPR008243"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8W5"
FT                   /inference="protein motif:TFAM:TIGR01796"
FT                   /protein_id="ACL63563.1"
FT                   /translation="MRGIRGATQCSANTVEAIEDAVKELCREITSRNQLEPQQIVWAIF
FT                   TVTHDLDADFPARAARVQGWNAVPMICSQEIPVPGSMPRIVRVLLHVDSDGPRNHVYLR
FT                   GAQALRPDLHVRP"
FT   gene            224824..225690
FT                   /locus_tag="A2cp1_0205"
FT   CDS_pept        224824..225690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0205"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; 6-phosphogluconate
FT                   dehydrogenase NAD-binding; KEGG: ank:AnaeK_0194 prephenate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63564"
FT                   /db_xref="GOA:B8J8W6"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8W6"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ACL63564.1"
FT                   /translation="MNVPTNRPLPALPGHLGVVGLGLMGASLARAARRVDRGVRITAVE
FT                   PRAEVRARALADGVADQVSAEPDAALAGCGVVVLCTPVATIEALLAPVSALLADGAVLT
FT                   DVGGAKERVVTLARERVRPGVAFVGAHPMFGGHGGYDGATAEKWSAGGTVAICTDGDPG
FT                   AVDRVAALHLALGAKVERCTAAEHDAAVAMVSHLPYLVASALSVAVREAGPLAMHLAGP
FT                   GLKDATRLAEFPFDIQGEVARRNAHLPEAARRLERHLARLLAAIAESPESARSALEAAR
FT                   AAREELF"
FT   sig_peptide     224824..224919
FT                   /locus_tag="A2cp1_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.606) with cleavage site probability 0.537 at
FT                   residue 32"
FT   gene            225687..227009
FT                   /locus_tag="A2cp1_0206"
FT   CDS_pept        225687..227009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0206"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   ank:AnaeK_0195 3-phosphoshikimate
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63565"
FT                   /db_xref="GOA:B8J8W7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J8W7"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ACL63565.1"
FT                   /translation="MSAAPTSGPLTCRRAGPLRGAIEVPGDKSISHRSLLFGALSTGET
FT                   RVAGLLDAEDVHSTRRAVEALGATVRTEGAEVVVTPPATLREPGDVIDCGNSGTSLRLL
FT                   TGVLSGVPGLSVLTGDASLRRRPVRRVIDPLRVMGANLSARDGDRLPPVVVRGGALRGA
FT                   RHLLPVASAQVKSALLLAGLFAEGETTVVEPEKSRDHTERMLRGMGVPVKVSGLEVSVS
FT                   AARPAGGRVDVPGDISSAAFFLCGAAALPGSEVTVRNLGVNETRTGLLDVLRAMGADVR
FT                   LANLREVAGEPRADVTVRADRLEGTEIRGATIPRLIDELPVVMVMATQARGRTVIRDAK
FT                   ELRVKESDRLAAMGETLSRAGARIELFEDGCAIDGPTPLRGVEVRTRLDHRIAMSMAVA
FT                   QLFCGGEPVVLDDVACVATSFPSFFRLLDQVSGQASGGGAP"
FT   gene            227006..227842
FT                   /locus_tag="A2cp1_0207"
FT   CDS_pept        227006..227842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0207"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: ank:AnaeK_0196
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63566"
FT                   /db_xref="GOA:B8J8W8"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J8W8"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACL63566.1"
FT                   /translation="MITGRTALYGVVGHPVAHSRSPEMQNAAFARLGVDAVYVALPVAP
FT                   ERIDEALRGAHALGFQGLNVTVPHKPRAASLCHALDPVATAVGAANTLRRTRDGWDGFN
FT                   TDAPACRTLLEAAGVVRGSRALLVGAGGAARAAAWALVQLGTEVRVAARREEAAAELCR
FT                   DLAAAVPGADLAAADFEDLEAEADAAAVVVNGTSVGLPGHEGRLPPLRFRAAQVVLDFV
FT                   YGDTELARAARAAGARLVSGEQVLVRQGALAFTIWTGQPAPEADMARALEAREGAR"
FT   gene            227839..228984
FT                   /locus_tag="A2cp1_0208"
FT   CDS_pept        227839..228984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0208"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: ank:AnaeK_0197
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63567"
FT                   /db_xref="GOA:B8J8W9"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J8W9"
FT                   /inference="protein motif:PRIAM:4.2.3.5"
FT                   /protein_id="ACL63567.1"
FT                   /translation="MTLRYLTAGESHGPALVAIAEGFPAGLAVDFEAVDRDLRRRQKGY
FT                   GRGGRMKIETDAAQFLAGLRGGLTTGAPIALAVWNKDHENWKDLVSPYARGGKKFTQVR
FT                   PGHADLAGALKYGLDDARDVLERASARSTAVTVALGALAKALLSTLGVEVCSRVVAIGP
FT                   REIRPDAPPTPAQRDAIEASDLHVDDEALAAEWRALIDAEKARGGSIGGAFDVYATGLP
FT                   IGVGSHVHPDRRLDARLAGALCGVQAIRAVEIGDGTQVGRPGYEFHDAIHHDPARGFWR
FT                   DTNRAGGLEGGMTDGMPLRVRAYMKPIPTMLHPLATVDLATRAATQARYERSDVCAVPA
FT                   AAVVGEAVVAWELANALLEKFGGDAVEDVRRAVEAYAARIR"
FT   gene            228965..229453
FT                   /locus_tag="A2cp1_0209"
FT   CDS_pept        228965..229453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0209"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: ank:AnaeK_0198
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63568"
FT                   /db_xref="GOA:B8J8X0"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8X0"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ACL63568.1"
FT                   /translation="MPLGSAETLALTGMMGSGKSTVAPLLARWLGRRLVRLDDEIVRAA
FT                   GKPIARVFAEDGEGRFRALERAAVAALPPGAVADLGGGAFCDPHGAARLLATARVVFLD
FT                   VSAQEAARRIGEDPARPLAARWEALRARRLPLYRRAHLTVHVDGMTPEAVARRVLESL"
FT   gene            229450..230604
FT                   /locus_tag="A2cp1_0210"
FT   CDS_pept        229450..230604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0210"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG:
FT                   ank:AnaeK_0199 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63569"
FT                   /db_xref="GOA:B8J8X1"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8X1"
FT                   /inference="protein motif:PRIAM:4.2.3.4"
FT                   /protein_id="ACL63569.1"
FT                   /translation="MSRTRKPAAAEEAGAAVTEIIPARQGDHAYEVRVGAGAAAALPAL
FT                   ADEHDAVALVSCRRVLSIPFGKDVLARLRREAPLALVHALPDGEAGKTLAELERAAAKL
FT                   LRAGATRRTLVVALGGGAVSDAAGFLAATYMRGVPWVAVPTTLLAMVDAAIGGKTAVNL
FT                   PAAKNAVGAFHPPDAVLADPAALRTLPRRELASGLGEVLKYGALQPALLDAFAALGAAA
FT                   PDPAVIATCARMKVDVVAEDPTEHGPRKLLNLGHTFGHGVEAAGRFSRYTHGEAVAVGL
FT                   AFAFRLAARMGRVDGAAVERVEAAVAGAGLPVRVPPAIARAAARLMAYDKKRAAGGLRW
FT                   VLPAAVEDGWRVEWDVEAEPAAVEAAVAEISEARAGGRAGRRTR"
FT   gene            230601..231071
FT                   /locus_tag="A2cp1_0211"
FT   CDS_pept        230601..231071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0211"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: ank:AnaeK_0200 3-dehydroquinate dehydratase,
FT                   type II; TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63570"
FT                   /db_xref="GOA:B8J8X2"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8X2"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ACL63570.1"
FT                   /translation="MILVVNGPNLNLLGEREPDVYGRSTLGDVELLVRDACAAWDVEVK
FT                   AFQSNHEGAIIDFLQEHRKQARGIILNAGALTHTSYALHDCLKAMPAPAVEVHISNIHQ
FT                   REAFRHVSVLAPACRGQIVGLGIRGYLLAAEWLCAEIGAQPRVAADRKKPSP"
FT   gene            231081..232085
FT                   /locus_tag="A2cp1_0212"
FT   CDS_pept        231081..232085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0212"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ank:AnaeK_0201 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63571"
FT                   /db_xref="GOA:B8J8X3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8X3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACL63571.1"
FT                   /translation="MPRVAVLLPARDAARTVRAAAVSILRQTERDLSLVCVDDGSRDGT
FT                   AEVLERLAARDRRVRLLRGPGEGIAGALQRGLAACDAEVVARMDADDVAHPRRLALQLD
FT                   ALRADPSLAALGGRVRLFPRAAVRPGMARYAAWLNGLVTPALVERDLLVEAPLVHPAAA
FT                   IRRDALERAGGWRDGPFPEDYDLWLRLSAAGGRLGNLSAPVLAWRESAGRLTRTDPRYA
FT                   LARHVALKCAHLARHVLVGAREVALWGAGETGRAFSDALRAEGIATAAFVEVDRRKIGR
FT                   TVRGARVVSYEEVGRLRGLPLLVAVGAPGARDLIRAELARAGFEELADFRCVA"
FT   gene            complement(232089..232568)
FT                   /locus_tag="A2cp1_0213"
FT   CDS_pept        complement(232089..232568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0213"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin Dps family
FT                   protein; KEGG: ank:AnaeK_0202 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63572"
FT                   /db_xref="GOA:B8J8X4"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8X4"
FT                   /inference="protein motif:TFAM:TIGR00754"
FT                   /protein_id="ACL63572.1"
FT                   /translation="MKGDAKVLDVLSEVLMNELTAINQYFLHARICENWGYDRLYAKFR
FT                   AESIDEMKDADHLIERILYLEGMPNVQKLSKVNIGENVPEILAADLDLEKHAIGALNRG
FT                   IETCRNAGDNGSADLLEDILEGEEEHANWLETQLTAIDQIGVQNYLTEQLKKDGG"
FT   gene            complement(232768..232980)
FT                   /locus_tag="A2cp1_0214"
FT   CDS_pept        complement(232768..232980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0214"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: afw:Anae109_1723 BFD/(2Fe-2S)-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63573"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8X5"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ACL63573.1"
FT                   /translation="MIVCLCFNVSDTLVRRRAAEGASLRQVIAETGAGTACRCCVAALA
FT                   KVHAGGAAAAPPCARAQPAARRDAA"
FT   gene            complement(232977..233258)
FT                   /locus_tag="A2cp1_0215"
FT   CDS_pept        complement(232977..233258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63574"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8X6"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0204"
FT                   /protein_id="ACL63574.1"
FT                   /translation="MIVRVILNIISGAPVHPPRDPAPSSATPEPSCALVCTRCGAVVAI
FT                   DPDLRALAASAASRNGFEVRAPRLRLFGCCAACRAGAAGPLPRGWGRA"
FT   gene            233391..234443
FT                   /locus_tag="A2cp1_0216"
FT   CDS_pept        233391..234443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63575"
FT                   /db_xref="InterPro:IPR025409"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8X7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0205"
FT                   /protein_id="ACL63575.1"
FT                   /translation="MPDSFDLGAFRRDLTRRTADAVHALRSRIGSETLYGFALFTSGER
FT                   DFAWVRASANTEDALTRRAAAAAALDPRFRGEAGRRLLRWSAPDWEYHDFAPEVRGLAV
FT                   PPPEGRRSTLDPALYDAFVGALKAVDRAGLFGRGADRAFLTVNILCDHASPAFFRRGLR
FT                   VLNPVPTAERHLHETAAAPFVRCVNRAPRRERMRIWLALYEDLYMEWRTPIAEEARARG
FT                   LSPWEVEEELARFGPKVVPALIDLLAHYGFAAPIDHNRGFETREVWLAGSALFLVRRIG
FT                   MVAEAEIARLQRLVGDFAERDRRLRVASTLAENTARVLHELRPRRFPPSEMDPLTFKLT
FT                   NPEPFLLRRP"
FT   gene            234478..235293
FT                   /locus_tag="A2cp1_0217"
FT   CDS_pept        234478..235293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8X8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0206"
FT                   /protein_id="ACL63576.1"
FT                   /translation="MTDRSRRARPAAPRPPPHDRHVLYERAVQHADSELDLVDRAVRRG
FT                   GGTPRRLREDFSGTALLSAAWVRRGRDRSAVAVDLDAAVHAWARAHRVPGLGAAAARLR
FT                   LVEADVREGPPGPFDAVIAFNFSYGVLQTREALGAYLTAAAGALAPRGALLLDAYGGWD
FT                   AEKELVERRRIGGGVSYVWEQESFDPITRRVRCAIHFELPGGRRLRRAFTYDWRLWTVP
FT                   ELTELMREAGLEPEVLWDVAPRGATRYVPRRSASNQGGWIAYVVGRRRP"
FT   gene            complement(235290..236195)
FT                   /locus_tag="A2cp1_0218"
FT   CDS_pept        complement(235290..236195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0218"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: ank:AnaeK_0207 pseudouridine synthase, RluA family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63577"
FT                   /db_xref="GOA:B8J8X9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8X9"
FT                   /inference="protein motif:TFAM:TIGR00005"
FT                   /protein_id="ACL63577.1"
FT                   /translation="MRRLTLLVPDADRYERIDRFIAARGGISRGLARRAIEAGGVFVDG
FT                   RRCKVAGRTLTPGQQVVVNLEEGGRAAPALAALGRERLLYADADLCAVDKPAGVPAQPT
FT                   LTTDRGALPELVSALLGAPVTLVHRLDRETSGVTVFARTRDAAAALAEAFRTGTPEKTY
FT                   LALCARAPSPAEGRVALALGKDPARPGLRRVDPAGDPAATRYRTLREAPGGALVEARPE
FT                   TGRTHQIRVHLAALGAPLLGDARYGGPRRVGEVAAPRVMLHATRLELPHPATGARMVFE
FT                   AEPPEDFRAVEAALVGPPER"
FT   gene            complement(236213..236488)
FT                   /locus_tag="A2cp1_0219"
FT   CDS_pept        complement(236213..236488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0219"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: ank:AnaeK_0208
FT                   regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63578"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Y0"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ACL63578.1"
FT                   /translation="MPIYEYECPKCGRFDALQKMSDPALQVHEVCGSKVRKLMSASAFA
FT                   FKGSGFYITDYGGKSAAAITPDRKPEKKAEPKSEACASCPANKSAA"
FT   gene            236666..238045
FT                   /locus_tag="A2cp1_0220"
FT   CDS_pept        236666..238045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63579"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Y1"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0209"
FT                   /protein_id="ACL63579.1"
FT                   /translation="MDAQERDRLAGELDALTTALEEARGRHAAGLDPEPSLAPLFAAHS
FT                   EAAHRRTVDALREAGEEALAARVAALRAGRAAAAGEEAWRAAEAAARGRGPDGEAPLAT
FT                   LELAALRERDRERRLALARAAAAALEPAAAHREAACEAAARARAEVGHAPDWRVVVEGD
FT                   QLLAASDDAWRDVLAYRARAELALAPLPAGDLTRADLLHLAALARWDGLFRAGMLPVAL
FT                   KLTLEPLGLDGRARVDAAERPAQWPGVHVHGARMSFRPRGGAGDWQDLAEGVGRALGAA
FT                   AAPPHRRDPALGAALGWLLGSLLLEPRWLADRAGVERRQAADVVRDLALRRLLALRARA
FT                   GALRVATEVERGLSGARWREAYVEAMEGATGARWEGVRAARDADAAAHAAALRGADAGE
FT                   RLRRDLRERLDEDWWRNPRAAPLLAGLLAAGALPPEPGDATPAPGDAARALVVRLEGKA
FT                   P"
FT   gene            complement(238196..238549)
FT                   /locus_tag="A2cp1_0221"
FT   CDS_pept        complement(238196..238549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63580"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Y2"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0210"
FT                   /protein_id="ACL63580.1"
FT                   /translation="MARMETKKKGTTAVVTEGSAQAALRRGPARELTPEEERVVRMRLG
FT                   AAPPRAAPLERSAEGLSDLEIEVLSYEIEAYMKWREREQATAPATAPVRAPAAAAPSRA
FT                   KEKIIRALRKKGL"
FT   gene            238794..239246
FT                   /locus_tag="A2cp1_0222"
FT   CDS_pept        238794..239246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0222"
FT                   /product="CoA-binding protein"
FT                   /note="KEGG: ank:AnaeK_0211 CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63581"
FT                   /db_xref="GOA:B8J8Y3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Y3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0211"
FT                   /protein_id="ACL63581.1"
FT                   /translation="MADWRENLVERDEDIRRLLAPVRRVAVLGIKTEAQSDQAAFYVPR
FT                   YLKDAGVEVVPVPVYYPEVKTILGAPVYRTIAAIPGTVDLVNVFRRPADVPAHVDDLVA
FT                   KKPAVVWLQLGIRNDLAAEALARAGIRVVQDRCLMVEWRRLGPAED"
FT   gene            complement(239271..239441)
FT                   /locus_tag="A2cp1_0223"
FT   CDS_pept        complement(239271..239441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63582"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Y4"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0212"
FT                   /protein_id="ACL63582.1"
FT                   /translation="MAKLESVEGYGVLVLAVALLAAFTLRMSNPPADVVRAASAPRAVT
FT                   VLEEISIPLAP"
FT   gene            complement(239618..240574)
FT                   /locus_tag="A2cp1_0224"
FT   CDS_pept        complement(239618..240574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0224"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   ank:AnaeK_0213 cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63583"
FT                   /db_xref="GOA:B8J8Y5"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Y5"
FT                   /inference="protein motif:PFAM:PF02628"
FT                   /protein_id="ACL63583.1"
FT                   /translation="MKAFARFAWSVLAYNLAVVVWGAFVRATGSGAGCGKHWPMCNGEV
FT                   VPRSPALETVIEFTHRATSGVALLLVVALVVAARRTFPPGHPARRWAWASLGLVLVEAL
FT                   VGAGLVLFGWVAKDDSAARGWVVAVHLTNTFLLVGAIALTAALAGRARGLALRGHAGLT
FT                   GALGLAAGALVLTGASGAIAALGDTLFPATSFAEGLRQELSEEAHVLLRLRVLHPFVAV
FT                   FSTLALGWAARSALRARPDADTRAASFAVLLLAGLQLFAGVLNVALLAPVWMQLVHLLV
FT                   ADLLWVALVVLAATALSPPAGAASPAGARPGDAPALG"
FT   gene            complement(240632..241321)
FT                   /locus_tag="A2cp1_0225"
FT   CDS_pept        complement(240632..241321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63584"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Y6"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0214"
FT                   /protein_id="ACL63584.1"
FT                   /translation="MRAAFAAGMALAVLASCRTVQTRQDFTPVSDADFGRLGPDQLGPV
FT                   GPARADAAAAHDAVARAKLRLQEAKREQGYAEADRTAAEADLQRAATEAKGANSAGDTA
FT                   WKARAQALADTAGLRRQAADAHLVFAKRLAEARQADVDAAEAHADAAQARLEQAKLQAL
FT                   ARAGIPAAGKYDARRFDAHLAKAVAAEREAQARAGETGRAAVAAEDGWRALQRRWEARS
FT                   QGRGGTG"
FT   sig_peptide     complement(241253..241321)
FT                   /locus_tag="A2cp1_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.803 at
FT                   residue 23"
FT   gene            complement(241379..242356)
FT                   /locus_tag="A2cp1_0226"
FT   CDS_pept        complement(241379..242356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63585"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Y7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0215"
FT                   /protein_id="ACL63585.1"
FT                   /translation="MRRAPLALCLVALACSRSDPEARARVLGREDRPHEPAPAAFDPEH
FT                   PEAALALDADEAARRLGAFDWTAAAEWTVAAPGDEARQVHVTEHHQLRQSATGEFEVRA
FT                   EIDPGLGPGSSGGKQVIWTGGTTYARALPAPFRERPTDRGRDARRFRDDSFRLAGTVAA
FT                   LVGPALRLEPAGEARLLGRAARRYRLSLAPPAPGAKPPATPPPPPGTPAPDPDTARRLG
FT                   FLQGRVPVAADGELLADAETGVPLRVRLSGAFEVPNAPGVKARIELLAEVKALGAAVGA
FT                   VTAPAGALPDERKPAGPSTALEAAGLKKRGEEPARPGEPADEGE"
FT   sig_peptide     complement(242300..242356)
FT                   /locus_tag="A2cp1_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.632 at
FT                   residue 19"
FT   gene            complement(242400..244223)
FT                   /locus_tag="A2cp1_0227"
FT   CDS_pept        complement(242400..244223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0227"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: GTP-binding proten HflX; PFAM: GTP-binding
FT                   protein HSR1-related; KEGG: ank:AnaeK_0216 GTP-binding
FT                   protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63586"
FT                   /db_xref="GOA:B8J8Y8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Y8"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ACL63586.1"
FT                   /translation="MQEVHGNTLGLKPSQLHALRRTYRRRVDAQSIVTPELARHLAEVS
FT                   RETNRQVGVLLDRKGDVQAVVVGDARKLDLPDVGRGRAGESRLRGLRLVHTHLNGEPLT
FT                   RDDHTDLALLRLDLVAAIEVREDGLPGRVHYAHLLPENPQGAMWKDEEAPTVHDLAYDA
FT                   LSGALALEDEFARARAARRTGGRERAILVGFGGKGRGRAEAEASLEELKELARTAGVEV
FT                   LEATLQLRRDPDPRYLIGKGKLEDIVLRSMQRMATVIVFDAELSPSQARHIAEATSLKI
FT                   LDRTQLILDIFAQRAQSADGKLQVELAQLKYLYPRLVGRDDSLSRLAGGIGGRGPGETK
FT                   LEIDRRRVRDRITALERRIEALGADRHLRRKQRNARGLPVLSIVGYTNAGKSTLLNALT
FT                   DSAVLAEDKLFATLDPTSRRLRFPRDREVIITDTVGFIRDLPPDLVNAFRATLEELGDA
FT                   DLLLHVVDASDPRQDEQIAAVEEILRGLGLDGKRRLLVLNKVDRLPPETRAALAQRRDA
FT                   AAVSAVTRAGLAGLLSRCEQLLWTDGRVALGDVIAAPAGEEGAGAAEHLADVAAPEPLA
FT                   PEPPAPAAASVPGPGEPGPPRLLPSSLRRVS"
FT   gene            complement(244345..244620)
FT                   /locus_tag="A2cp1_0228"
FT   CDS_pept        complement(244345..244620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63587"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Y9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0217"
FT                   /protein_id="ACL63587.1"
FT                   /translation="MEPAIALDANAIRMDGVLDVPTARRLAAQLAIAPAGSLVRIDLTH
FT                   VRELHDFGLAVLAQALSARGIRVSFRGLGQHQLRLLRYLGLDAVAA"
FT   gene            244926..245216
FT                   /locus_tag="A2cp1_0229"
FT   CDS_pept        244926..245216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63588"
FT                   /db_xref="GOA:B8J8Z0"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Z0"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0218"
FT                   /protein_id="ACL63588.1"
FT                   /translation="MNRFVVRRRADGVVHLRRRSFRHLLVDRIAWTMALLFVATAAGMT
FT                   ALVAALVEFPLVVILLAPVVGLGIWAGRLARGDGLQPAPAPVDPRPPRRVA"
FT   sig_peptide     244926..245075
FT                   /locus_tag="A2cp1_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.742 at
FT                   residue 50"
FT   gene            245410..246657
FT                   /locus_tag="A2cp1_0230"
FT   CDS_pept        245410..246657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0230"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: ank:AnaeK_0219 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63589"
FT                   /db_xref="GOA:B8J8Z1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Z1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL63589.1"
FT                   /translation="MDSPAQSARAGAGTVLNAAVVVAALGYFVDIYDLILFNIVRIPSL
FT                   TAIGVSGDALVSEGLSVLNWQMVGMLLGGIVFGIVGDKLGRLHILFGSITLYSIATIAN
FT                   GFVHDLATYKALRFVAGLGLAGELGAGVTLVAEILPARLRGYGTMLVASVGVSGAIVGN
FT                   VVAKTLDWRVAYWVGGGLGLLLLVLRIKVSESGMFQALRHTAVRRGDFLAVFRGAERFR
FT                   RYLSSILIGVPIWCSNAILVALAPEFGRTLGVTGPVTAGDAVMFFYGGLVLGDLSSGFL
FT                   SQVWRSRRKVVLLFVALLAAANVFYFVAGRGASPALFLGACGLLGIAGGYWAIFVTVAA
FT                   EQFGTNLRATVATTVPNFVRGLVPVCTLSFQWARPHLGLVGAAAAVSALWFGLALVSAF
FT                   GLRETFGVELDYVEAD"
FT   gene            246660..247178
FT                   /locus_tag="A2cp1_0231"
FT   CDS_pept        246660..247178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63590"
FT                   /db_xref="GOA:B8J8Z2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Z2"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0220"
FT                   /protein_id="ACL63590.1"
FT                   /translation="MSAYVVDVEADGPIPGKYSMVSFGAVRVEPGLSRTFRGEVRPISD
FT                   LWLPEALAISAVTREQHLRFGEPGEVMAAFERWIQETTKGKPVLFSDNLSFDWQWMNWY
FT                   FHTYLGRNPFGWSGRRIGDLYCGMVKDGHAQWKHLRPTAHDHDPVNDAKANAGVLLQLV
FT                   HMGLKLNLK"
FT   gene            247186..247794
FT                   /locus_tag="A2cp1_0232"
FT   CDS_pept        247186..247794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0232"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   ank:AnaeK_0221 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63591"
FT                   /db_xref="GOA:B8J8Z3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Z3"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACL63591.1"
FT                   /translation="MTPFAQGALLGLSAAAQPGPYQAYLLAQSLRNGAVRTLPVVLVPL
FT                   TSDPPVIAAVLVALAQVPAGLLRALQLAGGAVVLWLAFSALRGLCAPLAAPEARAPPRG
FT                   FWRAVLLNFTNPNAWIFWSAVGGPVLAAAWRDGPADAGGFLAGFYAFLVGGNAALVATA
FT                   GGLGRLGPRTQRALTAISGLALLAFGLWQLAKGLSGPRA"
FT   sig_peptide     247186..247257
FT                   /locus_tag="A2cp1_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.699 at
FT                   residue 24"
FT   gene            complement(247801..248670)
FT                   /locus_tag="A2cp1_0233"
FT   CDS_pept        complement(247801..248670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0233"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: ank:AnaeK_0222
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63592"
FT                   /db_xref="GOA:B8J8Z4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Z4"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACL63592.1"
FT                   /translation="MHRPSRTPLLALLSILALAGCTGKQRIATETSIASVLIPTEQEKQ
FT                   LGLQVKEQLETKEHVQYLEDPAVNAYVQGVTGKILASAKKERPDVDWSVKVINDPKTVN
FT                   AFATPGGFLYVYSGLLLAADDTAEVAGVLGHEAGHVVARHSARQMVNAMGLETVMGIAL
FT                   GKNPNGAAQLAAGLAGKGTLLAYGRADESEADEYGARYAAAAGYDPHGIATFFQKLEKG
FT                   EGKQPGWTTYLSTHPATPDRIEKVDRYIAEHHLTGLGGRSGAELAKVKERLKAIPPPPA
FT                   PPAQGAGK"
FT   sig_peptide     complement(248584..248670)
FT                   /locus_tag="A2cp1_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.490 at
FT                   residue 29"
FT   gene            248863..249642
FT                   /locus_tag="A2cp1_0234"
FT   CDS_pept        248863..249642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63593"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Z5"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0223"
FT                   /protein_id="ACL63593.1"
FT                   /translation="MSRTRVAVLSTAFAVVAAGVFGLGFLRGAAEASAAPAPPPLSSEY
FT                   PGGAPIDAARIQTGRLTFERMPAEVSGALELHSAEIVKQAEVLATKQARITGTCAPGSA
FT                   IRVVGQDGTVVCQRFPRGVVSVSSLAGLPRVSTTATTQLSVPGGVGRYQSAGEDDFLVV
FT                   PVDLPDGAVVTGFSFVFWDSDARIDGAAYLYRSDDTAMAALVTKEAADEVRVVSTQDVA
FT                   AQKVDNAAFAYFVYMQLSAAAGPRLVPIAASVAYKLP"
FT   sig_peptide     248863..248961
FT                   /locus_tag="A2cp1_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.541 at
FT                   residue 33"
FT   gene            249708..250859
FT                   /locus_tag="A2cp1_0235"
FT   CDS_pept        249708..250859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0235"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: ank:AnaeK_0224 glutamate 5-kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63594"
FT                   /db_xref="GOA:B8J8Z6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Z6"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ACL63594.1"
FT                   /translation="MPLPMSRSALRRVKRLVVKVGTGTLTDRAGRFDRDNCARLASELA
FT                   EVARGRKVVLVSSGAVALGAERLGLARSRGKPWDIPTKQACAAAGQPHLMAAWGEALGR
FT                   HGLVTAQVLLTADDLASRKRFLNARRTFERLLDAGAVPVVNENDTVAVDEIKVGDNDTL
FT                   AALVAGCVEADAVAMLTDVDGLYDRNPAEPGARLLRDVPRVTAEIERSAGGAGSERSVG
FT                   GMITKVKAARRLGAQGVVTALLSGRRARALPALLAGEPVGTVFAPGAHRLSSRQGWLAA
FT                   AARGKGVILVDAGARRALVEQGRSLLPSGVRGVQGQFGVGDPVDVAVDPARPFARGLAG
FT                   YGADEVRRIAGLKTGEIERALGYKYLDEIVHRNDLVVLETGRE"
FT   gene            250862..252145
FT                   /locus_tag="A2cp1_0236"
FT   CDS_pept        250862..252145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0236"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="KEGG: ank:AnaeK_0225 gamma-glutamyl phosphate
FT                   reductase; TIGRFAM: gamma-glutamyl phosphate reductase;
FT                   PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63595"
FT                   /db_xref="GOA:B8J8Z7"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J8Z7"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ACL63595.1"
FT                   /translation="MRKEKSLGLAAEMRKLAEASREAARALSHADPRRKDAALRAAAEA
FT                   IGRREKRILSENARDVAAARAAGQNAAYLDRLRLDPKRLAGIGAALHEIAGLRDPVGEV
FT                   TASWRRPNGLEIRKVRIPLGVVLMVYEARPNVTVDAAALCLKSGNAAILRPGSDALRSS
FT                   LALAAAFAEGLEKAGLPAASAQVVPTPDREATYELLALDDLIDLAIPRGGPSLIRAVAA
FT                   RSRVPVLKHYQGVCHLYLDASAPPQQAVDLALNGKVQRPGVCNATECLLVHRGAAGKLL
FT                   PPVGRALADAGVELRCDPTALTILKRAGVAAVPARPDDFGKEFLDKILAVRVVADLDGA
FT                   LDHIARYGSLHTEAIVTRDLASARRFQREVDASAVMVNASTRFNDGGELGLGAEIGIST
FT                   TKLHAFGPMGLAELTTQKFLVEGEGHVR"
FT   gene            252159..252755
FT                   /locus_tag="A2cp1_0237"
FT   CDS_pept        252159..252755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0237"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: ank:AnaeK_0226 iojap-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63596"
FT                   /db_xref="GOA:B8J8Z8"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Z8"
FT                   /inference="protein motif:TFAM:TIGR00090"
FT                   /protein_id="ACL63596.1"
FT                   /translation="MATKKKAAGKKPFAKKTPSKRAPARRGPPMKAPGKKKGGPAKAPG
FT                   KKGAPKERVLRARRPPRAAAPPAAIEAAPAPARPAADRPDPARPTAMAIAAAALDKKAE
FT                   DVTVLDVRGLTSYADYFVLMTADSDRQASAIADHVEQTMKAQGVTKVGVEGYQGGRWIL
FT                   VDYGDVVAHVMGREARGFYDLEGLWADAPRVAVEA"
FT   gene            complement(252752..253519)
FT                   /locus_tag="A2cp1_0238"
FT   CDS_pept        complement(252752..253519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0238"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: ank:AnaeK_0227 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63597"
FT                   /db_xref="GOA:B8J8Z9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8J8Z9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL63597.1"
FT                   /translation="MLRQAFSFCAELIGGRPPEPGDGFRDELAFWDRELSGRGEYAEDI
FT                   RRRSTPALMTLVYPHYLEPLLEERRARTGAPPRVLDAGSGPLSMWADGAEQGRIALTCS
FT                   DALADGYRELLARHGLHTRYPLVQCGGEALSRRFGEAAFDLAWMHNALDHTQDPGAVMR
FT                   ELVRVLAPGGYLVVQGWCREGSAERFIGLHRHDLWVEPPGRLMLRTRSPGRRRLSAPVA
FT                   LCDGLGLELLEASPPSRTPRTWMKLVWRKPAAA"
FT   gene            complement(253629..254519)
FT                   /locus_tag="A2cp1_0239"
FT   CDS_pept        complement(253629..254519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0239"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ank:AnaeK_0228 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63598"
FT                   /db_xref="GOA:B8J900"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8J900"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL63598.1"
FT                   /translation="MRPAVRTRIVATYLAVAALWGSTWMAIRIGLEDLPPLRFAGVRMA
FT                   IAALVLAPFALRGGAWREVVGPARAQLALVAVLQIALPYGLMFVAQQWVPSGLAAVLFA
FT                   SFPVWIALLARALVPGESLTPARVASALLGIAGVAVLQLPHLGDLEGSSRLLLGGALVV
FT                   LSSMIVALANVLVRRHLAAVSPLAMTAGQTAFGAALLLTAAALLEHGRPAAFTPSAIAA
FT                   LAWLAVFGTALTYVGLYWLVPRVPMAAIGALPLLDTTVAVTLGALVLHEPVGWNLALGG
FT                   GMVLAAAALTIPRRR"
FT   gene            complement(254582..255643)
FT                   /locus_tag="A2cp1_0240"
FT   CDS_pept        complement(254582..255643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0240"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; Serine/threonine
FT                   protein kinase-related; SMART: serine/threonine protein
FT                   kinase; KEGG: ank:AnaeK_0229 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63599"
FT                   /db_xref="GOA:B8J901"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B8J901"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACL63599.1"
FT                   /translation="MVRKVGTSRIVREIGRGGMGVVYEAFQEGLERPVAVKALDQKLVR
FT                   SSEVVERFRREGRAYAQLRHEAIVAVHDLVEKDDQLYLVTDLVDGADLARVLAQGGALP
FT                   ADCVAVIGARLAEALDYVHWSGLLHRDVKPANVMISRLGEVKLMDFGIAKGAEDPSLTR
FT                   VGMLVGSPSYMAPEVLAGDEGGPAADVWALGVTLYELVCGEKPFRGANADELFRLVRRG
FT                   RFRRVRSLAPGCPARVAAAIERCLARTPERRWKSAGALARHLDAFAAKKLARLHPRARL
FT                   VALLANRGFATEEVALSRMDVATLNATRLADEKGTATVAEFPVRRRRRATALQAALALA
FT                   AAAAVWLAPLTLP"
FT   gene            255912..259514
FT                   /locus_tag="A2cp1_0241"
FT   CDS_pept        255912..259514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0241"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; thiamine pyrophosphate protein domain protein
FT                   TPP-binding; 4Fe-4S ferredoxin, iron-sulphur binding,
FT                   conserved site; KEGG: ank:AnaeK_0230 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63600"
FT                   /db_xref="GOA:B8J902"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:B8J902"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACL63600.1"
FT                   /translation="MASRRMVTMDGNEAVASVAHRVSEVIAIYPITPSSNMGEWADEWS
FT                   AKGRKNVWGTVPSVAEMQSEGGAAGAVHGALQAGSLTTTFTASQGLLLMIPNMYKIAGE
FT                   LTAFCMHVSARAVATHALSIFGDHSDVMAVRQTGFGLLSSASVQEAHDMAAIAHRATLL
FT                   SRVPFLHFFDGFRTSHEVAKIEELTDDDLRAMIPEELVAAHRARALTPDRPTLRGSAQN
FT                   PDAFFQAREACNPYYLDAAGHVQAAMDHFGKLTGRKYKLFEYFGHPEAERVVVAMGSAC
FT                   DTAQETVEHLIARGEKVGLLKVRLYRPFDLGAFMTALPRTVQALAVLDRTKEPGALGEP
FT                   LYQDVVTALREAEQAHIDRFHHQITVIGGRYGLSSKEFTPGQVKAALDELLNARPKRHF
FT                   TVGINDDVTHLSLRADPTFDTEGKDVVRALFFGLGADGTVGANKNSIKIIGEDTPNFAQ
FT                   GYFVYDSKKSGSVTISHLRFGPRPIHSAYLIEKANFVACHQFGFLEKYEMAEMTVPGAT
FT                   LLLNSPYGPDEVWGHLPREVQEQILTKGLKLYVIDAYKVARDTGMGVRINTIMQTCFFA
FT                   ISGVLPRDEAIGHIKKTIEKTYARKGAEVVQKNFAAVDHTLAHLYQVKVEGRAATGAPR
FT                   PPTVSEAAPDFVKRVTALMLAGKGDQLPVSAFPVDGTWPTGTSKWEKRSIALEIPVWEP
FT                   SLCIQCNKCALICPHAAIRPKFYGAEALGSAPKGFLAMDYKSADVKGAKYSLQVAPDDC
FT                   TGCTLCVEICPAESKTEKGKKAINMAEAMPLKEKERANFEFFLSIPDADRKKVKLDVKG
FT                   TQFLEPLFEFSGACTGCGETPYLKLLTQLYGDRAVIANATGCSSIFGGNLPTTPYTQNC
FT                   EGRGPAWANSLFEDNAEFGFGMRLSIDKQAEQARELLAVLGPKLGDALVDELLKADQSD
FT                   ETGIEKQRARVAELKAKLQMMDGLEARWLLRIADYLVRKSVWIVGGDGWAYDIGYGGLD
FT                   HVIAQGRDVNILVLDTEVYSNTGGQASKATPMGAAAKFAVAGKNLPKKDLAMLAMSYGH
FT                   PYVARVAMGAKDAQTIAAFKEADSYPGTSVIVAYAHCIAHGYEMSEALGQQEKAVDSGY
FT                   WPLFRYDPRRVAAGDSPLKLDSAAPKIDLARFTEGETRFRQVEQANPAGFARMLEQAQK
FT                   DVREKYALYEQLAKAMNPANLVPGAAGGNGKPRA"
FT   gene            complement(259892..260788)
FT                   /locus_tag="A2cp1_0242"
FT   CDS_pept        complement(259892..260788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0242"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   ank:AnaeK_0231 protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63601"
FT                   /db_xref="GOA:B8J903"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B8J903"
FT                   /inference="protein motif:PFAM:PF07605"
FT                   /protein_id="ACL63601.1"
FT                   /translation="MTAPRQVLPGVTYLVTRRCFQRMFLLRPSPATNAIFLYVLAVAAR
FT                   RYGILVHAFCVMSNHFHLVVTDVNARLPEFEQYLNALVARAVNASLGRWESFWAPGSYS
FT                   AVALSSPQDVLEKVAYVLTNPVKAGLVASAKEWPGLWSAPESIGAGALRVTRPDGFFRR
FT                   SGPMPEVVELALVPPPGFEPADAFRSLLVDAIAAREREVAHAHALAGIGFVGARRVLAQ
FT                   RPTARPPEPPPMRGLRPRVAARDRWKRIEAIGRLVGFLRAYREAWRARRAGRSGVIFPA
FT                   GTYLLRVLHGVPCASFG"
FT   gene            260936..261910
FT                   /locus_tag="A2cp1_0243"
FT   CDS_pept        260936..261910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0243"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: ank:AnaeK_0232
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63602"
FT                   /db_xref="GOA:B8J904"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8J904"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL63602.1"
FT                   /translation="MPPTLVTGAAGFIGFHLAKALLDRGDVVLGVDSMVPYYDVRLKEA
FT                   RLAQLTGRPGFTFERLDLADREATSRLFERGGFGAVVHLAAQPGVRYSLENPHAYVDAN
FT                   VTGFLDVLEGCRRHPVRHLVYASSSSVYGGNTKVPFAVTDNVDHPVSLYAATKKANELM
FT                   AYTYSHLFAIPATGLRFFTVYGPWGRPDMAPMLFARAILEGQPIKVFNHGQMRRDFTYV
FT                   DDIVEGVIRVLDRPPAAGVVPPHRLYNIGNSQPVELLRFIDVMEAALGKKAVRELLPMQ
FT                   PGDVPATFADVSDLERDVGFRPATSIEEGVRRFVAWYRAYHRA"
FT   gene            262092..262961
FT                   /locus_tag="A2cp1_0244"
FT   CDS_pept        262092..262961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0244"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   ank:AnaeK_0233 glycosyl transferase, WecB/TagA/CpsF family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63603"
FT                   /db_xref="GOA:B8J905"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:B8J905"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ACL63603.1"
FT                   /translation="MKVARLEWPDLLEWFLRRLDAPAPVRCGTLVLANAHTLNVASANP
FT                   AAREAIRAATLVLNDGVGLDVYARLRTGAPFPYNFAGTDLVPRLLGECARRGLPLRVFL
FT                   YGARPGRAAEAARRIERAYAPVKVIGALDGHETTGDEARRAIDAAHPDLLLVGLGNPRQ
FT                   EEWLAANAPGLRARIAIGVGALFDFMSGSVVRAPRAVRAMRLEWMFRLALEPRRLFRRY
FT                   VVGVPLFLWRTLTYRPEPVPSHPTQSPLGAGKPRIGPRNDSGFGAVLARTGTDAKDSGS
FT                   GVRMGSAG"
FT   gene            263061..263960
FT                   /locus_tag="A2cp1_0245"
FT   CDS_pept        263061..263960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63604"
FT                   /db_xref="UniProtKB/TrEMBL:B8J906"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0234"
FT                   /protein_id="ACL63604.1"
FT                   /translation="MLLVALWSASAAVAAEPLLVPGRMGYNALPALRNVDPVVGNRTEL
FT                   ELSATAQLAGLGAQDAAGTPYVRLTVPFREVAALELDGTPFELFRTSAATGERIGARVR
FT                   SGASPGDLRAGARFLVLEERGKRPALGLRLVVKSTSGKDRGARRFTNAPGYVFDVLAGK
FT                   DLAAAGPVRLRALAKLGFLAWQVADGRQDDALDYGATLRAAFASGVALSGEWRGYAGWR
FT                   GDDRPMVLGLTADVPAGSRVLLRASADRGLTSDAPPLDVRLGVVLFLDAPMARDRAAGQ
FT                   ADPRLASGARPRRQPGPR"
FT   sig_peptide     263061..263105
FT                   /locus_tag="A2cp1_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.789) with cleavage site probability 0.436 at
FT                   residue 15"
FT   gene            complement(263961..265130)
FT                   /locus_tag="A2cp1_0246"
FT   CDS_pept        complement(263961..265130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0246"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   ank:AnaeK_0235 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63605"
FT                   /db_xref="GOA:B8J907"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B8J907"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACL63605.1"
FT                   /translation="MSRTRLAVLALALSPLVLVACSNGDGSSAAASDAVRAPPAAGSPS
FT                   AHGAGMDPHSMAGGKKILGVTTRNLYLGADLGPVMAAATPAAFVAATTAVWVTVQANDF
FT                   HVRAEAIADELAATRPGLVGLQEAYLWRVQDPGDFLAGGTTPATTVAYDYVQDLLDALA
FT                   ARDLHYVVAAEVTLFDFEAPVATGQDVRMTDRGVILARSDLATALPTGGVYATLLPVTV
FT                   LGNPVQVKRGWVSVDARYRGEWLRFVSTHLEAYHAGVRTAQAAELAGALAAETRPVVLV
FT                   GDLNSQPGTEGEAVLAAAGFSDVWAAVNGDAPGLTCCFPEDLRIGPGDPGFADLSTRID
FT                   YVLVRGPVEPWSAEVVGETADERVGGLWPSDHAGVAAEVRVTDGRHAGE"
FT   sig_peptide     complement(265068..265130)
FT                   /locus_tag="A2cp1_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.590 at
FT                   residue 21"
FT   gene            265374..266516
FT                   /locus_tag="A2cp1_0247"
FT   CDS_pept        265374..266516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0247"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ank:AnaeK_0236 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63606"
FT                   /db_xref="GOA:B8J908"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B8J908"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACL63606.1"
FT                   /translation="MPRATGPRHGCRLLGLALAAAVGLAGCKRDGGRAAEAAQEQPPVA
FT                   LAPENVAVVSSRRLQSGPEVAGTLHARRTATLRAEVGGAVAEVRVDAGERVKSGQLLAR
FT                   IDASALQDAVRAAHSAVTSAQNALRVAESGARRAHTLAREGAMAEQDAERADAQLEAAR
FT                   AQVEDAKARLAAAEQQAGKTAVRAPFAGVVSERSVSSGDVVASGAALYTVIDPSRLQFE
FT                   GSVPAASVGALVPGAPVDFSVTGFGGRRFDGHIERVNPAVDPSTGQVRVYVDVPNADGR
FT                   LLAGLYAQGRVASQASEALSAPATAVDATSTPPTVMKVQDGKVQKVAVEIALRDDVAGA
FT                   VGFRSGVKQGDVLVLGSARGALADGTPVRVVEDPRAQKSN"
FT   gene            266535..269699
FT                   /locus_tag="A2cp1_0248"
FT   CDS_pept        266535..269699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0248"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   ank:AnaeK_0237 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63607"
FT                   /db_xref="GOA:B8J909"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B8J909"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACL63607.1"
FT                   /translation="MFISDFAIKRPIVTITVMLALVIFGLLALVTLKTDEFPDVQPPVV
FT                   AVTIVYPGASPETVEREVIDPIEDAIFSISGIDGKQTTASATDGLAQFIVFFDFEKNLM
FT                   EATQDIRDAISSKRQDLPTEMEEPVLVRFDPSQEPIVTLTLTSKTLPVPALTRLADEVV
FT                   SRDLRSVQGVADVRLVGGQKRELTVQLDPEAMAAASVSAAEVVGALQAQNLAAPVGRVN
FT                   TPLGEQSIRLSGRLGTPEEFEQVAVASRGGQVVRLGQVATVLDGAEEARTLALFNSGEA
FT                   VGLEVLKTKGYSTTAVADAVKQRARALEPRMEGAKLAIVQDSGTRVRQSVDDVQRTLVE
FT                   GALLTVLVVFLFLNSWRSTVITGLALPVSVLAAFVSVWAFGFTLNTMSLLGLSLAIGIL
FT                   IDDAIVVRENIVRHIELGEDHTTASHKGTDEIGLAVTATTFSIVAVFVPVAFMYGVAGQ
FT                   WFKPFALTIAAAVLVSLFVSFSLDPMMSAYWPDPQVEKGERRGPVGRALGAFNRWFDRQ
FT                   ASSYRRVVAWALDHRWLVVAFATLSLVGSFALQGAFGGAGFVPVSDRSEVSLIVQTPPG
FT                   SSIEYTRRKVEETDRILRSHPEVAYTYASIGTPIPLQAPGVDQALIYARLTPKRERDLS
FT                   QDALGAVLRRELSRVAGAEISVFTSGFGGAFKSIQLELRGPDSRVLTELAEKVKAVAAG
FT                   VPGAVDVGLSTRGQKPELAVEVDRGLAGRLGVTVGQVAQSLRIAFAGLDSGDWVDPTGE
FT                   TRKVMVRLAPEARERASDLRQLPLILPSREGAPRILPVGQVARITEGLGPAQISHLDRQ
FT                   RVVSVQGNVAGRSLSEVVNEIERRLAGEVKLPPGYTLRQGGESADQAEVFTRIGVALLL
FT                   AVMLMYLVLVLQFGSFLDPFAILLSLPLSLIGVVLALLVTGDTINLMSLIGVILLFGIV
FT                   AKNAILLIDFAKWAREERGLSIRDALVEAGGIRLRPIMMTSVAVIAGMIPVASGLGEGG
FT                   DFRAPLGRAVIGGVITSTLLTLLVIPTVYEIMDGWRTRLGRLFRRAFARGGERHAREAA
FT                   QRREEP"
FT   sig_peptide     266535..266621
FT                   /locus_tag="A2cp1_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.750) with cleavage site probability 0.461 at
FT                   residue 29"
FT   gene            complement(269724..270239)
FT                   /locus_tag="A2cp1_0249"
FT   CDS_pept        complement(269724..270239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0249"
FT                   /product="Domain of unknown function DUF1791"
FT                   /note="PFAM: Domain of unknown function DUF1791; KEGG:
FT                   ank:AnaeK_0238 domain of unknown function DUF1791"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63608"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B8J910"
FT                   /inference="protein motif:PFAM:PF08754"
FT                   /protein_id="ACL63608.1"
FT                   /translation="MTPHRPLPLLALGALLALTAGTPLTARASATPGNADALRGVTSGK
FT                   GLFLVDLADGPKIAMYLKLIAGSYDGLRAQGVAPDFKVVFIGPTVRFLTGEAPAPSRAA
FT                   DRAAAVEIAAAVRELKRRGAALEVCTIATKVFQVEDARLLPELTVVADGFVSLIGYQAQ
FT                   GYHLVPIY"
FT   sig_peptide     complement(270153..270239)
FT                   /locus_tag="A2cp1_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.950 at
FT                   residue 29"
FT   gene            270432..271037
FT                   /locus_tag="A2cp1_0250"
FT   CDS_pept        270432..271037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0250"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ank:AnaeK_0239
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63609"
FT                   /db_xref="GOA:B8J911"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8J911"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL63609.1"
FT                   /translation="MSPREKLVETAAALFYRHGCHAVGIDTVLAEAGVAKMTLYRHFRS
FT                   KDELVLAALRRMDERFRNAFMAAVERASDTPAGRLDALFDVVREWVRGKDFYGCPFINV
FT                   TAEFAAHDDPVHVAAAEHKRLALEYIERLAAEAGAADARGLARALKVLLEGCTVLAQVT
FT                   GQPGFVDDAQQAARLVLQEGLRGAVPARAPRRPRRART"
FT   gene            complement(271306..272730)
FT                   /locus_tag="A2cp1_0251"
FT   CDS_pept        complement(271306..272730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0251"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="KEGG: ank:AnaeK_0240 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63610"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8J912"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0240"
FT                   /protein_id="ACL63610.1"
FT                   /translation="MRTPDAVVVGSGPNGLAAAVALGGAGLRVLVREAAATAGGGARTL
FT                   PLTLPGFLHDHCSAVHPLAVASPFLRTLPLAAHGLRWISPPAAVAHPLDDGTAALLGPG
FT                   FEATDATLGEDARAWRALFAPLARELPALLEEVLGPVLHRPRRPLLLARFGLPALLPAA
FT                   RLARARFRGPRARALFAGLAAHANRPLEAAASAAFALVLGAAGHAVGWPFPEGGAGAIA
FT                   AALAAELRARGGELATSAEVHRLEDLPPARAVMLDLTPRQVLRVAGARLPARYARRLAA
FT                   FRYGPGAFKLDWALAGPIPWRAAACAVAGTVHLGGTLEEIAAAEAAVERGEVPARPFVL
FT                   LAQPTRFDPSRAPPGGHVAWAYCHVPRGFDGDLTDAVEAQVERFAPGFRELVLARAVRG
FT                   PPALEQEDANLVGGDVGGGEASLAQLVARPVLSPDPWSTPVPGLYLCSASTPPGGGVHG
FT                   MCGWQAARAALRDLGL"
FT   gene            272900..273508
FT                   /locus_tag="A2cp1_0252"
FT   CDS_pept        272900..273508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0252"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   ank:AnaeK_0241 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63611"
FT                   /db_xref="GOA:B8J913"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B8J913"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACL63611.1"
FT                   /translation="MPDESDERLMLRFRDGDARAFEALVRRHRTPIFSFLLRLTRDRGR
FT                   AEDLCQDTFLRVVKASGAWEPRARFRTWLYAMARNLAVDESRRMAFRRASSLEADPAAS
FT                   ALAADDPAPDRAADAALVRPLLEAALASLPEEQREVFLLREHAGLRFPEIAEVTGAPEP
FT                   TVKSRMRYALEALRERLAAMGVEPEVAAGGPASTRSAAP"
FT   gene            273505..274824
FT                   /locus_tag="A2cp1_0253"
FT   CDS_pept        273505..274824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0253"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="KEGG: ank:AnaeK_0242 Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63612"
FT                   /db_xref="GOA:B8J914"
FT                   /db_xref="UniProtKB/TrEMBL:B8J914"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0242"
FT                   /protein_id="ACL63612.1"
FT                   /translation="MSDERFHERLGARLHDAILEHAYGELPAGEGRALERHLEACEACR
FT                   AELGRIRGTRARMSGLEEAPAPERGEAVLLAAAREAADARRRRRRLPAWTWGAALSAVA
FT                   LVAVGAVSYRLLALHPGPALRDDPEALLGRAAAPAPQAGTEAATPAAPEAPAAAAAPVA
FT                   GPDDVRAERARPAAPPAPERRREPPRPLGAAKAAPAAAPAAARAGEPEADAPVAPRTFR
FT                   APAPAPAPATAERTVAPPAPAPTAERTVAPPTPEPTPATRATPAPAPRALRAEATEAAP
FT                   PAAGSAPAATLEAVPAPEHAAGARRAATAARGQAPDAAAAPAGSSALARWRALQQAGAL
FT                   RGEVVTFTDCDGEAWRKVERDAQGRVVRYVRHGRLAGRAFEADLYYGEDGALALARYRE
FT                   EGGPWREARPPGTDGAIPEAALRPARAADARADAPPRCGP"
FT   gene            275048..276151
FT                   /locus_tag="A2cp1_0254"
FT   CDS_pept        275048..276151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0254"
FT                   /product="teichoic acid biosynthesis related protein"
FT                   /note="KEGG: ank:AnaeK_0243 teichoic acid biosynthesis
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63613"
FT                   /db_xref="UniProtKB/TrEMBL:B8J915"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0243"
FT                   /protein_id="ACL63613.1"
FT                   /translation="MARILYGVAGEGMGHAVRSRVIIDHLARTHDVQVVVSGRAHDYLK
FT                   ARERDRLGVNRIWGLSIVYEDNEVRSFRTVLKNVGGAVAGGWPRNVKAYFDLTESFRPE
FT                   VVVSDFETWSYLYARTHGLPCISVDNNQAVNRCDHPPEILSGHEAEYLVAKGVVKAKLP
FT                   GCFHYLIATFFQAPVAKPRTSLHPPVLRPEILAARAEPGAHLLVYQTSTSNEALPEILR
FT                   GAGVECRVYGLRRELTQDLREGNLVHRPFSEARFVEDLRTARAVISGGSFTLMTEAVYL
FT                   HKPMLAIPVKRQFEQVLNARYLQALGYGATADDLDARVLDGFLARLPELERGLSRYRQD
FT                   GNRELLAKLDDVLARALDGGAPGEPRA"
FT   gene            276148..276609
FT                   /locus_tag="A2cp1_0255"
FT   CDS_pept        276148..276609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0255"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   ank:AnaeK_0244 protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63614"
FT                   /db_xref="GOA:B8J916"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J916"
FT                   /inference="protein motif:PFAM:PF02590"
FT                   /protein_id="ACL63614.1"
FT                   /translation="MKVRVVAVGRDRSGLYAPAVDEYAKRLGRYLRFELVEVPEARKLA
FT                   GTAGAKGEEGATLLAKVGPRERVVVLDERGDELTSVAFAERVRRWMERGQDVALLIGGS
FT                   DGLAPEVLARADERLAVSRFTLAHRLARLVLVEQLYRAMTILRGEPYHK"
FT   gene            276722..279328
FT                   /locus_tag="A2cp1_0256"
FT   CDS_pept        276722..279328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0256"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: ank:AnaeK_0245 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63615"
FT                   /db_xref="GOA:B8J917"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017309"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034176"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B8J917"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACL63615.1"
FT                   /translation="MTRLRTPAALALSLAALACGGGGSDSPPLPTAFTLSGHIAATAGQ
FT                   DVDRDVADTSTTRTPNDSAAQAQPLASVTTLGGWASAAAGAYDTGLPYPADPQDWYRAT
FT                   LEAGQTVVLEVADTAATFELCLFSADGTTSISCASSGTGTPVLTVPAAATYLVRVRAAS
FT                   GLSNYALTLGVNGAAAVAGAAPHLALPFVPGELVVRFRDDTLGVAAAGDLRQRAAALGL
FT                   TALAGARGRAALLSMSGPEARARALAALGVEPLAPDALGAGADPVLAEKWDTLRAIAAL
FT                   RRRADVESADPNFVFQPARVPTDTYYKYQWHYPLISLPQAWDVTTGVAGAVVAVVDTGV
FT                   FLAHPDLSGQLVTGYDFIRDPTMANDGNGIDPNPDDPGDAATPGGSSWHGTHVAGTVAA
FT                   RADGSGVVGVAWDARVMPLRALGVGGGTSYDIVQAVSYAAGLANDSGTVPATRAAVVNL
FT                   SLGCQGCFSSTEQAVYNAARNAGVIVVAAAGNEASSAPGYPAAYAGVLSVSAVDMKGAK
FT                   APYSNTGSTVDLAAPGGNTAVDLDGNGYADGVLSTLVKDTTGTREPIYAFYQGTSMAAP
FT                   HVAGVMALVKSVCPSLAPAAVDQLLQEGQLTRDLGTPGRDDTFGWGLVDALKAVQAAAT
FT                   SCGAPLPPSLSVTPGRLDFGPADATLQLQAAKVGEGALTVTAVSDDAAWLTVTAPGVDA
FT                   SGLGAYAAAVDRTGLADGRYAAKITFTPSVGDPVVIPVTLQVGAAAAAGDAGYLYALLV
FT                   REGVSGPELVKQWSGAASGGSYAFRFDGVSAGTYYLVAGSDMNNDGYICDAGESCGAWP
FT                   TLGVLTPLGASGPRSDLDFSVAFDPAVAPVGAAAGAPVGARGLARQPATKGVAGLR"
FT   sig_peptide     276722..276796
FT                   /locus_tag="A2cp1_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.433 at
FT                   residue 25"
FT   gene            279452..281002
FT                   /locus_tag="A2cp1_0257"
FT   CDS_pept        279452..281002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0257"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="KEGG: ank:AnaeK_0246 phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63616"
FT                   /db_xref="GOA:B8J918"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:B8J918"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ACL63616.1"
FT                   /translation="MPKTKPVLLVVLDGWGIRAAREANAIAIAGTPNMDALQREFPHAA
FT                   LETSGLSVGLPEGQMGNSEVGHTNLGAGRIVYQDLVRINRAVEDGSFYKNDALLLACRR
FT                   AREAGGALHLLGLVSDGGVHSHVEHLHACLELARREGVARAYVHAFMDGRDTPPKSGLD
FT                   YLAAVERRLAATGYGKVATVTGRYWAMDRDKRWDRVAQAYAALVSGEGFKAASGTAAME
FT                   AAYARGETDEFVKPTVVVNGDGKPVGAIRDGDAILFFNFRADRAREITRAFTQDGFHDF
FT                   ERKAVPRLSAYVCMTQYDETFTLPVAYAPQDLTEIFPEIVARAGLRQLRTAETEKYAHV
FT                   TFFFNGGRETVFQNEDRILVPSPRDVKTYDEKPEMSAREVTDKLVQALGTGQYGFTLVN
FT                   YANPDMVGHTGLLDAAVKAVRVVDECVGRLWQAARKQGMAMLVTADHGNCEMMTDPVTG
FT                   QPHTAHTLNPVPFILADPDLRGAKLREKGVLADVAPTALQVMGLPQPKEMKGLGLVIR"
FT   gene            281076..281762
FT                   /locus_tag="A2cp1_0258"
FT   CDS_pept        281076..281762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0258"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   ank:AnaeK_0247 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63617"
FT                   /db_xref="GOA:B8J919"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8J919"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ACL63617.1"
FT                   /translation="MLRAAVRALLDLVYPPRCAACGEPVAEEPFCEVCAGALEPVPPGC
FT                   DRCGAPGPGPACGACLAAPPAFDVVRAGGLFGGPLADAVHALKYGGRPDLARPLGAWLA
FT                   ARVPLPPGAAVVSVPLGRARRIARGYDQAALLADALARAAGARGRRLRGVLRRARETAP
FT                   QVGLGRAERARNVEGAFLAGPAVAGRDLVLVDDVVTTGATADAAARALRAAGARSVTVV
FT                   ALARAE"
FT   gene            281813..285583
FT                   /locus_tag="A2cp1_0259"
FT   CDS_pept        281813..285583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0259"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   transglutaminase domain protein; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ank:AnaeK_0248
FT                   tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63618"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8J920"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACL63618.1"
FT                   /translation="MLARLAALLALCLAWTGSVRALSPLPPPTGLDPEAERAAAAVAAL
FT                   DRERRGPRGLAALAELDALADDLPELAHLAAAYARAADDREAHPEVRALARFRLAEVER
FT                   ARGNLQKEAASLQRLGFVARWRVLGPFDDEGKRGLAEAFPPEKAVDLAARYPGKVREVA
FT                   WRALPDDAVVDGFVHLGAALRPAREVVAYALAEVEAPREVEARLWLGASGAARVWVNGA
FT                   VVLTDADYHPARLDQRAVGVTLRRGANRILVKLCHQDGRMGFYLRLADARGEGLELAAA
FT                   DPRGAALHEVPAPGPTAPVPPAVAALEQRAKAARGARAEAEARLELARVLAARQGGDVQ
FT                   ERRAAAEARRAALLAPGWVEAQLEAAALEEDHGRRRQRIEAALAAAPEDSRALRALGQE
FT                   ELDQGRPQAAARLLERAVRAAPGWAAPRVELAEALSRAGLEARGALLAEATASAFATVP
FT                   SAVRAAARSARRLGRTEEASARSRTLVALRFDDAQTRAALAQILADRGDVAGARALLEE
FT                   ALRLDPSDAYQRLRLGDLLAASGRGEEAERAYAAALALAPDEPDAWERRGRARLSQGRV
FT                   KDAQADLQRALELRPQSPELKLLVRSLEPAREPFERPYLLDARALAAAAPAPEPDEDAL
FT                   VLGELKVTRVLPSGLSSTYTQTVVKVLTPRGADQARRQTVSWSPDRQEVRVERARILKP
FT                   DGTVIEAHDESERSASEPWYRLYYDLTARTLSFPALAPGDVLEVAWRLEDVAGENLLSD
FT                   YFGDLTFVDDTTRKARFEYVLLVPAARAIHANAPAGIAHAQRTLPGEVVEHRWSARDLP
FT                   RVVPEPGMPGWSEVSRHVHVSTYASWDQVARFYWGLVKDAVRPTPEVRAEAERIAAEVL
FT                   RARRGEGTRVARAQAAASALPPPGGWDLETQRALTRAVYDFVVSQTRYVGLEFGIHGYK
FT                   PYRVDQVLQRRFGDCKDKASLLRAMLESIGIDARLVLLRMRRLGRLPEAPASLAVFNHA
FT                   IVYVPALDLWLDGTAAYSGSGDLPGEDRGATVLVVNPDGKPRFATVPEALPEQNRGETR
FT                   FDVALAADGSAAVRGAWRVTGAEAPTYRRAYLVEEQRRAQLEQSFNRSFPGVRVASVTA
FT                   SDLTRLEDDVTMQFALEVPRFARPDGAGLRFSPFGAARGWGESWAALSSRRHDLDLGSP
FT                   AETVFTYRHTLPAGWRIAELPDGDAARTPYASFEVRYRREGAALVAEARVRLEKGRIPA
FT                   RDYPAFRDLTSRIDRAFARKVRIVPAEEAAR"
FT   sig_peptide     281813..281878
FT                   /locus_tag="A2cp1_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            285580..289296
FT                   /locus_tag="A2cp1_0260"
FT   CDS_pept        285580..289296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63619"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="UniProtKB/TrEMBL:B8J921"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0249"
FT                   /protein_id="ACL63619.1"
FT                   /translation="MSRAVRRAAPRFTGVAALAALALACAGPRAEQAEPGRATREGLAA
FT                   LEQNDVARAEARLGPASRVRDPWARFGASLLARRALDGEAEVQRLLAAVEAGPDEPIAL
FT                   VALRRLSELAERGPALAAQVDAGVLRLGAGGRLRGLAAYRVRVARVTAAEVLGDHEAAA
FT                   QARRENGAVPVWSIAGPFAAHHALDFGAPIPPDRGELPASVPGRAGGPAVPTRALPAPD
FT                   GTVALDGEPAGGDLFALATDVDLARGGRYLVTLGTQLSARLVVDGALVHERRAFGAWLP
FT                   GLVHLPVELARGRHRVVLEVTRGGPSTGIHLAFARADGAASDARFAAPAPGAPPAPAAA
FT                   RSRAEPALTPRALALALEPDVGAATARLLAARDAMVNDREAAKVLLAEALALRPEAAAL
FT                   RAARADAAVDDPSLDEQVARARAEADLREALRLDPGDAEARVELAALLRGAERHDDAEA
FT                   VLAGLAPEAAARPAGIAARARAAQARGLLERAEGLAAEALRSAGSCDAADLAYELAVRR
FT                   GAAAREDEAMAVLSRCRGGRERLAGHLRRRGDPVAERAALDPVVRARPWAVEPGLTRAD
FT                   ALVASGETRRAVAALEAIAGIWPRDARVQRRLADARELSGDAPGARAARERALALEPGD
FT                   LQLRRALALEDGTEVLADVAADPRAAIRAYEAAGRRNGASTVMVLDAAYVDVHPGGAAT
FT                   ERTQQLVHVLDQQGVEQFGEVTVPAGADVLALRTIKPDGTTLEPERAGSAKGSISLAGL
FT                   APGDYVELDYVRAAQSPPGLEGYVADPFYFQVPGSRLFRSLYVVRAPAGLGLEADAHGM
FT                   PAPVPVRDGGREVLRAERHDVPAIVPEPDAPGGAEYLPFLAVGTGGGRAALQRAIADAL
FT                   PERTRATAELRAFAREIAAGGGGPAQLARAAYARVAQAVLGSGGGMGEDASVALSRGRG
FT                   SRLAVLKAVLAELGIESRVALVRPYSADPAPYRFPALGLYAAPLLRVRAGGATFWLDPT
FT                   ARHAPFGAFPAVLAGCEALVLPEPGEAPEVDRTPESPLVEEGRETTARLVLAADGSAEA
FT                   SGTDRYLGYGGAELKAALERLDAAQRRQAVEGMLGRVLRGVTVTEVAFAGEDDPAAPLE
FT                   IRWKARVPELARAVEGGLVLDQPLFPARLGARLVGVAARRTPLLLPTPERQVQRVEVVP
FT                   PRGLAVVADAPRTASSPSGRFTQTERLDGGALVREERLDLRRGRIAPEHYAELAAFAAA
FT                   VDQAQERPLLLAR"
FT   sig_peptide     285580..285681
FT                   /locus_tag="A2cp1_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.483 at
FT                   residue 34"
FT   gene            complement(289660..290271)
FT                   /locus_tag="A2cp1_0261"
FT   CDS_pept        complement(289660..290271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63620"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:B8J922"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0250"
FT                   /protein_id="ACL63620.1"
FT                   /translation="MRRLLALLVLGLAAGAGLGLALRLGRAPALPDPPAVATRIREVAR
FT                   LEALDVTLYKKVAFSPEPAEAGSLWGDVAGWLRHVFRTPHGKAIVFADAHLGLDLARLD
FT                   ASRVRVTGRTAEIALPPVEVRIALRPGETEVIGSNLDSAETARLLELARAAFEREVQAD
FT                   AALRARARASAERAIRGLLLGLGFAEVRFVDALPAAAPSS"
FT   sig_peptide     complement(290206..290271)
FT                   /locus_tag="A2cp1_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.676 at
FT                   residue 22"
FT   gene            complement(290281..290901)
FT                   /locus_tag="A2cp1_0262"
FT   CDS_pept        complement(290281..290901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0262"
FT                   /product="TfoX domain protein"
FT                   /note="PFAM: TfoX domain protein; KEGG: ank:AnaeK_0251 TfoX
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63621"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:B8J923"
FT                   /inference="protein motif:PFAM:PF04993"
FT                   /protein_id="ACL63621.1"
FT                   /translation="MPISPSFVDHAVDLVSALGPVQARRMFGGVGLYCDGLMFGLLDGD
FT                   ELFLKTDGETRPWFLEAGCRMWIYPGMYETSYYRPPDEAHEDAEAMLPWARLALDAAVR
FT                   AQAARAAKARAPRRAGAKARGTRGAAAKAAKAAKAKARAGTGARPGRKGARPSKPRPAR
FT                   KAAPSAAGRKSTAPSPKTRRAGVRAGGRGSARRRGAPSARRPR"
FT   gene            complement(290935..292074)
FT                   /locus_tag="A2cp1_0263"
FT   CDS_pept        complement(290935..292074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0263"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: ank:AnaeK_0252 oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63622"
FT                   /db_xref="GOA:B8J924"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B8J924"
FT                   /inference="protein motif:TFAM:TIGR00539"
FT                   /protein_id="ACL63622.1"
FT                   /translation="MARPFGVYVHYPYCTHRCPYCDFAVTTERPPGAGRYARAVRAELG
FT                   LRAPAFEGLSLRSVYLGGGTPSLWDADELRDVLAAVRDRFGLPGGAEVTLEVNPESSDP
FT                   ARLEAWRAAGVNRISVGAQSFDPGVLAKLGRRHGPERAEQAIREAAAAIGNVSVDLIYG
FT                   ARRSSVETARRDAERAVEAGAVHVSAYALTLDPDVMAEEVPLARMRREGRLPLPSDEDA
FT                   LAQAAALRAALRRLGLRRYEISNFARPGRESVHNGLYWRHESYLGLGAGAYGCRRGDAG
FT                   SVRYGNLRDAGAWLATVEAGRLPTAEEDRIDARADRNERLMLALRTRDGAPLAALGPAQ
FT                   TREAADLVRHRLAVRRDGALVLTSRGLDLHSAISERLFE"
FT   gene            complement(292120..293205)
FT                   /locus_tag="A2cp1_0264"
FT   CDS_pept        complement(292120..293205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63623"
FT                   /db_xref="UniProtKB/TrEMBL:B8J925"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0253"
FT                   /protein_id="ACL63623.1"
FT                   /translation="MPASSRSSLACAAALATVLAAARPAAAQHAPPPAGAPGEPPCVPV
FT                   KPCEIPDEPAPAAEPPAELGAEVRRLFDLVACRGPAPAGLDAQVVGAFCAEQRRALEAF
FT                   RTGPRAKALEALAPLRPAGLPSTAVVPGGADLLTALGAFPDLKNVTTFSAAPAGDPRVL
FT                   AGLAPERLRQGLAAVRAGAQALLRGEGATARGASRPGEFPVQLALFLTALAAEGYEPTG
FT                   LRYFTVQPDGTLRHLGRADLGAGRAPLASSELTFVRRGDDPRTRTRTHRHVAADLSDAA
FT                   LARSPGVLAHLAGKGELSVALGAAGASPWRDDHARVRKLLLERAAMIVSAGPRLPAALA
FT                   RQAGLSAEERGPFQVARRDRR"
FT   sig_peptide     complement(293122..293205)
FT                   /locus_tag="A2cp1_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 28"
FT   gene            293406..295478
FT                   /locus_tag="A2cp1_0265"
FT   CDS_pept        293406..295478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0265"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="TIGRFAM: oligopeptide transporters, OPT superfamily;
FT                   oligopeptide transporter, OPT family; PFAM: Oligopeptide
FT                   transporter OPT superfamily protein; KEGG: ank:AnaeK_0254
FT                   oligopeptide transporter, OPT family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63624"
FT                   /db_xref="GOA:B8J926"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:B8J926"
FT                   /inference="protein motif:TFAM:TIGR00733"
FT                   /protein_id="ACL63624.1"
FT                   /translation="MAEPSTVVKPEVEQKEFRPYIGADRTLPEFTPKAVLLGALFGILF
FT                   GAATVYLALKAGLTVSASIPVAVIAISLGRKVFKTSILENNIIQTTGSAGESIAAGVVF
FT                   TLPGFLFLSAGPGGSSVGAGYFSYVTLFTLSLVGGILGVLMMIPLRRSLIVKEHGQLVY
FT                   PEGTACASVLIAGDKGGDFAKTAFQGVGFALGYALLQKVFHVIAETPAWVTKQTNKWLP
FT                   NATVNGEITPEYLGVGYIIGPRIAGVLVAGGVLAWLGLIPLLSVLVPGEVIARQLVKVG
FT                   ASPEGFGFDAAAGTFANLPRAVYLAYIRQIGAGAVAAAGFITLLKTFPTIVSSLRDSIR
FT                   SLGDKAGAASVSRTERDLSFVTVIVGSIALVVLLVALPQVPGDTVLNKLLTAVLIIAFG
FT                   FIFVTVSSRIVGIIGSSSNPISGMTIATLMATAMVFVSVGWTGAAYEPMALVVGGMVCI
FT                   AAANGGATSQDLKTGYLVGATPRAQQLALFVGAIASATVIGVTVKVLDTPTARMISEGI
FT                   TEHAIGSSYFPAPQATLMATLIKGLLSLNLDWHFVLVGAFIAITMELCGVKSLSFAVGL
FT                   YLPLSTTLPIFVGGALKGVADFVSRRKGGAGEEGELGSGSLFATGLVAGGALFGVIVAF
FT                   LQVFAEGTMKTLDLQESIVHAIGSTGYAVLGVVFFAALAAVLYRAARKPQPGLEA"
FT   gene            complement(296001..298577)
FT                   /locus_tag="A2cp1_0266"
FT   CDS_pept        complement(296001..298577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0266"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ank:AnaeK_0255 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63625"
FT                   /db_xref="GOA:B8J927"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8J927"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL63625.1"
FT                   /translation="MALNVLLVEPDPGLAEEIRRALGPAGFSVSAVASGEPALARCREL
FT                   APDLILLAAELPDMSGFSVCNRLKRAAASVPLLLYTGEATDAAIAAHRATRTRADDYLK
FT                   KPFELAELLGRAAALLHGDAPAPPPPPAPPPAATPAARAPRAGEGDPPPVLKRVESGVV
FT                   AARGLAGALAAATPAPVAGARPGPVAAPRPPPPPPPPRGAPLGKVKVAGATPRPDPADV
FT                   LAEWPRDPAPPKGTPEEKLEYFRDRLRARDAFLARVRDAIAAMKAEVAELAGERDLLAR
FT                   DLAGERDRAAGLEARLAEGAQDAAAQAARVEDLRRQLEESESTRRSLSEVLNETMQQQE
FT                   SAEQEASARIAGAEEARARLEAELAEAVEAHARAMAAVEADRADERAALEAARAQAEAD
FT                   AARGLEQVEAERVRERDEAAERLGMAEARATAAAAERDALEAELAALRGELGERDRALA
FT                   EGEARAGEARRAAEAEAQALRAAADEAEGRAQAAAGEHAEARERIAALEAELAEAAGTR
FT                   EALEEALRQAQAEARAYDQKAVAAEHAFQAKAAELAAAAQRIADLGAALDEGRASVEGT
FT                   RGELARVEAGRAEAERKGAQAAAERDQLAREVEAARREGEAERERARRLDAEVKRLAQL
FT                   EPVAEEAARLRKEVGSLREMVQQRTQAAEAASRSAQAAAAERARAEERAAVEAGKLQGS
FT                   AARLESELGAVRRKLAELDAERGARAAELEKVRAELQTAQAEADRRRQGAAAEAGEAER
FT                   RHASEAARLKAAMVELEKHLEARARAELVMKKRIQELEKAAAAPRPPPVPAADPAEVAK
FT                   LKAAVARLDEELGDLRGENDFLNGEVARYQQKNRDLQAQLDSLREV"
FT   gene            298816..299679
FT                   /locus_tag="A2cp1_0267"
FT   CDS_pept        298816..299679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0267"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: ank:AnaeK_0256 ribosomal
FT                   protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63626"
FT                   /db_xref="GOA:B8J928"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8J928"
FT                   /inference="protein motif:TFAM:TIGR00406"
FT                   /protein_id="ACL63626.1"
FT                   /translation="MSTHSLTLDVPRARAEDLSAELWELGASGVEVRDGEGTPMPGLPQ
FT                   PAPGRALLVAWFADRASAEAAAASAGGGEVAEVPDEDWGETWKKGLGPMVIGRAFVRPS
FT                   WVDAPVPPGLAEVVLDPGMAFGTGTHPTTSLCLAGLSELLAARPGASVLDVGTGSGLLA
FT                   IAARKLGAGRVTGNDNDPVAVAVARENAARNGVPEVALTEDALPAIGGAFDVVVANILA
FT                   NTLVELAPEIAARLAPGGAVLLSGILGPQEDEVRAAYLALGLRPLAGGDRREGEWSLLA
FT                   LEKPRA"
FT   gene            299676..300398
FT                   /locus_tag="A2cp1_0268"
FT   CDS_pept        299676..300398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0268"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   ank:AnaeK_0257 protein of unknown function DUF558"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63627"
FT                   /db_xref="GOA:B8J929"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B8J929"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACL63627.1"
FT                   /translation="MSLRRVHLPPERIGEGRAGLTDEARHYLRDVLRLAPGAAVELFDG
FT                   RGGAWEATVLDGFEALALGARRAAPGGGAPVWLLVALAKGEKIDLVVQKATELGAARIA
FT                   PFAAERSVVRLEPEKGEARAARWRRIAEEAARQCGRADVPEVRAPAPLGAALAEVPAGF
FT                   GAFVFHPGGAALSEAAPSPAGGYAAVVGPEGGLTDAEREACARAGARDTSLGPRVLRAE
FT                   TAAIVAVALLQARFGDLR"
FT   gene            300497..301498
FT                   /locus_tag="A2cp1_0269"
FT   CDS_pept        300497..301498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0269"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   ank:AnaeK_0258 RDD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63628"
FT                   /db_xref="GOA:B8J930"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B8J930"
FT                   /inference="protein motif:PFAM:PF06271"
FT                   /protein_id="ACL63628.1"
FT                   /translation="MVFCAGCGAPLALAPEPPPRALDASLSIDRRGDARPPGTPPPLRG
FT                   APPPPASAADTFVFGLPAMPPAAPVPTAPARTGRAREVDRSGWDLGPPLGVRQPDAPPP
FT                   QAAVSAADTSDDDFEFGPLPDLRAEPARALPPPAAAFARALEVDREVLGAPAAPAAVPA
FT                   LEAAPDEAIDVDVDAVEVHLRRPATWRRAASWAIDVLPFAALAIWALQAIAGAVPLAPG
FT                   EPGGPAHALDLALRDGGAIALPLAAGAVILGLVYQTLGHALAGATLGKLALGLRVVGPD
FT                   GRRPTLARSAARAALSAASVLLLGLGLLAALFTRSGRSLHDLAAGTWVVEAP"
FT   gene            301531..304056
FT                   /locus_tag="A2cp1_0270"
FT   CDS_pept        301531..304056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0270"
FT                   /product="General secretory system II protein E domain
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; General secretory system II
FT                   protein E domain protein; KEGG: ank:AnaeK_0259 general
FT                   secretory system II protein E domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63629"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B8J931"
FT                   /inference="protein motif:PFAM:PF05157"
FT                   /protein_id="ACL63629.1"
FT                   /translation="MRRDLAQLLVEEGAIPAAAAERAAARQAEAGGALDTALLELGLAG
FT                   EDVVLRALERASGLPAAPDWAWDASDARARRVFPSRVAERHGLAPFALEGRELSLVATH
FT                   PVDLALLDEISFMLSLHLTPHVGPEWRVRALIHRLYGGALPPRLAALAAGGAAAAAPGA
FT                   EAAAPEPAGAEPQAPDEGAPPPAAAADPEPPAPPPPAPAAAGFDEPGQLEPLAAAVAQV
FT                   LESADFSFLDAAPPSPAPEPSEAADAVDPAPAARPSAGPGRANAPGAARVERAEPPREP
FT                   ASRPAPRRMGEAAAPPPPPAPGAQGRWTRAQAQAALAAAGERDEVLRVVLRYAREFFAF
FT                   AAVFAVSRDAVAGHDALGEEEGEDARALCRSVAIYTSDPGVFHTAIETHAPHLGPISPE
FT                   PEGNRAILDGLGRGTPRTVLVHPVVLRQRTACLLYADNGPSAVSPRRLADLVLFLAGLA
FT                   PALERVIQARKRARSGVSGAGEVPAAAPAAPPPVAAPAPGPAPSPIRAATPAAQARPTP
FT                   APVAAPTGEPWQAHEPAAALADLEVDIDLFEEELGAAAPPSGAVRFDPEAEVTALLETD
FT                   AGSLDRIAGLARLAAFPEAALPVVWARLPGPIESDEDGASPTALGPLAAALAALGPAAV
FT                   PAMVEVLRDRDPVRRRIAATVLGAAGDPSTFPALAERVLDPDPRVAGAAIAALAAHRRH
FT                   PEMRAVPEKLRRALLSGVAARTTSAARALGAIRDAESVPLLVQVLESSEREPAEAAAAA
FT                   LAEITLQRLGTDARRWLAWWKQNRGRGRAEWLLSGLTSAEREVRAAAAEELARAAPPPV
FT                   SYQVDAPAPEREAAARLWAGWWARSGLVL"
FT   gene            304526..306085
FT                   /locus_tag="A2cp1_0271"
FT   CDS_pept        304526..306085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0271"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: ank:AnaeK_0260
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63630"
FT                   /db_xref="GOA:B8J9S7"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9S7"
FT                   /inference="protein motif:PRIAM:6.4.1.3"
FT                   /protein_id="ACL63630.1"
FT                   /translation="MPHSDPDPRRALLDQLDAEAEKGGGDERVARQHREGKLTARERID
FT                   AFLDPGTFVEMDRFKTHRCADFGMAEHKVLGDGVVTGYGLVEGRQVFVFAQDFTVFGGS
FT                   ISGAVAEKICKVMDRAMEVGCPVVGLNDSGGARIQEGVVSLAGYAEIFLRNTLASGVIP
FT                   QLSVIMGPCAGGAVYSPAITDFIFMVKDTSYMFITGPDVIRAVTHAEVTKEDLGGARTH
FT                   AARSGVAHFALDTEEAALRAVRELLSFLPLNNVDDPPIQPCADDPGRRDELLKTIAPEN
FT                   PGKAYDMKEVVRAVADDRHFFEVAEPFAPNIVIGFARLNGRPVGVVANQPAVLAGVLDI
FT                   DASVKAARFVRFCDAFNVPLLTFVDVPGFLPGTDQEWNGIIVHGAKLLYAYAEATVPKI
FT                   TVITRKAYGGAYDVMASKHIRADVNLAWPGAEIAVMGPEGAVNVIFRKELLAAKDPVAE
FT                   RARLVQEYRDRFASPYKAAELGYVDEVIRPEDTRPRVIRALEMLRTKRQELPAKKHGNI
FT                   PL"
FT   gene            complement(306180..306839)
FT                   /locus_tag="A2cp1_0272"
FT   CDS_pept        complement(306180..306839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63631"
FT                   /db_xref="GOA:B8J9S8"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9S8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0261"
FT                   /protein_id="ACL63631.1"
FT                   /translation="MPMRTHELHPAIVHAPLALLPAAAIADLVATARPRDRALDAVGRT
FT                   LWWSAAAGGLAAGLAGMAASQEIEVRGEHARDAMFLHGIGNLGLVVAAFGVAAWRSRNR
FT                   ACLTTALSGLAASAAATYTAYLGGELVYGHGAGIRALGGAASEAPALFSAAAPGRLARD
FT                   AVRGLRWLLSRGARAVTGRERVDRTALGPLAEAGTGAVPPAPGTRTDGSGMGAPLS"
FT   gene            complement(307028..307231)
FT                   /locus_tag="A2cp1_0273"
FT   CDS_pept        complement(307028..307231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0273"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ank:AnaeK_0262 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63632"
FT                   /db_xref="GOA:B8J9S9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9S9"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACL63632.1"
FT                   /translation="MATGTVKWFNDAKGFGFITQDDGGEDVFCHYSAISGDGFKSLAEG
FT                   QKVEFDVVKGPKGLQAANVRKV"
FT   gene            complement(307383..308558)
FT                   /locus_tag="A2cp1_0274"
FT   CDS_pept        complement(307383..308558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0274"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   ank:AnaeK_0263 2-nitropropane dioxygenase NPD"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63633"
FT                   /db_xref="GOA:B8J9T0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9T0"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACL63633.1"
FT                   /translation="MTADATPVHPEETPAPFPRLDRAAIEALVRAGQRLLVQGGMGIHA
FT                   SDGLAGKVARHRGARLVGVGTISAVLKTPEQLRGEIRRARAEAPGGFVGVNLMAAINKD
FT                   DFEALARVSIEEKVSFLVQGAGISREIVRWCREGGVPFCGIVSSGRLAAMYEKWGADFV
FT                   VAEGAEAGGHIGDIGHPLPTLVDEVIAATSLPVIAAGGVDAADVSRFLAAGAAGVQMAT
FT                   RFLACSDGDVHPAFKQMHLAKREDDVVIITSCVKGMKARAVRNAFTERLARGEAVPPRS
FT                   KLWWFGKDGYRGRRGSCIQCLGEGLCKARASGFKESFCITDALLEAAVHGDTEAGLFYT
FT                   GQSITRIGERDASDLPRAAEILTDLEQRLADEARPSDAGSQARPAAVGAAA"
FT   gene            308795..310108
FT                   /locus_tag="A2cp1_0275"
FT   CDS_pept        308795..310108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63634"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9T1"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0264"
FT                   /protein_id="ACL63634.1"
FT                   /translation="MTAPSPAPIVVAVDMGYGHLRAATALADALGTEVLKVDRAPVAGP
FT                   DEERLWQRVRRGYEAISRLSQVPVAGRPLAWALDSITDIPRLHPRRDLSAPTRGVRALE
FT                   RLARGDLGAGLVARLRAEGAPLLTTFYSPAVIADRAGIERVYCVATDTDLNRIWAPLEP
FT                   ARTRIQYLVPTRRAARRLLAYGVPANRITFTGFPIPDALLGGPSLPVLRRNLAARLVRL
FT                   DPTGEFRRSMPEELAVFLGALPREEEGRPAQLTFAVGGAGAQAAMADAFLPGLRPALES
FT                   GAMRLALVAGTRPEVEARFREAVRRAGVEPLLGGAVEILRAPSFGEYYARFNALLARTD
FT                   VLWTKPSELTFYGALGLPLVLAPPVGVHERYNRRWARESGAGLKQRDARFAAEWLSDWL
FT                   ADGLLAAAAWAGYMRLPKFGLYRVLEALGRTPAANVAP"
FT   gene            310327..311061
FT                   /locus_tag="A2cp1_0276"
FT   CDS_pept        310327..311061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0276"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; KEGG: ank:AnaeK_0265
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63635"
FT                   /db_xref="GOA:B8J9T2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9T2"
FT                   /inference="protein motif:TFAM:TIGR00530"
FT                   /protein_id="ACL63635.1"
FT                   /translation="MLAVFSFVYWIFFVLTLPFLFAVALVVFVLTAPFDPRRVALQLWS
FT                   CAWASFYVVVNPLWRSRVVGREKLPWNGAAVLVANHLSMLDILVLYGVFRPFKWVSKAE
FT                   LFRVPFVGWNMWLNDCVPVWRGDRESVRKMMAHCRAHLARGAPVMIFPEGTRSPDGRLQ
FT                   AFKDGAFRLAVDANVPVIPIAVSGTSEALPKHGMVLRQRMRAEVHVLDPIHPSAFDGPA
FT                   ALREAVRDAIAAALPPEHRPGA"
FT   sig_peptide     310327..310422
FT                   /locus_tag="A2cp1_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.733) with cleavage site probability 0.553 at
FT                   residue 32"
FT   gene            311148..311675
FT                   /locus_tag="A2cp1_0277"
FT   CDS_pept        311148..311675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63636"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9T3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0266"
FT                   /protein_id="ACL63636.1"
FT                   /translation="MITHTYEVAGGVGARTPGAIGPDELDGRADWVEIPARGEGELMER
FT                   LEARLGSEARTRKVLLAVLAPVRGALEGPALAAILAHLPHRFARELREAEWNLDAPVRE
FT                   AATGAEYLAEVSRLLQRPPRHAAAYVLAVLAAAHEVMGPAAREVAGQLPPDLADLWRGV
FT                   REPGSAIAEAEP"
FT   gene            complement(311635..312852)
FT                   /locus_tag="A2cp1_0278"
FT   CDS_pept        complement(311635..312852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0278"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ank:AnaeK_0267
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63637"
FT                   /db_xref="GOA:B8J9T4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9T4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL63637.1"
FT                   /translation="MAPHDAPGQEAGQAAQAQGRVDLLRALDRLLAIEPEEHALRRILS
FT                   ALADAVPAVHAAVLLVPGDEGRLAIAAEVGGDGRPPPPADGGAGLAAGAPWVRGDPGWP
FT                   LPAGARAGAAAPAGGGAVLVMGTRGEGGFDPEALALLRVAADRAGLALERGRLRRAHES
FT                   AEEAARRALAEVDSRRRAVDYILGIVGHDLRNPLGAVHMSAALLQKRGGLEGWQARAIE
FT                   RMRSSAGRMARIIADLLSYTRTRLGNGMPIDRRPARLDEIARRPVDELGAVNPGREITV
FT                   EVRGDVSGSWDPDRLEQVISNLVSNAVDHGDPASPVRVELSGEPDACVLRVRNTGPPVP
FT                   PEVLEHLFEPFSRPPDEKSRKGSGLGLGLYISREIVRGHGGEISIASDGETVITARLPR
FT                   SQSPAP"
FT   gene            313068..314600
FT                   /locus_tag="A2cp1_0279"
FT   CDS_pept        313068..314600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0279"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   ank:AnaeK_0268 carbamoyl-phosphate synthase L chain
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63638"
FT                   /db_xref="GOA:B8J9T5"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9T5"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACL63638.1"
FT                   /translation="MSPTRPIEKVLVANRGEIAVRVMRTCREMRIPTVAVYSEADRGAL
FT                   HVRKADEAVFIGPAPARESYLSIERILDACRRTGADAVHPGYGFLSENAELARALDRAG
FT                   IALVGPPAAAMDAMGVKTTARRNMAAAGVPVVPGSEEPFAEEAEARAFAERIGFPVMIK
FT                   AAAGGGGKGMKKCDRAEDFAALWQSARREATAAFGDDRLYLEKFLEKPRHVEIQIFADQ
FT                   HGNCVWLGERECSVQRRQQKVIEETPSAVLDDRLREAMGEVAVRAARAVGYVGAGTVEL
FT                   LVDAHRNFYFLEMNTRLQVEHPVTEMVTGLDLVRMQLEVARGAPILAQEQVQRRGHAIE
FT                   ARVYAEDPARGFLPQPGKITYLRVPGGPGIRDDSGVYAGWVVPQWYDPMISKLVAWAPT
FT                   RPQAIDRLIRALGEYVVHGIGTNLSWLAAALDHPEFRSGDYDTGFCARNAKALIRPPDP
FT                   SLERVALIAAAVAAFRRERDAAEAHAARAGQGAARSGWARAGRLRALRGGGR"
FT   gene            314597..315109
FT                   /locus_tag="A2cp1_0280"
FT   CDS_pept        314597..315109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0280"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: ank:AnaeK_0269 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63639"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9T6"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ACL63639.1"
FT                   /translation="MKTYVALLDGGKREVTLGVTRLATGQYEVRIGDEVHRVDAYPHDY
FT                   GTLSLLVDTRSYSAMLDERGAKVHVQVDGSVFPLELLDERKLRMRRASPRASVEGRRAV
FT                   TAPMPGRVVKVLVAPGDAVRAGQPLVVVEAMKMENEMRSPKDGKVVEVRVVEGQAVEGS
FT                   ALLCAVE"
FT   gene            315182..316831
FT                   /locus_tag="A2cp1_0281"
FT   CDS_pept        315182..316831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0281"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: ank:AnaeK_0270 methylmalonyl-CoA mutase, large
FT                   subunit; TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63640"
FT                   /db_xref="GOA:B8J9T7"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9T7"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ACL63640.1"
FT                   /translation="MADEKKQRWLEGTYAKAVKKGPERRPRFETSSGIREEPVYGAADV
FT                   RPGLDERLGLPGEYPFTRGVQPTMYRGRFWTMRQYAGFGTAEESNKRYRYLLESGQTGL
FT                   SVAFDLPTQMGRDSDHPRARGEVGKVGVAIDSIRDMEVLFDRIPLGEVSTSMTINATAG
FT                   MLLAMYQAVGEKQGAAPAVLQGTIQNDILKEYAARGTYIYPPEPSLRIITDIFAYTAKV
FT                   MPRWNPISISGYHIREAGSTAVQEVAFTLADGIQYVDAAVKAGLDVDAFAGRLSFFFNA
FT                   HNDLLEEVAKFRAARRLWARIMKERFKAKDPRSMMLRFHTQTAGSMLTAQQPDNNIVRV
FT                   TLQALAAVLGGTQSLHTNSRDEALGLPTEDSVRIALRTQQIIANESGVADVIDPLGGSW
FT                   AIEAMTDEIEGRAQEYIRKIDELGGMVHAISKGYVQREIQEAAYAWQRQVEAKDQVVVG
FT                   VNAFRSDDPPVPVMKVDPALEAQQVERLKALRAARSASAARGALDAVRAGARGTDNLMP
FT                   LILAAVKAECTLGEISDALREVYGEYRETVVL"
FT   gene            316838..318640
FT                   /locus_tag="A2cp1_0282"
FT   CDS_pept        316838..318640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0282"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: TPR repeat-containing protein; heat shock
FT                   protein DnaJ domain protein; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   ank:AnaeK_0271 heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63641"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9T8"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ACL63641.1"
FT                   /translation="MSDAPPKPPGETPPPRPRPAPPAGPPRLERVPDGYRPPAMPRAVA
FT                   PAAARPPPPPPPAPTYGLAAREVGADAAIAAGLAHQGALAADSALRLYGLAAATRASGR
FT                   LTLAPAGRSYALVFRRGAVEHAASSDPTDDLGRFLLRKGVLRPEQLVQAEAARGAAGGD
FT                   LAAALVGARLVPPGDVAALLAEHGLALVARALAVEDGTWAWEPGVAPPPSGFPLGPPFA
FT                   ALCAAVRALELATVKRRLGDREERAASRMAGRVRIEDLRLTPQEARAAALLDGERSPAE
FT                   IAAASPADAAAVLRLSLLLGELDLLAFGARRARSPAPAPASVPTPTPTPPPASTPVSRA
FT                   ATAVPAAAAPRPPAAPHPPATAAAVARPPSAPVRRATALEPAALKATLVSLEGSDHFQV
FT                   LGVKRDAPAAQVKVAYFQLAKLYHPDAIPSDAPADVRKLCADLFARVSAAWAELGDEAR
FT                   RAQYLEELRGGGAPEVDVMGILQAENLFQAGTQLVKARRYDEAHARFLEALQLNPEEPE
FT                   FGIWRAWCDFLRAEDKKRQQAQSAAAIEAGLKKNPRCAPGYLFLGQMAKVLGDLALAER
FT                   HLRRGLAAAPDNADLARELKYLRK"
FT   gene            318653..319186
FT                   /locus_tag="A2cp1_0283"
FT   CDS_pept        318653..319186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0283"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   ank:AnaeK_0272 protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63642"
FT                   /db_xref="GOA:B8J9T9"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9T9"
FT                   /inference="protein motif:PFAM:PF01985"
FT                   /protein_id="ACL63642.1"
FT                   /translation="MPAPTNPKKRALMPSSPLRRALRAAGHHLSPVVQVGKEGLTEAVL
FT                   RQLDEALLAHELVKMKVGTESPEDRLEIADRLLAEDVQVAQVLGRTVLAYRRHPERPRY
FT                   EPAPAGARAERPEAKRAAAKGRRAPAKEKRAPARGQRAPARERRAPARGQRAPAKGQRP
FT                   AGRRPAPRAKRTKR"
FT   gene            complement(319210..319521)
FT                   /locus_tag="A2cp1_0284"
FT   CDS_pept        complement(319210..319521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63643"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9U0"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0273"
FT                   /protein_id="ACL63643.1"
FT                   /translation="MFALLAAAALLLAVASWIRFRRLEQALVGELAGLTARVKDLAERV
FT                   DAAEADVGHAVTQTEIAESLLLDKGIAEPEELEALRRRVDEDDAPAPAYQPERDGALH"
FT   sig_peptide     complement(319474..319521)
FT                   /locus_tag="A2cp1_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.759) with cleavage site probability 0.307 at
FT                   residue 16"
FT   gene            319651..320250
FT                   /locus_tag="A2cp1_0285"
FT   CDS_pept        319651..320250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63644"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9U1"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0274"
FT                   /protein_id="ACL63644.1"
FT                   /translation="MTRAVKRLIRDLALRVPELGHVRASRVLVVAGEARRSSRATIRPA
FT                   HFGATRRRAGEGGAVKPLVRVKGRKILYVVTLRPLWFLASTPEERIGTIVHELYHASNR
FT                   FDGTLHRGRRHSRFPRARYNRKVRALLRAYLARAPEEVVAPFAHQGVVRARMWLERPGS
FT                   FRDGEYSGRRLYTEKQLFYGLVRMRSGARRRGPSAA"
FT   gene            complement(320247..320822)
FT                   /locus_tag="A2cp1_0286"
FT   CDS_pept        complement(320247..320822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0286"
FT                   /product="Fe-S type hydro-lyase tartrate/fumarate beta
FT                   region"
FT                   /note="PFAM: Fe-S type hydro-lyase tartrate/fumarate beta
FT                   region; KEGG: ank:AnaeK_0275 Fe-S type hydro-lyase
FT                   tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63645"
FT                   /db_xref="GOA:B8J9U2"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9U2"
FT                   /inference="protein motif:PFAM:PF05683"
FT                   /protein_id="ACL63645.1"
FT                   /translation="MPKTLTLPALPEDVRGLAAGDEVLLRGRIVTGREAAHRYLATHDD
FT                   PQVRRWTEGAVLYHCGPVVARAPGGGWRFVAAGPSASGRQEPWEAEVIARYGLRGVLGK
FT                   GGMGPRTLEALRAHGAVYLHAAGGLAVSLARHVTRVLDVARLDALGVTEAIWLAEVDDF
FT                   PAVVTMDAHGETLHAPGAEAPETTPAPG"
FT   gene            321023..321961
FT                   /locus_tag="A2cp1_0287"
FT   CDS_pept        321023..321961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0287"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase; KEGG: ank:AnaeK_0276 pseudouridine
FT                   synthase, RluA family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63646"
FT                   /db_xref="GOA:B8J9U3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9U3"
FT                   /inference="protein motif:TFAM:TIGR00005"
FT                   /protein_id="ACL63646.1"
FT                   /translation="MRREIRLPLTASGRLDRALADALGLGRAAVKRAFALGEVRVRGRR
FT                   ARASDPAAPGALVELDVELPAGPPEPEPDAPLSVLLERPRYLVVEKPAGVAVHPLAPGE
FT                   GGTLANAVAARHPECAEASPEPREGGAVQRLDLETSGCVLFARDPEAWEALHAQLGAHT
FT                   VDKVYLALAVGRLPAGGVCSVPLAQRGGRVVPAPDVEAEERLQARGLRPRPAETHYEPE
FT                   RRFADHTLLRVRIVTGVMHQIRAHLALLGHPVAGDALYGGAAAALPGLERQFLHAWRLA
FT                   FDDPDGAGRVAVESPLPPELEAVLARLPAAR"
FT   gene            complement(322069..322515)
FT                   /locus_tag="A2cp1_0288"
FT   CDS_pept        complement(322069..322515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0288"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   ank:AnaeK_0277 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63647"
FT                   /db_xref="GOA:B8J9U4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9U4"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ACL63647.1"
FT                   /translation="MAMGLGSKRPVTDINVTPLIDVVLVLLIIFMVLTPLAEKQKFIRV
FT                   PEYQPEMQPVPPDSVPPDQTVLTALGNGNVLLNKQEMTINDAMQRLHVAYDGRPSKVMF
FT                   FNAEDSVRYEQAVKVLDAAHGAGVNTIGMMTDPPLGGGAAGEQQ"
FT   gene            complement(322518..322937)
FT                   /locus_tag="A2cp1_0289"
FT   CDS_pept        complement(322518..322937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0289"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   ank:AnaeK_0278 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63648"
FT                   /db_xref="GOA:B8J9U5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9U5"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ACL63648.1"
FT                   /translation="MSMDVGGKGVKSEINVTPLVDVVLVLLIIFMVITPMLQRGKPVVL
FT                   PDAKHVSALKQGGDPILVSVTKDGKIWIDKEEVQKADLSQMLTIAMQMQPGAPVLVKGD
FT                   RDVTYKTIREMIFEISKTHIMGVSLAASQIKDKEK"
FT   gene            complement(322974..323732)
FT                   /locus_tag="A2cp1_0290"
FT   CDS_pept        complement(322974..323732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0290"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   ank:AnaeK_0279 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63649"
FT                   /db_xref="GOA:B8J9U6"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9U6"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ACL63649.1"
FT                   /translation="MSLQVIQTLQQLAAAQATPEVSFDLLHMWKTMGPFAKFIAGVLAV
FT                   MSIYSLGVMAERLVTFARAQKASRQFAAALRDLLPAAKFGEAVELSRKLKRGHLPKVLG
FT                   LAIEEYSHGVEALKTHGPRDVGNFDVIAAVNRAVERSSLRTVNDLRRGLGALATVGSTA
FT                   PFVGLLGTVAGIITAFQAMAATGSGGLGSVSAGIAEALVTTAFGLLVAIPAVMMFNYLT
FT                   NRVEDMQVDITDSATELMDFFMKEGRSEVK"
FT   gene            complement(323785..324531)
FT                   /locus_tag="A2cp1_0291"
FT   CDS_pept        complement(323785..324531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63650"
FT                   /db_xref="GOA:B8J9U7"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9U7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0280"
FT                   /protein_id="ACL63650.1"
FT                   /translation="MFDEVTKQEGGKNAAKRAGYVFGSTLFQVLLVFAIITASAAIKAK
FT                   VIDEPVVDVKFVKAVPPPPPPPPAPPPPAARKRPPDEKPRTDLPKPPPPTALLQPKDVQ
FT                   AEMKPPDPNEPPEPEYDYGDAAAGEGVVGGVVGAAPQQNQIEDAPAYATAGYKKPQMAQ
FT                   PNCVQQSVRLPRELLGYISGPITVKFAIGRDGAPSRFEAMTNVPDKRIADAIWNAVQTC
FT                   KWVPGADAQGRPTAIWVILPLRFTAG"
FT   gene            325045..328413
FT                   /locus_tag="A2cp1_0292"
FT   CDS_pept        325045..328413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63651"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9U8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0281"
FT                   /protein_id="ACL63651.1"
FT                   /translation="MRKKLLRLLRIAPLALLFAGVAFAQTTGTIIGVVTDASTGKPVAG
FT                   AVIVARSPNLQGEQTAVTDANGNYRITLLPPGAYSLAVQLEGFKPAERADITMRTDKTI
FT                   RANIAVVPEAVQMEEQVVRTGAAPVVNIGAAESGAVVSREFMANIPVGRSVENVATVVP
FT                   TAQTDSYGVSFAGAQSPENSYIVDGLNVTDPVYGTFAGNPNSQTLTPTLQNNFVQEIDV
FT                   KTGGFQPEYGRTTGGVLNVVTRSGSNEYHGSVFTDFTPRMLIDPTGKTAGTNGEAIGWR
FT                   RKPDEGAYDLDFGFEVGGPIMKDKLWFYAGFAPIVTRTYTERFLQLNRMEQDPTSHAWS
FT                   PALNESTGLIEQDRVPGTEQVYRSGRTTYQYVGKLTYLLDENNNLTLSAVGMPTSATSI
FT                   SMAGGPSRRTFDETGNTFDGSLRYAGKFLDKRLIVEAQAGWHYNKSAPKDKTQAGVDQL
FT                   NTPTLQFRFRTPVTNFEALPECVGRAPSTDPTTPLDQGYSATDVCGVNLYNTGGLGYLS
FT                   DAVSNRLATRVSASYLSELLGSHNTKVGVDFERSTFAQDKRYAGGYYYATTGNGLIYAR
FT                   RGYGYVSTANGRIPATTPGTNVIPSEVNFATRIQNTAGTNSTSVYAQDSWQLPQNVTLN
FT                   YGIRWEGQSLNNVSNPESNGFTINNSWAPRVQAIWDFTGSGRGKVAGSWGRFFYAMPLD
FT                   LGDRTFGAERSLIFYMPTSAIGTAPGCAIPGGASEAGMADPTNQSLVTYDTRQLNPSNC
FT                   GVTNSGGGTGPDRSYLFRTSGTSASPVSPDISQAYVDQFGGQIEYEVLSDLSVGLEYAG
FT                   RRQGDIIEDMSPNDGEGYYIGNPTKGGEFVGSDGVTYNPSAPTATDTATGRLMVIPFPK
FT                   PERSYDGVTLSVRKNFSRGWQASASYTYSVLRGNYAGPYRPEDDQLDPGITSQYDIPSI
FT                   MTNQKGYLYGDRPHQVKLFGSYTWAASPRFSLTGGAAYTGQSGNPISALAGYNDIYDVS
FT                   QTFVVPRGMAGRSPWTNKVDLRGALEYVIKPPYALKFTVDVFNVLNSEETILIDQDYTY
FT                   DMTQPISGAKCSSQSAVGKANPVQALQSACPDLKYLKTIDGRNVTVNPNWGRPASGTAS
FT                   FMAPLSLRLGLSLSF"
FT   sig_peptide     325045..325119
FT                   /locus_tag="A2cp1_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            328436..329227
FT                   /locus_tag="A2cp1_0293"
FT   CDS_pept        328436..329227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63652"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9U9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0282"
FT                   /protein_id="ACL63652.1"
FT                   /translation="MKTLTKLALTLIAVAGLQACDPYEDENKGTPSVTNVIATDGGAAF
FT                   EGTNTGTSWTVATTSGTVVFVKANPGKLLDGASIQVTPEDCTPAGGWLSVNGAGPGNWM
FT                   SCYYPQSPASFEGASVVLYPGPSISATESWFNLTELAAGIFNLKGTVSDKQGHPLDIDV
FT                   NVLVNDFAAAQSDTAGTEITVDFSDAGDNMTDVQLWEAPDNSGAPGNWTAVATTSPYVK
FT                   TGVTVGATWWYKVSADTNGFPTTAASFETEPVSVTTEPPAP"
FT   sig_peptide     328436..328495
FT                   /locus_tag="A2cp1_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.993 at
FT                   residue 20"
FT   gene            complement(329443..330102)
FT                   /locus_tag="A2cp1_0294"
FT   CDS_pept        complement(329443..330102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0294"
FT                   /product="translation elongation factor Ts"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   ubiquitin-associated- domain-containing protein;
FT                   Translation elongation factor EFTs/EF1B dimerisation; KEGG:
FT                   ank:AnaeK_0283 translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63653"
FT                   /db_xref="GOA:B8J9V0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J9V0"
FT                   /inference="protein motif:TFAM:TIGR00116"
FT                   /protein_id="ACL63653.1"
FT                   /translation="MAEISAKMVQELREKTGAGMMDCKKALTEAGGDLAKAEEVLRKKG
FT                   LSAAAKKTGRAATEGAVASYIHMGGKIGVLVEVNCETDFVARTEGFQGLVKEIAMQVAA
FT                   ASPRWVRREEVPADVVAKELEIAKAQAREQKKPEAILEKIATGKVEKFYSEFCLMEQAW
FT                   VKDDKKKIQDVLTDAVAKIGENIQIRRFARFVLGEGLEKKQENLAEEVAKAAGLQK"
FT   gene            complement(330212..331243)
FT                   /locus_tag="A2cp1_0295"
FT   CDS_pept        complement(330212..331243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0295"
FT                   /product="ribosomal protein S2"
FT                   /note="PFAM: ribosomal protein S2; KEGG: ank:AnaeK_0284
FT                   ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63654"
FT                   /db_xref="GOA:B8J9V1"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9V1"
FT                   /inference="protein motif:PFAM:PF00318"
FT                   /protein_id="ACL63654.1"
FT                   /translation="METQETQQQPAAAVPPPAAPEAAAPAPDTMAAALSQGGTAITMKA
FT                   LLEAGVHFGHQTKRWNPKMKPFIFGARNGIYIIDLQKTVGLARNALRFVSDSVAKGGSV
FT                   LFVGTKKQAQDAIREEASRSGQFFVTNRWLGGTLTNFKTVKQGIDRLKTIEKMAADGTY
FT                   ERLPKKEVAQLEREREKLEKNLGGIKELSRLPSALFVIDTKKEHIAVHEANRLGIPVVA
FT                   VVDTNCDPEGIDYVIPGNDDAIRSIRLFTGKVAEACIEGKGRYSAWVAEHGGHDERREQ
FT                   EDRDAASERGHKDRRDRRDRRGGPRERREPREDRAAASANVEVVRKGEVAPAAAPEAAP
FT                   AKE"
FT   gene            complement(331518..332567)
FT                   /locus_tag="A2cp1_0296"
FT   CDS_pept        complement(331518..332567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63655"
FT                   /db_xref="InterPro:IPR010330"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9V2"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0285"
FT                   /protein_id="ACL63655.1"
FT                   /translation="MPRRRPASPRPRPGHPAAAGKVRAPVRAGARGDVLLAWALDRDGR
FT                   KVNAGRLDPADRRRLAPFTCLGCGEPLVPHLGRVRARHFAHAPGSACPLTAPETALHLD
FT                   AKERLLALCADAFGRRRTVTVLARCPSCRRLAPRDLAAEGDAAAAEGAVGPLRADVLVL
FT                   RAGRAALALEVLVTHAVDVEKEAALAAAGVPAVEIDAREEWERAEPDGAVAIVPVRSLG
FT                   FPACPACAAGARADADRALGGEAAEIAELEAYRARGLLGPALRAPALAGAPGAAGGPDA
FT                   PFTEAERADLAARFACPDCGGAAIAFGARIARHPCPGRPPRPIAWRGYDGARIELTWWK
FT                   RPAGPPPRR"
FT   gene            332693..333148
FT                   /locus_tag="A2cp1_0297"
FT   CDS_pept        332693..333148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:332825..332827,aa:Sec)
FT                   /locus_tag="A2cp1_0297"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="Contains selenocysteine; PFAM: alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Redoxin domain protein; KEGG: ank:AnaeK_0286 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63656"
FT                   /db_xref="GOA:B8J9V3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9V3"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACL63656.1"
FT                   /translation="MALEVGRKAPDFALPDEDGNVVKLSSFKGKRVVVFFYPKANTSGU
FT                   TQEASDFRDEVDAFTKQKVAVVGISKDAPAAQKKWKEKLGLPFPLLSDADTAVQQAWGV
FT                   WKEKNMYGKKVMGTERTTVVIGPDGKVEKVFPKVKVDGHVASVLESL"
FT   gene            333211..334524
FT                   /locus_tag="A2cp1_0298"
FT   CDS_pept        333211..334524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0298"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: ank:AnaeK_0287
FT                   Fmu (Sun) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63657"
FT                   /db_xref="GOA:B8J9V4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9V4"
FT                   /inference="protein motif:PFAM:PF01189"
FT                   /protein_id="ACL63657.1"
FT                   /translation="MTRKPHPQRPPRNDLVDALVLEVHGLVHDQGWLADRALERVLRRE
FT                   RALWANERRAVAEAVYGILRAQGQLDFLLGGSPPLATRYAAWLVRAAGVAPAQAAARLG
FT                   ASPRALAGLAEADARVAAIPDPLDRFAVEASLPRWIAERLVSELGEAEARSLAAVLNRR
FT                   APLTVRANALAGDRDALRAALAAEGVPAEPTRFSPWGLTLDGHQNAFALEAFRTGGFEI
FT                   QDEGSQLIALACGARPGQVVVDACAGAGGKSLALAAEMHNKGSLHALDSDAGRLEDARR
FT                   RARRAHVHNLRTRVVPAGPEAEAAVADLAGKADVVLVDAPCSGLGTLRRKPDARWRLQP
FT                   GDPERFAAIQRELLGRFSRLARPGGRVVYATCAMGRTENDEVADYAERELGLAPAPLAP
FT                   FLGAERARALGAGESRCALYPHRHGTDGFFFAAFAKRA"
FT   gene            334540..335382
FT                   /locus_tag="A2cp1_0299"
FT   CDS_pept        334540..335382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0299"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: ank:AnaeK_0288 DNA-(apurinic or apyrimidinic
FT                   site) lyase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: zinc finger Fpg domain protein;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63658"
FT                   /db_xref="GOA:B8J9V5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9V5"
FT                   /inference="protein motif:TFAM:TIGR00577"
FT                   /protein_id="ACL63658.1"
FT                   /translation="MPELPEVEIAARNLRRWAEGRRVEEVGWDPRARRIFRPATPAAFA
FT                   RALEGARFAGIRRIGKHLLVALERGGAPVGLLAHLGMTGKWVLRGAEEPAPRHARAWLR
FT                   LDGGGVLHFQDSRLFGRLRTVPGARFEDVPEVAALGPDPLEHGIDPAALAGALAKSRLP
FT                   VKVKLLDQRLLPGVGNIHASEACFRARVDPRRPSRALSRAEAKALAAAILASFRMTLDA
FT                   EDGPEITYVEEPGAENPFLVYAREGEPCPRCRKGGRTSPIARVVQAQRSTFFCPRCQR"
FT   gene            335393..336244
FT                   /locus_tag="A2cp1_0300"
FT   CDS_pept        335393..336244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0300"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: ank:AnaeK_0289
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63659"
FT                   /db_xref="GOA:B8J9V6"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9V6"
FT                   /inference="protein motif:PRIAM:3.1.26.4"
FT                   /protein_id="ACL63659.1"
FT                   /translation="MRPEDLPRLSVAELRARLLDRGEALGDACEAALEADPRAGAREVL
FT                   RLVRKRRRENRAEGQRLRHLLRYEAELWERGLVRVAGVDEAGMAPLAGPVVAGACVLPL
FT                   DYRPRGIDDSKQLDRAERERLAEDIKRNAVCWAVARADVEEIDRLNIYWAGMLALRRAV
FT                   DGLSARPEHLLVDARKLPDLPFPQTPIVHGDALSLTIAAASILAKTARDALMAELDLVH
FT                   PGYGFARHKGYPTAEHFEALGRLGACPIHRRSFTPVRVALGLEPAQGDLFALADAAVAD
FT                   DE"
FT   gene            336407..338077
FT                   /locus_tag="A2cp1_0301"
FT   CDS_pept        336407..338077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0301"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /note="KEGG: ank:AnaeK_0290 poly(A) polymerase; TIGRFAM:
FT                   poly(A) polymerase; PFAM: Polynucleotide
FT                   adenylyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63660"
FT                   /db_xref="GOA:B8J9V7"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9V7"
FT                   /inference="protein motif:TFAM:TIGR01942"
FT                   /protein_id="ACL63660.1"
FT                   /translation="MHEPSTKNDLFRPAYPAEDLEENRDRRPPPGLALDPPEAPPPEHP
FT                   PEIPVDRLDGDALKVIARLRHMHHQAYLVGGCVRDLLLGATPKDFDVATDAHPGEVRAI
FT                   FRNCRLIGRRFRLAHVYFRAGKVIEVATFRKNPTDVAEDVGEGEGDLLITRDNVFGTAE
FT                   EDSVRRDFTVNGLFYDVATGEVIDYVGGRADLEAHRISTIGDPEIRMREDPVRALRAVR
FT                   FAARLGFTIAPDTFEAMRRTSGELARCAPARVLEETFKLLRCGGSARAFELLRACGALP
FT                   VILPALGAALETWDDGRRRAFFAHLAALDRLVRSGAEVSEAVLLGALLMHLGADAPRAG
FT                   RADAARGDEDAGAPRWDEADAFLASLVQTARLPRKVAERIRLALHAQRQLEEPGKRRRR
FT                   RGRGPAGQTYFQDALQLLEIRVRATGRGAEVLERWSAEAPHPHAPSERPGRAGPRDDRH
FT                   ERRDRREGSATHGADRDEGAVREVVIPTEAAEAADEADPEVREVDSSAAGEGGEGEASQ
FT                   GGRRRRRRRGGKRRRRRGAGASGPDGGAQVPPAEAGGQG"
FT   gene            338149..338904
FT                   /locus_tag="A2cp1_0302"
FT   CDS_pept        338149..338904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0302"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: ank:AnaeK_0291
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63661"
FT                   /db_xref="GOA:B8J9V8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9V8"
FT                   /inference="protein motif:TFAM:TIGR02075"
FT                   /protein_id="ACL63661.1"
FT                   /translation="MASEKASNAKARYQRILLKLSGEALMGDGKYGISPKTLTSIAHDV
FT                   KDVVDLGVEVALTIGGGNIFRGVSGATEGMDRSSADYMGMLATVINSMALQDALEKIGV
FT                   PTRVQSAIEMHQVAEPYIRRRAIRHLEKGRVVIFAAGTGNPYFTTDTAASLRAMEIHAD
FT                   VLLKATKVDGVYTDDPKKNPAATKFKQLSYIDVLKKNLKVMDSTAISLCMDNDLPIVVF
FT                   DLTQRGNVRKVVLGEEIGTTVGRPSARNA"
FT   gene            338924..339490
FT                   /locus_tag="A2cp1_0303"
FT   CDS_pept        338924..339490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0303"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor; KEGG:
FT                   ank:AnaeK_0292 ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63662"
FT                   /db_xref="GOA:B8J9V9"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J9V9"
FT                   /inference="protein motif:PFAM:PF01765"
FT                   /protein_id="ACL63662.1"
FT                   /translation="MGTIADDILDDLHGRILKTLDQLRTELAAVRTGRASLHLLDNVRV
FT                   DYYGTPTPLNQVATLSVPEARLIVVKPWEKSMIPPIEKAIRDGNLGLNPMSDKDLVRVP
FT                   IPALTEERRKEIVKQVKHKGEEHKIAVRNVRREAKELIEVAEKDGDISGDDAEKALEKM
FT                   QKETDDGVKKIDEIVAAKEKDVLQV"
FT   gene            339490..339705
FT                   /locus_tag="A2cp1_0304"
FT   CDS_pept        339490..339705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63663"
FT                   /db_xref="GOA:B8J9W0"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9W0"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0293"
FT                   /protein_id="ACL63663.1"
FT                   /translation="MGGAVARSPAALLLLLGPLLALGFAAGAVRALAARPDLPPRRRRA
FT                   LSAAWVLLLLAGTPLWLVAAALLGIW"
FT   sig_peptide     339490..339591
FT                   /locus_tag="A2cp1_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.857 at
FT                   residue 34"
FT   gene            complement(339725..340153)
FT                   /locus_tag="A2cp1_0305"
FT   CDS_pept        complement(339725..340153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63664"
FT                   /db_xref="GOA:B8J9W1"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9W1"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0294"
FT                   /protein_id="ACL63664.1"
FT                   /translation="MRELLVFLHILSAATWIGAALWVPGDVKRTVALGRPFVEQLAARA
FT                   RPALKLDLYAGVAVLVTGVLLIGVDGGHPRTGILVGFAATLARLLVVGFASMPAWRRVE
FT                   AAVASGELAAATAPARRLAMFGGMGHALWAIALAGMIF"
FT   gene            complement(340330..340833)
FT                   /locus_tag="A2cp1_0306"
FT   CDS_pept        complement(340330..340833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63665"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9W2"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0295"
FT                   /protein_id="ACL63665.1"
FT                   /translation="MTKFAWSVLALALLGAPAAARAGGLLELSVGSGARIDPSPTERIP
FT                   TNVMLTAGYGFADMLKLELGAVANLGDVEDSKFDIDLRPMLVVSPPLFPVYLRGIMTVN
FT                   SLVEEPVKIGYGGALGVRLGVMGLGAFVEAGVLARIVEVPDAAGVTHDKTFTIVEGRVG
FT                   GYWD"
FT   sig_peptide     complement(340765..340833)
FT                   /locus_tag="A2cp1_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 23"
FT   gene            complement(340968..342677)
FT                   /locus_tag="A2cp1_0307"
FT   CDS_pept        complement(340968..342677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0307"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /note="KEGG: ank:AnaeK_0296 NAD+ synthetase; TIGRFAM: NAD+
FT                   synthetase; PFAM: Nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase; NAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63666"
FT                   /db_xref="GOA:B8J9W3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9W3"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ACL63666.1"
FT                   /translation="MARSGRIALAQVNTTVGDFAGNAARVRAAAEVAREAGAALAVFPE
FT                   LTVCGYPPRDLLDLPDFLERARQALEELARPAAWSKGIALVVGFPEAPDGAPPPGVYNA
FT                   AALISDGRVVAVGRKSLLPTYDVFDETRYFLPAGASTTAAAPEGLGVPLGLSVCEDIWN
FT                   DQRFWERPRYARDPIADLVRAGAGLVVNVSASPYAMGKAPLRERMLSASARDHGAPIAY
FT                   VNQVGGNDALLFDGGSMLLARDGAVLARAPLFEEAVLVCDLEGGAPLALGLDGRPLPPP
FT                   PPPPADAQADEVLRALVMGVRDYVRKCGFRQAVVGLSGGIDSALTACIAAEALGAENVL
FT                   GVAMPSRYSSGHSREDAAELARNLGVRFREIGIEPMHAAFLAALAADGAPPLCDLADQN
FT                   VQARVRGQILMAISNDTGALVLTTGNKSEIAVGYCTLYGDMAGGLAAIGDVPKTLVYRV
FT                   ARAANARAGRTLVPERTFTKPPSAELKPGQLDQDSLPPYDVLDDILQAYVEERRPLEAI
FT                   VARGHDEAIVRRVLRMVVQSEYKRRQAAPVLKVSEKAFGEGRRFPIAQGYRY"
FT   gene            342706..343611
FT                   /locus_tag="A2cp1_0308"
FT   CDS_pept        342706..343611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0308"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: ank:AnaeK_0297 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63667"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9W4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACL63667.1"
FT                   /translation="MPRRILVAEASAPLLAPLRRPLRAAGVELDAISPAAASGRLGPAS
FT                   HVAAIVPGGAGGAEAVRAVRAADPLLPVIALFADEAEAAAAAQGEALGADGALVAPVGP
FT                   AAVVGACRLAERLRAATARAVEADARRLAAEAPRHAADLEFLKRLLPLEVKRSRRYGYP
FT                   VSVALVAVDRFAEVAGRLGPHGRAALMAEVLGLLAASVRDIDLAAPFTGERFVVLMPHT
FT                   RAEGALQVARRLCARIRERGAGEGITVSAGVAGHDGDGTVSFGGLVKRAAEALTRARAA
FT                   GGDRAEPAEPPRRRDRIVLG"
FT   gene            343616..344680
FT                   /locus_tag="A2cp1_0309"
FT   CDS_pept        343616..344680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0309"
FT                   /product="ABC-type Fe3+ transporter, periplasmic ligand
FT                   binding protein"
FT                   /note="KEGG: ank:AnaeK_0298 ABC-type Fe3+ transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63668"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9W5"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0298"
FT                   /protein_id="ACL63668.1"
FT                   /translation="MRRSLAAAAPALVVATALVAAGGLAACRRAAPALPEVRLHASPDL
FT                   PAEVVRDLAARFAVARVVLVPRAEEAEVAWASDPAALLALAPRLVPGSAAPEPATAQFA
FT                   DPQGRFAPVAARARVLLVARDARLPVDPTNLRDLADPRLRGRVALAHPARGAGPATCAA
FT                   LSLVYGEASLGRFLRLVAANAPVVVGSDAEVRAAVAAGRAAVGLAGSVDGAAGAASAAA
FT                   LRVVYPDQAGRGAVVLPTAAAALAPAAGGAPSPAAVRLVAWLAGADAERILVARAPGLL
FT                   PLRPEVPVPVGVEPAGNLRALPLDWDGLAAEAARLAPLLERWPDAFAGAGTGRGAAREA
FT                   AAPEGRPGRLEHAP"
FT   sig_peptide     343616..343678
FT                   /locus_tag="A2cp1_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.582 at
FT                   residue 21"
FT   gene            345036..345380
FT                   /locus_tag="A2cp1_0310"
FT   CDS_pept        345036..345380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0310"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: ank:AnaeK_0299
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63669"
FT                   /db_xref="GOA:B8J9W6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9W6"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACL63669.1"
FT                   /translation="MAQIDIEILTPFAAKFMEGTSLTPAERAEVLRIAQGFACKDSAAA
FT                   AGVSPETIRARRKRIYRKLDVPGSGELLASLLSLSLKMLAKGERIEPRPVAPAQPQQAA
FT                   ATTSSAVMAR"
FT   gene            complement(345512..347509)
FT                   /locus_tag="A2cp1_0311"
FT   CDS_pept        complement(345512..347509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0311"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase central region; KEGG: ank:AnaeK_0300
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63670"
FT                   /db_xref="GOA:B8J9W7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9W7"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ACL63670.1"
FT                   /translation="MPNARPELVEKAVNTIRMLAADGVQQANSGHPGMPMGAADMAFVL
FT                   WTRHLRFDPAEPRWLGRDRFLLSAGHGSMLLYSLLHLAGFDCALEDLKHFRQLHSRTPG
FT                   HPEYGFLPGVEITSGPLGQGFANGVGFALGHAMLAAKLGPGNPVSDAFVYAIVSDGDLM
FT                   EGVSAEAASFAGHHKLGRLVYLYDDNGITIDGKTSITFSGEDVTRRFEAYGWHVQSVDG
FT                   RDHDGIDRALQAAKAELGRPSLIRVHTTIGFGSPAKAGKSSVHGAPLGEAELEATKKAL
FT                   GWPLEPRFLVPDDVRAYWAEVRAEKAAQKQAWRAAEQAWRAANPEQAALLDAHVERWVP
FT                   ERILDRARAELPAPDATRKVSQAILQKIAPLVPCLVGGSADLAESNLTEIKGAGSVAPG
FT                   SFAGRNLHFGIREHAMGAIANGLAYDGLFVPFVGTFLQFADYMRPPVRLAALSKLQAVY
FT                   VWTHDSIFLGEDGPTHQPIEHLTALRAIPNLHVCRPADPEETAAAWAHALQRRDGPTAL
FT                   VLTRQKLAPVKRSVPLDPEAILRGGYLVDAPAGATFTLVATGSEVPLAQAALEALAKQG
FT                   VVGRLASIPCLECFLAQPKAWRDEVVPPGQRVAVVEAARGTEWWQLAGRDGLVLGIERF
FT                   GSSAPEKALAEEYGFTPAQVAARVTRWLAG"
FT   gene            complement(347601..348197)
FT                   /locus_tag="A2cp1_0312"
FT   CDS_pept        complement(347601..348197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63671"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9W8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0301"
FT                   /protein_id="ACL63671.1"
FT                   /translation="MASRLRRFLHLERPRDGAPAPDPAPGTADRAARFGAVQRPGVAPA
FT                   ETPATGARLERFGAEPEPALQLLDPGDRLPFTRCLRCGMDGHALAVECAGCGAALDTPE
FT                   QRAADERLRVERARQAEVEARAAAARREALAREEAGEAGSRRALAEALAREVGERERRR
FT                   LEAEGLGGGPGPLELGARVLRALGARWGRGGGGRG"
FT   gene            complement(348213..349751)
FT                   /locus_tag="A2cp1_0313"
FT   CDS_pept        complement(348213..349751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0313"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: ank:AnaeK_0302 AAA ATPase central domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63672"
FT                   /db_xref="GOA:B8J9W9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9W9"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACL63672.1"
FT                   /translation="MSASGAAPRPQPAFVQELDTLVRARYPLVYLVTSEEQRLEAILDG
FT                   LADRHGKALLGWSIARGFRRLGGTRGPAPEGAKDPLEALAAIEKLAEPALVVLKDFHPF
FT                   LADPAVVRGLRELGHALKSTYTTVLLLSPTLVIPPEIEKEISVLDVPLPGYRDLLDLLK
FT                   EIVGVVRQSGRAQVELNQDDADQLIQAALGLTLSEAESAFAKAIATDGRLSRDDVPLVL
FT                   EEKRQVIRKSGLLEYFATDARLAGVGGMASLKAWLGRRGAAFSEAARRFGLPEPKGLLL
FT                   LGVQGCGKSLTAKAIAAQWRLPLLRLDMGRIFSGLVGSSEENLRRAIRVAESVAPVVLW
FT                   VDEIEKGLSGTQSSGVSDGGVTARVFGALLTWLQEKTAPVFVVATANRIEQLPPELLRK
FT                   GRFDEIFFIDLPLAPERREIFQIHLARRRRDPARFDLHALAAASEGFSGAEIEQAVVSG
FT                   LYDAFAEGVDLAQGHVERAVRESLPLSTTMREDIARLREWARTRTRPASAPTAG"
FT   gene            complement(349791..350231)
FT                   /locus_tag="A2cp1_0314"
FT   CDS_pept        complement(349791..350231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0314"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: ank:AnaeK_0303
FT                   putative phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63673"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9X0"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACL63673.1"
FT                   /translation="MPPIRVYLVRHAKAEARAGDDADRRLTPDGRDGFAALVARLRGRL
FT                   AIRGVIASPYARARETAELLAAATGAPLEVDPRLAAGACGGAELLALARAAGDGAALVG
FT                   HNPEVAEAVALAAGRGLEVRPGTIAAVDLGAGSAALAWLEAP"
FT   gene            complement(350246..353269)
FT                   /locus_tag="A2cp1_0315"
FT   CDS_pept        complement(350246..353269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0315"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /note="KEGG: ank:AnaeK_0304 malto-oligosyltrehalose
FT                   synthase; TIGRFAM: malto-oligosyltrehalose synthase; PFAM:
FT                   alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63674"
FT                   /db_xref="GOA:B8J9X1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9X1"
FT                   /inference="protein motif:TFAM:TIGR02401"
FT                   /protein_id="ACL63674.1"
FT                   /translation="MGAAENGANAAKVEELLGALAEALARGEGVTPRPASTYRLQLHAG
FT                   FGFDAAAALVPYLDALGVSDLYLSPVLASAPGSTHGYDVVDHARLDPELGGEEGYARLA
FT                   AACRARGMGILLDYVPNHMGIGPWNAWWMDLLENGPSSVHAPAFDVDWTPLKSELANKV
FT                   LVPVLGDQFGRVLERGELRLAREGGALAIRYFDHVFPVAPRSVPLVLRHGIERLREALG
FT                   PEDPSLQELESICASLEKLAPRSETRPEAVAERAREKEVAKRRLAALCDASPAVRAFVD
FT                   ENVAAFNGTPGDPRSFDLLQRLLDAQAYRLAFWRVAGEEINYRRFFDVNALAALRMEEP
FT                   RVFAEAHRRVLALLRDGAATGLRIDHPDGLYAPAAYFRRLQACYLAERARALAQARGTA
FT                   LENGAEALLLERLFAELEAGRLPARPLYVVAEKVLAAGERLPEGWDVDGTTGYELLAAV
FT                   NGLFVDPAAERALDALYARVAGGRQDYRRTVEEKKRQVMSSSMASEINMLAHRLSRISE
FT                   TDRRTRDFTLNELTRALVEYVALFPVYRTYVTRRGEVDARDRAYVEATIARARRRSPLV
FT                   DPSIYDFLRDVFLQRYPDGLPEAARGAWLEFALKLQQVTGPVTAKAVEDTAFYCYVRLV
FT                   SLNEVGSDPGRFGTSADALHALLAERRARFPGSLSASSTHDTKRSEDVRARISALSEIP
FT                   GELRAAVSRWGRVNRAHVRRLEGRTAPDRRDEYLLYQTLLGTFPDGGLTPGTPAHAEYV
FT                   ERIQAYMEKALREAKIHTSWTHPDEDYEGGVRAFVAGALASRTFLRDLGALAERAARAG
FT                   RISSLAQVALKLAAPGIPDVYQGTELWDLSLVDPDNRRPVDWAHRARALEAIQAELARG
FT                   PEARRALARRLSAPDALAGGEAKLLLLAEGLRLRRRERALLLEGDHRPLAAEGPQAGHV
FT                   VAFARTLGGRAVACAVPRLVVRLQDQGGGAPRWEGRLPLGGLAARWVDVVTGTVHRGEA
FT                   PALAELFADFPVALLASE"
FT   gene            complement(353307..354866)
FT                   /locus_tag="A2cp1_0316"
FT   CDS_pept        complement(353307..354866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0316"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: ank:AnaeK_0305 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63675"
FT                   /db_xref="GOA:B8J9X2"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9X2"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ACL63675.1"
FT                   /translation="MARQAGVLLPLFSLRSQADWGVGEIPDLVPFARWCADAGFSLALL
FT                   LPVNEASRGQNSPYGAISAFALDPVYLAPSALPDFQAAGGLDALSPDERARLAAVRAAP
FT                   AVQWDEVRRLKRRALEIAFARFEREEWNRRTERARALEAFARQEAGWLDDYALFVALHD
FT                   EAGGRAWTDWPAPLRDRDPAALATARARHAREILFQAWVQWQAEEQWRRARAAANGAGV
FT                   ELGGDLPFMVAPDSADVWARRGDFRLDARVGVPPDAFSATGQDWGLPVYRWDVMDREGY
FT                   PWLTARARRMADLFDLYRVDHVVGLYRTYYFPNDGAPPAFVPSEEGAQIANGERVLGIF
FT                   SEGARVVAEDLGVVPDFVRASLERLRIPGYRVQRWEKNWEAGGNAFRDPARWPPVSVAT
FT                   TGTHDSESVADWYEGLAREERAQLLALPALEPLRARAPERWDDGVRDALLALVYGAASD
FT                   LALVPFQDALGMRDRVNVPGTVTGENWTFRIPMDLGALAADAATRTRLRELAVRAGRAP
FT                   PG"
FT   sig_peptide     complement(354810..354866)
FT                   /locus_tag="A2cp1_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.960 at
FT                   residue 19"
FT   gene            355006..355977
FT                   /locus_tag="A2cp1_0317"
FT   CDS_pept        355006..355977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0317"
FT                   /product="Glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="PFAM: glutamyl-tRNA synthetase class Ic; KEGG:
FT                   ank:AnaeK_0306 glutamate--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63676"
FT                   /db_xref="GOA:B8J9X3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9X3"
FT                   /inference="protein motif:PRIAM:6.1.1.17"
FT                   /protein_id="ACL63676.1"
FT                   /translation="MSSRGRFAPSPTGPLHLGNARTALLSWLAARTAGAAYVMRVEDLD
FT                   GPRVRPGLEARILEELRWLGLDWDEGPDVGGPLGPYRQSERLPRYGAALERLRAAGLAY
FT                   PCFCSRAEIAAASQAPHGASDEGPRYPGTCRELSPAEVARRAATRRPAWRLRVAAGPVA
FT                   FEDGVHGPVAHDVAAEVGDFVIARADGVPAYQLAVVVDDAAMQVGEVVRGDDLLPSTAR
FT                   QLLLYRALGVAPPRFAHVPLVVGPDGARLAKRHGALSLGELRARGADPRAVVALLAGLS
FT                   GLAAADPHAACTPRELVGRFSMARLPREPAVLSPERIAALLP"
FT   gene            355974..356567
FT                   /locus_tag="A2cp1_0318"
FT   CDS_pept        355974..356567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0318"
FT                   /product="tRNA-hydroxylase"
FT                   /note="PFAM: tRNA-hydroxylase; KEGG: ank:AnaeK_0307
FT                   tRNA-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63677"
FT                   /db_xref="GOA:B8J9X4"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9X4"
FT                   /inference="protein motif:PFAM:PF06175"
FT                   /protein_id="ACL63677.1"
FT                   /translation="MIAYTARVRLLRSPTDPRWIDVALAELDRTLQDHAHCEKKAAASA
FT                   LKLVADHPERAGMVRALAKLAQEELQHFLGVLAELGRRGTALPPDDGDPYAQALLRHVR
FT                   GGPRPEDRLVDRLLVAALIEARSCERLWLLAGALPEARLRELYARLAQSEAGHERLFVD
FT                   LAREVDAAADARLEVLAEEEARVVAALPLLPRIH"
FT   gene            356567..358690
FT                   /locus_tag="A2cp1_0319"
FT   CDS_pept        356567..358690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0319"
FT                   /product="histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; CHASE domain protein; KEGG: ank:AnaeK_0308
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63678"
FT                   /db_xref="GOA:B8J9X5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9X5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL63678.1"
FT                   /translation="MAPDASAPPAAPGPGDAPRPGRRAPWGGVAAAAAVLLLGGAVLQQ
FT                   HEVAEGRGRRRAVLERADLAARAIEDDLSRSLAAAHALAALVRHADVDRFEQIADELLS
FT                   HYGGISSLQLAPGGVLTRIHPLAGNEAALGLDLLADPEHRDSAERTLESRQLTAEGPFE
FT                   LRQGGQGVVGRIAVFRTAPGGGEAFWGFVAVAVRLPEVVSRTRVAALSAGGLDWALRRD
FT                   GAARPFASSGGALPRDAVAVKVRLPGEAWELDVAPREGWVRWGGLVMPAALLLLVAAAS
FT                   GLLAHRLLRLPEELRRAVDERTAALALANRRLAAELVERQRAEEARQAAEAQARHGQKM
FT                   EAVGLLAGGIAHDFNNLLTGILGYAELLGEAGTAADEAAAGIRQAARRGAALTRQLLGF
FT                   ARRGKYQQVPVNVHALVREVSALLERTLDKRIAIRHRLAAGSAVVRGDPDQLQQVVLNL
FT                   AVNARDAMPSGGTLTFEVAEVELDAEGTRARPGLAPGPHVAVTVADTGVGIPAVVRDRV
FT                   FDPFFTTKPAGQGTGMGLAMVYGIVQNHGGWVGFESEEGKGARFTVLLPEAPAPERDEA
FT                   VPAGAPEHGAGRVLVADDERGVRETTARLLRRLGYDALPAASMEEALEVQGRGALDLAL
FT                   VDLAMPAGDGPETLRALRRAQPELPAVLMTGYGLDARVREALEGGFRGILHKPFSLEEL
FT                   AAEVARAVRRRGA"
FT   gene            complement(358873..361587)
FT                   /locus_tag="A2cp1_0320"
FT   CDS_pept        complement(358873..361587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0320"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ank:AnaeK_0309 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63679"
FT                   /db_xref="GOA:B8J9X6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9X6"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL63679.1"
FT                   /translation="MLAPLVPLVPLAALALAAAPAAPPLELTSFSLPNGLTVVLAPDHR
FT                   LPQVAVDTWFQVGSKDEAPGRTGFAHLFEHLMFMGTNRVPGNRFDVIMESGGGSNNAST
FT                   SSDRTNYYSVGPSQLLPTLLWLDADRLQALADAMTQEKLDLQRGVVRNERRQSYENTPY
FT                   GAAELVVPEVMYPEGHPYHHPVIGSHADLEAATLEDVKGFFRTWYVPANATLVVAGDFR
FT                   PDEVRPLVEQLFGAVPLRAPPAPARAAPVRLEREVRRILSDRVELPKLILAWHAPAAYA
FT                   EGSAELELLADVLAEGPSSRLDRRLVQELRLAESVTAYLDPGRLGSLFRVEVTGTPGAD
FT                   LERVKREALAVLAALQAKGPEARELARVRAQAERRRREEREHLVHRADKLNEYLAYYGE
FT                   PDGFARDLARITSATAAGLRVAARGLGEGRLDLRVLPARAGSAKAEIPDAPPPPLAARP
FT                   FDPPAPEVFRLANGLEVRVAPRPGTGLFAAHLVLPGGAAAVPAEKAGLAPILAELLTSG
FT                   AGGRSAAEYADAIRALGASVEAEARPASLQVSVSGLSAHLAPALDLFADAVLRPNLARA
FT                   DFEREAALALARLEARPDDPRKVAPVVAAAAIFGRGDPRGRPVDGWAATVRTVTLDDVR
FT                   RLAPRLLDPRGATLVVAGDVDPAALRRLLAPRLGAWRGTGPAPAAAPAPLTTSPGGRVL
FT                   LVDRPGAPQTRILLARPVAPAAEPARALRELVNVVLGGSFTSRLNQNLREKHGYTYGAR
FT                   SAFETEGGQGLFTAGAAVQTEVTGAALVELRRELDGLAAAGVDAAETAKARETARHRTV
FT                   EEIQTTAGLADALAAAVLEGRPPDALRREAEALASVEPARAAAEARTGPYAFGGLTVVL
FT                   VGDRKAVLPQLEKAGVPRPVVVDPDGTPVPDPE"
FT   sig_peptide     complement(361534..361587)
FT                   /locus_tag="A2cp1_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.586 at
FT                   residue 18"
FT   gene            361772..363106
FT                   /locus_tag="A2cp1_0321"
FT   CDS_pept        361772..363106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0321"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   FAD-binding 8 domain protein; Ferric reductase domain
FT                   protein transmembrane component domain; KEGG:
FT                   ank:AnaeK_0310 oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63680"
FT                   /db_xref="GOA:B8J9X7"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9X7"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACL63680.1"
FT                   /translation="MRAVRLQDLTRVGLWIALYVLLALYPLLWLAAVPAPGGGGDLRQE
FT                   LAAALGYLGLSIMAMQFLLTARFQWLAPPFGTDVVYAFHRHVTAVALLFLLLHPLVLLG
FT                   PGLGGMAEWLVPWRAPGPVAAGVWSLYALLVLAVTSYGRRRLRLPYEAWRALHGVAATA
FT                   AVLLGLWHAAAARRLLAGPVTRVMWIAWTLAWVALLLRVRIAKPLALRARPYRVREVRP
FT                   ERGDAVTLVLDPEGHEGFRFRAGQFAWLTLGASPFAAREHPFSISGSSQRAPRVELTVK
FT                   ALGDFTRRVQATRPGARAWVDGPYGTMSVDAFPDADGYLFVAGGIGIAPCLSMLRTLAD
FT                   RGDRRPHQLVFGTGRWERTPFREALAELATRLDLTVVHVLEHPPDGWTGEVGVVGEDVL
FT                   RRHLPRGHRGCLVCGPPAMMDAVETALVRLGVPLRDIHSERFDLV"
FT   gene            complement(363201..363641)
FT                   /locus_tag="A2cp1_0322"
FT   CDS_pept        complement(363201..363641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63681"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9X8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0311"
FT                   /protein_id="ACL63681.1"
FT                   /translation="MNLWKLAPAALLALAAPALASAGEEGGCENCPAHKAHAEHGAKAV
FT                   PAAATAVAGAVKKGVRTIPVTVTSDGFTPAEVKAKTGETVKLVVTRKVQRTCATEIVMK
FT                   DFGVNQPLPLDQAVTVTVKPKAPGTYRFACGMDMIAGNLVVE"
FT   sig_peptide     complement(363573..363641)
FT                   /locus_tag="A2cp1_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.551 at
FT                   residue 23"
FT   gene            363887..365359
FT                   /locus_tag="A2cp1_0323"
FT   CDS_pept        363887..365359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0323"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ank:AnaeK_0312 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63682"
FT                   /db_xref="GOA:B8J9X9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9X9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL63682.1"
FT                   /translation="MMHATGTAKRLALGLGALVLLLAIASAAAIIGSARIHRGIAETMR
FT                   REEGVRLSLELASAVRDQYAHQAHTIIIGDGSHLGFYAESRDTVLRLTRALRQAADRPE
FT                   ERSLVDRIEAESGRLDRIFRDSIVPAVLRGERQSVQEEHGRAQLVVTHIQDLTQELVSR
FT                   FEAQIAQARAGADQAERRTLAVLVAILVAAPLVAAAVSLAIGRSIAVPVAQLQAGAARI
FT                   AEGDLDTRIEVRGAPELVSLARRWNEMTAAVRDHQEQLVRSEKLAGIGRLAAGVAHEIN
FT                   NPLGVILGYAKLLRKKADGALAEDLAVVEEEALRAKHIVDGLLDLSRPLPPPSEQVDLR
FT                   ALAEDVVARLREARLLEGVSAEVEGEASAPGHAEKLRQVLVNLVRNAGEASGPGGRVAV
FT                   RLRERDGVAELTVRDSGPGIPAAARGKMFEPFFTTKPRGTGLGLAVSRAIARAHGGELA
FT                   VAAAAEGGACFALTLPTAPAAARRRAAGGAKP"
FT   sig_peptide     363887..363973
FT                   /locus_tag="A2cp1_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.455 at
FT                   residue 29"
FT   gene            365356..366753
FT                   /locus_tag="A2cp1_0324"
FT   CDS_pept        365356..366753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0324"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: ank:AnaeK_0313
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63683"
FT                   /db_xref="GOA:B8J9Y0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Y0"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACL63683.1"
FT                   /translation="MTGGPVRVLVADDKENMRKLLAKILADGYAVEEAEDGARALSLVA
FT                   TRPYDVVVTDIRMPGADGFELLGAVKARAPDTEVVMMTGYATIADAVRAMRMGAFDYLE
FT                   KPFDPDAALAVVARAAEHKRLADAARRDDASGGEPSSFHNLVGRSARMRAVYGLLDKAA
FT                   GLDITVLLLGETGTGKELAARAIHYHSARRERRFVPVNCGALPAELVESELFGHARGAF
FT                   TGAAAAKAGLFEEAQGGSLFLDEVGELPLPAQVKLNRALQEREIRRVGDTQPLKVDVRV
FT                   IAATHRDLREEVRAGRFREDLFYRLHVFPVTLPPLRERAEDVPLLAQHFLAKHARALRR
FT                   ELAGGFDPEALRRLAGYPWPGNVRELENAVERAVAVSSGDRVRVADLPAEVAGAAPAGP
FT                   EPADLAKLPYKEAVAEARDRTSREYLVALLAEFGGNVTRAAERAGMERESLHRLLRRYG
FT                   LRSDDFK"
FT   gene            366835..367314
FT                   /locus_tag="A2cp1_0325"
FT   CDS_pept        366835..367314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0325"
FT                   /product="protein of unknown function DUF456"
FT                   /note="PFAM: protein of unknown function DUF456; KEGG:
FT                   ank:AnaeK_0314 protein of unknown function DUF456"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63684"
FT                   /db_xref="GOA:B8J9Y1"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Y1"
FT                   /inference="protein motif:PFAM:PF04306"
FT                   /protein_id="ACL63684.1"
FT                   /translation="MEILLYALGAAALVAGVAGVVLPVLPGSLLLVAGAVLVAWAGDFQ
FT                   RVGWGTVAVAAVLSVAIWAVDWLASVLGAKAFGASGWAVAGAGVGLLVGFFLGLPGIVL
FT                   GPAVGAIAFEYARNPDVKRALKAGVGAFLGFVLGSAVKVALAFAVVGAVALALIW"
FT   sig_peptide     366835..366936
FT                   /locus_tag="A2cp1_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.304 at
FT                   residue 34"
FT   gene            complement(367333..368028)
FT                   /locus_tag="A2cp1_0326"
FT   CDS_pept        complement(367333..368028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0326"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Fibronectin type III domain protein; KEGG:
FT                   ank:AnaeK_0315 fibronectin type III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63685"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Y2"
FT                   /inference="protein motif:PFAM:PF00041"
FT                   /protein_id="ACL63685.1"
FT                   /translation="MFGSRVAVLASVLAAALACERAAPRPGPSPASVAPAAAPRAPDPP
FT                   RDLDARAVTDRHVVLRWKPGAGATDGAAYEVLVGDRVLHAEAPPLDDRQVGPARAYCYA
FT                   VRAVDAAGNRSPASPAACVRTPDLVAPTPPGAPGASALGTESAMVSWSPSHDDVAVAGY
FT                   ELLRDGHVVARAGAAATDAVEAGLVPGREHCWSVRARDAAGNASAAAGPVCARTSDASR
FT                   AGRLGAPRP"
FT   sig_peptide     complement(367972..368028)
FT                   /locus_tag="A2cp1_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.559 at
FT                   residue 19"
FT   gene            368235..369383
FT                   /locus_tag="A2cp1_0327"
FT   CDS_pept        368235..369383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63686"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Y3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0316"
FT                   /protein_id="ACL63686.1"
FT                   /translation="MRRRPRLADPRAVALAVVGGLVALAPGARAAAPAPDAPLGAWTPG
FT                   PLRGLSLDMPLDDARGAPSPFVDVRWLAANAWSVPTVLERGGDRVVVRLDAQTDVLQAA
FT                   VAIPWPRAWAGALRERLATRVEARLLRTWGGWTDRPIEAWHGAIGSWNFQREVWARDAV
FT                   DVRLGREDGRGIGVAGPRTALGDVAVRTALRIAGDGAGGPGRLALALRLDVKLPTGAPS
FT                   RLGGSGSPDAGVGVAATWTPVRWLTGHGMASLRALGPLPRGAGLRLRPLQAGIEASLVA
FT                   RLGEGVAVVVEDRLLAPAFGSHGWTLSPEVERPQASAWYALFRAHNQVSAGLRVGELTV
FT                   YVSEDFTPGTQHARDARGGGQRWFYDSNAPDLALGVAWTRRL"
FT   sig_peptide     368235..368327
FT                   /locus_tag="A2cp1_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.790 at
FT                   residue 31"
FT   gene            complement(369378..370001)
FT                   /locus_tag="A2cp1_0328"
FT   CDS_pept        complement(369378..370001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63687"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Y4"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0317"
FT                   /protein_id="ACL63687.1"
FT                   /translation="MTETAETLGFGGLVLAAGPSVRMGEPKQLLLWRGEPLVHRAARAA
FT                   VEAGLWPVVVVVGACAEEVRAALAGLPVATVLNRDHAAGVSGSLRRGLARLGECAPSLA
FT                   GAVILACDQPGVDAAHVAALAGALRVSGRPVAASTDGGALLVPALFSAALFPELRALDG
FT                   DEGAERLLSRDPARVAPVPLAHGGCHVDTPEDWRRARLMGGAGS"
FT   gene            370248..371231
FT                   /locus_tag="A2cp1_0329"
FT   CDS_pept        370248..371231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0329"
FT                   /product="protein of unknown function DUF1028"
FT                   /note="PFAM: protein of unknown function DUF1028;
FT                   Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   ank:AnaeK_0318 protein of unknown function DUF1028"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63688"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Y5"
FT                   /inference="protein motif:PFAM:PF06267"
FT                   /protein_id="ACL63688.1"
FT                   /translation="MSHPPACRLVLALACALAAGAARGGTPREPVATFSIAGRDPTTGE
FT                   LGVAVASRFFAVGTVVPWARAGVGAVATQAFCNTSYGPRGLDLLAKGATPAEALEILLR
FT                   SDPERDLRQVGIVSAGGASVTYTGKGTNAWAGGRSGPDYAIQGNILTGEAVVAAMERAF
FT                   VAGKGSLADRLYAALAAGDAAGGDSRGRQSAALLVVKEGAGYGGFDDREIDVRVDDHPR
FT                   PFEELKRLLDYAQMNAAWNEGWTAFRRKQFPAALAAQERAAARAPGNGEVLYDLAVIRL
FT                   AAGQRPGALEALRRALEANPKLAAQARTDADLAALRGDAGFEKLVR"
FT   sig_peptide     370248..370322
FT                   /locus_tag="A2cp1_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.924 at
FT                   residue 25"
FT   gene            371231..372415
FT                   /locus_tag="A2cp1_0330"
FT   CDS_pept        371231..372415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0330"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: ank:AnaeK_0319 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63689"
FT                   /db_xref="GOA:B8J9Y6"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Y6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL63689.1"
FT                   /translation="MSAATRRAVAGALALAAAMGIGRFAYTALLPGVQHGLGFDDAAGG
FT                   AIASANLVGYLAGVLWARRLAGSPRRGAALRLGPAATAVLTAAVTGVGSEAGWAAVRFG
FT                   SGVASGLVFVLASAAALEVPPDHLPRPLPRPGVLYGGVGVGIALAAVVAALAPPGGGWR
FT                   VPWWALGGAAAALAAPAWSVLSGPLANDSGSGGGVAAGRGRAPVGFGRLATAYFLEGLG
FT                   YIVSGTFAVAAVRRTPGLEGLAPWTWALAGLAAAPSALLWAALGRRVGVRSALITAHLV
FT                   QAAGMALPSLSSAAWAALAGAALFGGTFIGITTLTVAAAREIRPQALGRAVGTLTAIYG
FT                   VGQIVGPLAAGAVAQRLGDPRPAVLGASAAVAIGALVLLIPSRASLASRTEPNA"
FT   sig_peptide     371231..371314
FT                   /locus_tag="A2cp1_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.515 at
FT                   residue 28"
FT   gene            complement(372434..373327)
FT                   /locus_tag="A2cp1_0331"
FT   CDS_pept        complement(372434..373327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0331"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="KEGG: ank:AnaeK_0320 protein of unknown function
FT                   DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63690"
FT                   /db_xref="GOA:B8J9Y7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Y7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0320"
FT                   /protein_id="ACL63690.1"
FT                   /translation="MTAPRQILSGVTYHVTRRCAQRELLLRPSEMVNETFLYVLGVALR
FT                   RYGLLLHGFCVLSNHFHLVVTDPGARLPAFEQYLDSLVARSLNAALGRWEAFWASGSYS
FT                   AVTLATPEDVIDRLAYALANPVAAGLVPTASEWPGLWSSPERIGGEKFVARRPEHFFRP
FT                   GGSMPESVELQLTLPPGFDDVQQFRECLAQALADREQLAAERMRAEGRSFLGVRRVLAQ
FT                   KPTARPASVAPRRGVRPRVGARDKWKRIEALGRLRSFLNEYREALKALRAGLRDVVFPN
FT                   GTYWLRVAHGVRCAPG"
FT   gene            373463..373666
FT                   /locus_tag="A2cp1_0332"
FT   CDS_pept        373463..373666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0332"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: ank:AnaeK_0321
FT                   4-oxalocrotonate tautomerase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63691"
FT                   /db_xref="GOA:B8J9Y8"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Y8"
FT                   /inference="protein motif:TFAM:TIGR00013"
FT                   /protein_id="ACL63691.1"
FT                   /translation="MPYVNIKITREGATAEQKATLIRKVTELLRDELGKNPSTTVVVID
FT                   EVDTDNWGIGGESVTVRRKRGS"
FT   gene            373713..374492
FT                   /locus_tag="A2cp1_0333"
FT   CDS_pept        373713..374492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63692"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Y9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0322"
FT                   /protein_id="ACL63692.1"
FT                   /translation="MQPWETVERARAPDGTALALARRGDEWVIRAAGHVLMSSRAHGSE
FT                   EALAALALERCARPRAVLLGGVGLGFTLRALLDRLPPDAKVVVAELVPELAAWNRGPVA
FT                   DLAARPLDDPRVRLQLGDVLARIAEARGAYDAILLDVDNGPSALAHGANHRLYGEAGIR
FT                   ACRAALRQGGVLAVWSAGPDERYLARLERAGLDARAVTVPARGPATQGGGGGGVRHVVF
FT                   LATAPAQGGGARRPGSPSRDGGAGRRPGPHARGARGR"
FT   gene            complement(374465..375436)
FT                   /locus_tag="A2cp1_0334"
FT   CDS_pept        complement(374465..375436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0334"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ank:AnaeK_0323 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63693"
FT                   /db_xref="GOA:B8J9Z0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Z0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL63693.1"
FT                   /translation="MAITRLPPHPFSLRQLQYAVAVAETLSFRRAAERCRVAQPSLSTQ
FT                   IAQLESALGLRLFERDRRRVLVTGAGRPLLEQMRRLLLQADDLLEAARRAGDPLAGALR
FT                   VGVIPTISPYLLPAIAPALRAAYPALHLTWLEDRTAELVRSLHAGTLDAALLAVEAELG
FT                   DVEVAPVARDAFVLATPPGHPLGVAREPASAAELRDASVLLLEDGHCLREQALAFCSRA
FT                   RTRELEFRATSLSTLAQMVAGGAGVTLLPELAVPTETRRADLRLRPFADPAPFRTVALV
FT                   WRRSSPIAEALRRLAGTVKAAYPAPAGRAAGSERQRPRAPRA"
FT   gene            375553..376089
FT                   /locus_tag="A2cp1_0335"
FT   CDS_pept        375553..376089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0335"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ank:AnaeK_0324 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63694"
FT                   /db_xref="GOA:B8J9Z1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Z1"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACL63694.1"
FT                   /translation="MLTVGDRFPEFSLQAVTSLESGNEFETLTQASHPGKWKVVFLWPM
FT                   DFTFICPTEIAEFGRRNGEFQDRDTQVLGASIDTHYVHLAWRKSHPDLKHLPFPMLADT
FT                   RRELSSALGVLHRDGVALRATFIVDPEGVIRHVSVNDLSVGRNVDEVLRTLDALQTDEL
FT                   CPCNWKKGESTLQVA"
FT   gene            376093..376653
FT                   /locus_tag="A2cp1_0336"
FT   CDS_pept        376093..376653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0336"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   ank:AnaeK_0325 alkylhydroperoxidase like protein, AhpD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63695"
FT                   /db_xref="GOA:B8J9Z2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004674"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8J9Z2"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACL63695.1"
FT                   /translation="MAALDAIREALPEPARDIKLNLQAVLQPGTLTPAQRWGVAVATAA
FT                   AARNERLLAAALADARAEVEPAVIEDALAAAAVMAMNNVYYRFRHMVGKASYAEKPARL
FT                   RMNRLVKPAASKVDFELFALAVSAVNGCETCVRSHEQVVVAGGLSEDQVHEAVRIAAVL
FT                   HAAAVSLELAGYAAVPSAAAAAG"
FT   gene            complement(376655..378598)
FT                   /locus_tag="A2cp1_0337"
FT   CDS_pept        complement(376655..378598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0337"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain; KEGG:
FT                   ank:AnaeK_0326 transcriptional regulator, SARP family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63696"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Z3"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ACL63696.1"
FT                   /translation="MPASPNWTLHLLGAPRLAGATEPVRLDRRTAALLALLAIDGPQPR
FT                   SRAAGLLWPDSPEKTARANLRQLLRRLREAAAGDLVGAGDPLELSPRVTVDARDPTRPD
FT                   AAWPDGRLLDGVDLDEAPELSEWLAGARRSLDAARLDAALAAAARLEAAGQLGAALAQA
FT                   QRALALEPLSEEAHRLEIRLRYLGGDRAAALAAYERCRAALRDALGVEPSPETVRLAEE
FT                   VARGRRVPARAGSPAALPLSVTRPPALAGREREWALMEEAWAAGKGIALGGAPGVGKSR
FT                   LMQDFLSTHARPLFFEGRPGDRAVPYGTHARTFRETLGALASAGVALPPWVRTELARML
FT                   PELGPSPGPLATEADRVRFWNAKLEAMRVAFRAGFDALGFDDTQFVDPASAAAGAYVLE
FT                   QLLRDAETPLRTVHCFRTAEMAPEVLAHIRALAEAGRALYLELEPLADDAVEELVRSLD
FT                   VPGIERVAAEVARYAGGSPLFALETVKHLVETGAVERGIPDRTPPRLEALLRARFERLS
FT                   APALQLARALGVLGTDFTLERAAAVVEARAMDVAVGWSELEAAQLVRGAAFGHDLLAEA
FT                   VVAATPAPLRGFLHGRAAEVLAATGGAPGRIAAHWERAGDPVRADACRREAESVARATL
FT                   LATEAAGYFRAA"
FT   gene            379035..380060
FT                   /locus_tag="A2cp1_0338"
FT   CDS_pept        379035..380060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0338"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; PAS fold-4 domain
FT                   protein; KEGG: ank:AnaeK_0327 transcriptional regulator,
FT                   LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63697"
FT                   /db_xref="GOA:B8J9Z4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Z4"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACL63697.1"
FT                   /translation="MIRSPEAHPCRALPAQGATPARRSLLRLISADAPDASASAGRAPA
FT                   GPAPAAVARAIADAERRPLAWVDRDGVLRLVNAAFAALLGAEPATLEGRSACDLLCADA
FT                   PGRAQALLRAAFRGALHRTDLTALRGGREYGLKVELAAVGRGASAALCIDVHEVVERAP
FT                   PPVACGAAGDLDYRISAGASDFGRLLALSGAGAEAALRVGRRCHEVLHGRPSPCPGCPA
FT                   LRGGGEAWPRVEVRRAARTRGFEVATATALPGDEVLVAVRRVDDAALAAVREARTAELV
FT                   RRFELSPREEEVLRLLLIGRQAADIGTALGITPRTAKFHQSNVLRKLGASSRRDLLGLA
FT                   S"
FT   gene            380057..380914
FT                   /locus_tag="A2cp1_0339"
FT   CDS_pept        380057..380914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0339"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: ank:AnaeK_0328
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63698"
FT                   /db_xref="GOA:B8J9Z5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Z5"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACL63698.1"
FT                   /translation="MTRARTEPDWGAVALAMLERGREPAAWVDAGGTVRLATASLERLL
FT                   GASPRALEGRPVAAVLAGAPAPAEGRVEREVTTAAGRRLRVALEPGCEPAAEPGALLRV
FT                   LEVLGDLPGLGAGELDYAIETGPGAFGRLAWVRPLGGAALDPVPEARCHEALHGRSEPC
FT                   SDCPVRGGGTWPRVHARTLAPAPGYEVVTAAPEGAERVRLTVRRLAEAAVHGLVEARAR
FT                   ALARGAGLSEREEAVLNRLLQAEGLADIGRALGITLRTVKFHQANLLRKLGAESRADLA
FT                   RVLM"
FT   gene            381030..381809
FT                   /locus_tag="A2cp1_0340"
FT   CDS_pept        381030..381809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0340"
FT                   /product="split soret cytochrome c precursor"
FT                   /note="KEGG: ank:AnaeK_0329 split soret cytochrome c
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63699"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Z6"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0329"
FT                   /protein_id="ACL63699.1"
FT                   /translation="MHDDSIGRRGWIKLVGGAAGAGAALVVARQAGAAPPAAGKGMQAV
FT                   PWPYAPLDPDATAERAFKGYLEGHCMYGAFDALAGQVADKLGAPYTSFPTRMFTYGAGG
FT                   VAGWATLCGALNGAAAAFQLLSAKPEPLVDALFRQYEQAALPDWVPASAKFPNVKSVAG
FT                   SPLCHASISAWCKASGKKAYSPERKERCGVLTASVARHAAIILNAQHAGKAFPVLEDKA
FT                   TAECASCHEKGGTLENTRAKMACGGCHFNLGTKHPAI"
FT   sig_peptide     381030..381131
FT                   /locus_tag="A2cp1_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.935 at
FT                   residue 34"
FT   gene            381833..382966
FT                   /locus_tag="A2cp1_0341"
FT   CDS_pept        381833..382966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0341"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="PFAM: phosphate-selective porin O and P; KEGG:
FT                   ank:AnaeK_0330 phosphate-selective porin O and P"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63700"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Z7"
FT                   /inference="protein motif:PFAM:PF07396"
FT                   /protein_id="ACL63700.1"
FT                   /translation="MTLTPFLIALSLAQTTPAADPAAAAAQPAPAPVKAAPTLAGALAN
FT                   APKPTFWGFVNAQYSRTEGLNGADDTSTFELRRARIGARGKVHELVGYSILFDGADSKL
FT                   KDGYVSLFALPGVEVRMGQWKTPFGYEQYESDTKLLWVNTSYVVGALARGPDARDLGAG
FT                   LLVQTPKAGPVSAEVLGSFVNGAGPNKKDDLETKNFWGRAGLTLKQGAITLKAGGSYGT
FT                   GQQLQGTGGNGAFDGVGTPVDDTYFYFHTYGVDATLDTPWLFAAAELIQSERDQSRYAT
FT                   AAAVTTVTRSSRTARGWYAGAYGKTPWNLGPIFRAERFDADRTAPGGRLERYTIGAYVD
FT                   VIPVNARLILNHELDQGQTGAAGRTGDRTTLFAQVIF"
FT   sig_peptide     381833..381913
FT                   /locus_tag="A2cp1_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.516 at
FT                   residue 27"
FT   gene            complement(382956..383726)
FT                   /locus_tag="A2cp1_0342"
FT   CDS_pept        complement(382956..383726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0342"
FT                   /product="BioH protein, putative"
FT                   /note="KEGG: ank:AnaeK_0331 BioH protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63701"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Z8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0331"
FT                   /protein_id="ACL63701.1"
FT                   /translation="MTASDGPLLTLLLPGLDGTGRLLDRFVAAASGRLELRALSYPPDR
FT                   ALSYAELAELVRAELPRGRRFALVGESFGGPLALRVAAGRPPGLVGVVLAASFHRRPAA
FT                   RLVSALRPLSPAFFRLPLPAHAVRVLLAGHDAPDALVADVQAAVASVRPRVMARRAHEA
FT                   LHVDATGWLRDCPAPVLFLGGRQDRLLRTGLAIEIRLVRPDAEIRMLDAPHLVLQRRPA
FT                   EAMRAVEAFLGRSPAATAPMRAAPADEPEISARR"
FT   gene            383935..384768
FT                   /locus_tag="A2cp1_0343"
FT   CDS_pept        383935..384768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63702"
FT                   /db_xref="UniProtKB/TrEMBL:B8J9Z9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0332"
FT                   /protein_id="ACL63702.1"
FT                   /translation="MIGWITVLALAATVALVGVRRARFAREVAAEARSLWALREDAPPA
FT                   RLDPGALPAPVRRYLEVAGALEATPLAAARLRHGGSFRPALDGAWRPIRGVQYLAAEPP
FT                   GFVWWGRVRLAPGVEVAARDRSAGGEGGMRIALASALVMADLSGPELDAGALQRLLAEL
FT                   VWLPTALLDARHVAWLPRDASSARARLRVGGREVEVTFHFGGDGLPERITALRYRDVKG
FT                   RGVLTPWTGRCADWRQVGGVRVPFRLEASWELDGRDQPYARFEVERLEHGVPQPF"
FT   sig_peptide     383935..384012
FT                   /locus_tag="A2cp1_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.876 at
FT                   residue 26"
FT   gene            384969..387260
FT                   /locus_tag="A2cp1_0344"
FT   CDS_pept        384969..387260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0344"
FT                   /product="M6 family metalloprotease domain protein"
FT                   /note="TIGRFAM: M6 family metalloprotease domain protein;
FT                   PFAM: peptidase M6 immune inhibitor A; KEGG: ank:AnaeK_0333
FT                   M6 family metalloprotease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63703"
FT                   /db_xref="GOA:B8JA00"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA00"
FT                   /inference="protein motif:TFAM:TIGR03296"
FT                   /protein_id="ACL63703.1"
FT                   /translation="MRTSRTTTLALLAALALAPSAAFAASDEPQLPDVAATTDNPSHPL
FT                   GDAQAARKAIAIQAKLSGKTKGKTHQVARGQYVELERQGEDRIWTVVGEFGEQVNPTYG
FT                   GTAGPLRNQIPEPDRTVDNVTIWAPDFSRAYYEDLLFSDAPGDVSMRNFYKELSSNRYT
FT                   VNGEVTDWVKVPLNEANYGSNYCGGIVCARTWLFVRDAVNAWYNGQIAAGRTVAEINAY
FT                   LAQYDVWDRYDYDGDGNFNEPDGYIDHFQAIHAGEGEETGGGAQGDDAIWSHRWYAFYN
FT                   NIGATGPAFNRYGGIRIGASDFWIGDYTIEPENGGVGVFAHEFGHDLGLPDLYDTSGNT
FT                   GGAENSTGFWTLYSVGSYGASGRPEDGLGTKPIHMSAYEKIFLGWSNYQVVRAGQYASL
FT                   KLGPAEANTKQAQTLVVLLPDKIVESEIGTPYAGTYFYHSGSGNGLDHSMTRQVTLPAG
FT                   ASLAAKVKFDIELDWDYAYLTVNGAPVATNLSSSTNPNGQNFGNGITGSTGGAWVDLTA
FT                   DLSAWAGQTVTLGFRYWTDVAVAEAGLSIDDVAISGQPLDGAETDPGWTYDGFVRTNGT
FT                   LATPFFNAYFAEYRQYRGYDQSLKTGPYTFGYLNDPTLQNWVDHFPYQDGLLVWYYDTS
FT                   FEDNNVGDACASGRCGGLFLPVDAHPGLILRPDNGKAWRPRFQAFDSTFGLEPTDVVCL
FT                   HANSQQGCFGGQPGNPLFDDTQSYWVPPDPSLNHSGWSSVIVPNTGTTIRVVGTSAQGD
FT                   FMQVVVAPKR"
FT   sig_peptide     384969..385043
FT                   /locus_tag="A2cp1_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            complement(387329..388504)
FT                   /locus_tag="A2cp1_0345"
FT   CDS_pept        complement(387329..388504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63704"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA01"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0334"
FT                   /protein_id="ACL63704.1"
FT                   /translation="MTADRVYVATAAGLAILGRDATGAPASATSVARPCPAGETSILDV
FT                   AVSGQSVWVVSGQRYWSGSTDAFCASADGGTTFAPRWFVAPDRGNAIASTVYAEGARVY
FT                   VGYAPGFFLSTDAGATFRSAELPAGGVRDVAAAGGSLYAGLDAGVAVSTDGFRTFVLRT
FT                   EADGLANPGVVDLAAVGTRVYAVTSFGLSISSDGGAHFAPPATLTNASMAACVAAPDAS
FT                   TVYLGQKSWLQVSTDGGAHFAQRLPPVGSTSYLSDTVGVDARGATVAVAARDTVFVSTD
FT                   GGASFAERGAAAGLVAPSGYTLSLRGVAVAPSGAIHVASNVGLFSSTDGGATFTAAGGG
FT                   PAWLEAVSAGGPALYLGGDLLHVSTDGGATFVSRGAPDGLPGRPGPAVYVP"
FT   gene            complement(388501..390408)
FT                   /locus_tag="A2cp1_0346"
FT   CDS_pept        complement(388501..390408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63705"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA02"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0334"
FT                   /protein_id="ACL63705.1"
FT                   /translation="MHRTAALHPVAVALASALALAGCSGGGGAAGPGGSSCALPAATSL
FT                   QVVESAPGQGADGVSVNAAVRIRFNTCVDTPTLAGAVSFRRGTTAIPFTQAYDAATATL
FT                   VLTPAAPLALSTSYVVMVLPTARGARGEPFSGWVLGFYTRDAPDTAPPTIAADPAGGHF
FT                   NHPVDVVLTCADEPGGSGCAQTVFAVNGGAPHPYVGLVRLEASATLTFFALDGEGNRSA
FT                   TGTGTYVIDVDPPGVASVFPPDGATGVALDAVPAAAFDEDMDPATVTAARLTLAPAQAT
FT                   GAAYEPATRTARFPPDRRLECGTTYTATLDPSVTDLAGNGLPAAVALTFTTDPDCVEPV
FT                   TTASVTDGVYAAPQQVTLTCTDAGGSGCARVVYTTDGSVPAPGSGTVVEGAVAGPIAVG
FT                   EGETVLRYYSVDRAGNREAVRQQRYSVSTSGFTYVATTGGLARGAGVVPARFVALGGAG
FT                   WTSAFHRDPVTGRLWRATERGVAGSDDGAAWSLTRLPSASGGRMLPARAVWGQGSLVLA
FT                   GTEEGLFRSVDGGATFVPLLQRTVDGYDAWVTAIAGDGKDVYVATSLGLAVSHDRARTF
FT                   AWTIADRAVADWSSTPTPATCSPRPRPACSAPPTAARRSRGSTPAPSPPSPPATSAPSR
FT                   "
FT   sig_peptide     complement(390319..390408)
FT                   /locus_tag="A2cp1_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.745 at
FT                   residue 30"
FT   gene            390533..393169
FT                   /locus_tag="A2cp1_0347"
FT   CDS_pept        390533..393169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0347"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: ank:AnaeK_0335 peptidase M1 membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63706"
FT                   /db_xref="GOA:B8JA03"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA03"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ACL63706.1"
FT                   /translation="MPIPALALTVAALAAAAAGDPAPRPPPLPAGEVPPALRLPAGVRP
FT                   IRGEVSLTLDPAAERYRGRVRYPVVLDAPARVVWLHAEGLEIEEAKVGGRPARAVPAAG
FT                   GLLGLVPDAPQPPGEATVEIAFAGTIDRVRSRGVYAAAEEGRWYAYTFFEPADARRAFP
FT                   CFDEPSFKIPWRLSLTVKRGDRAVANTPALREAPDGGGTRVEFAETRPLPSYLVAFVVG
FT                   PFDVVEAGAGGAARVPVRFVVPRGRGGETRYAASITARLLDLIEAETGVPYPYEKCDVA
FT                   VVPRFWGTMEHPGIVALGQPLTLIPPIAETRERRLRYASIAAHELVHHWFGDLVTMAWW
FT                   DDTWLNESLTSFVDPVITDALEPAWRRTARARAEGRASALAADALAAVKRLREPVGSRH
FT                   EIEGAFDNAITYDKGAAVAAMYERFLGRAAWRAVLRDHLLAHADRTAASEDFLATLAAR
FT                   STPAVAASLRGFLERPGVPLVRASVRCDGRGAAAVVRQERFLASGAPDPAATWAIPLCV
FT                   RAGAGARVETACALVGGDGPEGELPLPFCPEWLWPNAGGTGYHLTALDAAALPGLWPHL
FT                   APAERLALATDASLLARRGDLPVEAALGRVGPLAASEDRLQVEASLALARLAQPEWLGP
FT                   DDHARWRAFLRETWGPRARSLGWMPRRGEPDDTAALRRLVVPAVADEGEDAALAGEAAA
FT                   LARRWLADRRSVPAEAAWPALEVAARTGDAALFDRILAAARASRDRTVRARLLAFLGRF
FT                   ERPALADRALGLVASGEEDLRDTSGILRAALAGRETRWRAWALLRGRWDALAPRLRSDE
FT                   ASWLVAQAAGLACDPGRAAEVAAFLRPRAEAFDGAPAALARALEEAGACRAARARNGPA
FT                   VARFLAR"
FT   sig_peptide     390533..390592
FT                   /locus_tag="A2cp1_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.667 at
FT                   residue 20"
FT   gene            complement(393395..393817)
FT                   /locus_tag="A2cp1_0348"
FT   CDS_pept        complement(393395..393817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0348"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B; KEGG: ank:AnaeK_0336
FT                   methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63707"
FT                   /db_xref="GOA:B8JA04"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA04"
FT                   /inference="protein motif:TFAM:TIGR00357"
FT                   /protein_id="ACL63707.1"
FT                   /translation="MDKLILSDAEWRARLTPEQYQVLRGHGTEPPGTGCFLGTHEPGTY
FT                   VCAGCGNPLFRSGEKFESGTGWPSFTRPVSPDAVVEVHDRSYGMRRTEVRCARCDGHLG
FT                   HVFPDGPPPTGLRYCMNSAAMRHVAEGAPLDPPGAG"
FT   gene            complement(393946..395571)
FT                   /locus_tag="A2cp1_0349"
FT   CDS_pept        complement(393946..395571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0349"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; 4-vinyl reductase 4VR;
FT                   Activator of aromatic catabolism; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   ank:AnaeK_0337 putative sigma54 specific transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63708"
FT                   /db_xref="GOA:B8JA05"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA05"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACL63708.1"
FT                   /translation="MRIEDLDLREILSFDPRGGVIRFMGQRVVLFDAVALGLLRKELTN
FT                   AFGTFAARGVLTRFGYAHGWRVGEALEHEHPDLWKEGKAGPFLPPLKGQFILGENVRTD
FT                   GLGDAPLVETVWHRSYEAEQHLLHIGLSDEPVCWTSAAFASGYLSYKERREVYVIEDRC
FT                   VGKGDSECHIAARFKERWGPELERHLPYYHMESIDHALQEVSSKLRRTERRLRERQAEL
FT                   ERLATCSDQDTGLVARSEAMRRVLERARSVARTGSSVVVTGESGVGKEEVARLVHRSSE
FT                   RAGGPFVAVNCGAIPETLLERELFGHVKGAFTGAETDAVGLFEAADGGTLFLDEVGEVS
FT                   PAMQVKLLRALQEREVRPVGDSRSRKVDVRIVAATNRDLAVEVASGRFRQDLFYRLNVI
FT                   ELRVPPLRDRPDDVVPLARCFLAKLSRSAHRPVTGFTAQVADLLVRYPWPGNVRELQNA
FT                   VEYAVALSAGNQVGVDDLPEALRHAPPAPARPGVIRPLHEVEREHVLAALRTAGGNKVA
FT                   TAAGLHIGLATLYRKLKEYGEPAP"
FT   gene            396057..397352
FT                   /locus_tag="A2cp1_0350"
FT   CDS_pept        396057..397352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0350"
FT                   /product="porin"
FT                   /note="KEGG: ank:AnaeK_0338 porin"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63709"
FT                   /db_xref="GOA:B8JA06"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA06"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0338"
FT                   /protein_id="ACL63709.1"
FT                   /translation="MNMTHRRSLALLAALLLPAAASALEGDVTLYGTLMPFFDNARVSD
FT                   PTRPGLSPATGGATQVSDAAYTGVAIPQRFRLTSGTSNIGFKGGFDVLGEDLQVFFQVE
FT                   SAVSPDGDAPNAWASRNSAVGVKGKFGRAFFGNWDTPYKYPVLLVGAVRGLNPFDNTIT
FT                   ANPGFGVPGTTTQSGRVNGKADAAFNRRQGNSVQYWTPELYGFSARLAYSANESRTVAS
FT                   ATAPSISPTISSGLVSWAYGPLLLRYAYERHQDYFGLSQLGGSPVSLTNRSSTDQGHEA
FT                   IAQLALPTGTRVSLVGERLSYENEDRAVGAVREYARLAYYALLQQRFGAHQVFGSFGQS
FT                   DAGECKVVGGGACTVNGLGATQWNAGYSYALTKAADVYVAYYETRNDRSASYGVVGGPG
FT                   AVAPGGDTRGFGLGLLYTFAATANVGAPKGSP"
FT   sig_peptide     396057..396128
FT                   /locus_tag="A2cp1_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.874 at
FT                   residue 24"
FT   gene            397809..398300
FT                   /locus_tag="A2cp1_0351"
FT   CDS_pept        397809..398300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0351"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   ank:AnaeK_0339 protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63710"
FT                   /db_xref="GOA:B8JA07"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA07"
FT                   /inference="protein motif:PFAM:PF01883"
FT                   /protein_id="ACL63710.1"
FT                   /translation="MSPGPEPRSRASRALEWIFAALLLGASSAILIAAAVSRADTHYAW
FT                   IRPAGDPARGDVTAAQVRERLHEVLDPELGIDVVDLGLVYEIAEPREGKVALVMTLTVP
FT                   GCPFAKQLVEDVRRALFAHPGVKEVSLTVTLDPPWSWERVAPEVRKRMIEHGAGAEERS
FT                   "
FT   sig_peptide     397809..397928
FT                   /locus_tag="A2cp1_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.492 at
FT                   residue 40"
FT   gene            398297..398926
FT                   /locus_tag="A2cp1_0352"
FT   CDS_pept        398297..398926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63711"
FT                   /db_xref="GOA:B8JA08"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA08"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0340"
FT                   /protein_id="ACL63711.1"
FT                   /translation="MTLLGPLSSGFLLGLGTGPLCFIGCIPLALPFALPGPDAGPGSRR
FT                   GGWGFLLKFLAGRLVAYSTVGVLTGLASSLAGPLRRWVTPVWLALSLVLILHGLGRGLG
FT                   HRGLCGATTRLVRSRAFPFLLGLAAALSVCPPFLLAVAYAMDRSGQVLGGVAFFLAFFV
FT                   ATTLYVLPIAMLGYLPRRELWQRVGRVASVIAGAALLAQGLRELLA"
FT   gene            399067..400989
FT                   /locus_tag="A2cp1_0353"
FT   CDS_pept        399067..400989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0353"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: ank:AnaeK_0341 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63712"
FT                   /db_xref="GOA:B8JA09"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA09"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0341"
FT                   /protein_id="ACL63712.1"
FT                   /translation="MTKTDRYVLWGIGAVWALDLATFILTDFHIYAFLALFVIAALGFA
FT                   WWGLRFQVTEPMRRNAALGVTGFWTVAMALLFAPWPIPDKPEYIVGEVHRFSEMEHGFS
FT                   RVLTGVTGPNIAAGGLVYGDPADQQSMMTEWGWPPNFISGYPLARALFGGTILMERLRG
FT                   ATTIGGEPANPLRYSWSNFQGEKRDKKLGWNKGDLLLGEVAKAMGSAKATYTPHENTLM
FT                   VKSIASWLGSPRIAIAAVDPRWFYSHDLSTYGTPLPLKDAKDLKYVIQIFTDQDWTRIH
FT                   NDAGTSWWSVSNSGQAYSTSAWIGIRMAQMLRDMGYVARVGFGGMNYENIETPASVYSG
FT                   IGEYGRLSDAVVPTAGGLRFKSATIFTDFPLEAGDPKQGWGITRMCANCDRCARACPVN
FT                   SVPMGEPTVENGVKIWQVDKDKCTRFRTGNLNGNMCGACLAVCPYNKPDTAFHRVGNYI
FT                   IRHSPIATYLFGNIHGVGLEDWLDFEYSSEASPYNVSRPARWIQEDPGWKATFPYQVGQ
FT                   YIYTERDRSKNEEWASGVDPKMGKVGLSYKGTTWGKIPDRLLDASGRNRNVHWDYEAGE
FT                   LPPNLPLPGKLLTPEEATALLKEGKAFSGASYSPDDEVFPPRDPKYEKQTLTYEQAARM
FT                   WAEEK"
FT   gene            400991..401248
FT                   /locus_tag="A2cp1_0354"
FT   CDS_pept        400991..401248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63713"
FT                   /db_xref="GOA:B8JA10"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA10"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0342"
FT                   /protein_id="ACL63713.1"
FT                   /translation="MTRLKRLKLSIALEWYEILLIGVTAGLLAFGLWALVDTLLISSPV
FT                   AAWRFLALFVVWSLPGIAILAFVRPRPPAAPPAPRQQVTP"
FT   sig_peptide     400991..401095
FT                   /locus_tag="A2cp1_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.912 at
FT                   residue 35"
FT   gene            401338..402762
FT                   /locus_tag="A2cp1_0355"
FT   CDS_pept        401338..402762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0355"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: ank:AnaeK_0343 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63714"
FT                   /db_xref="GOA:B8JA11"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA11"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0343"
FT                   /protein_id="ACL63714.1"
FT                   /translation="MALLAVGTAAWTAMTSAALVEREWRATWISLATALGCAALGAGLL
FT                   LAKRRGALEGSRARWTLRGVLGLAALLALALVIPSDRSFPDKRVGAATPTQAYDATTQP
FT                   GNDVLGKVERSRGPDGRDELTFSVYDVCVGKVAHRAARDGSVAPVAVEVTEPAVLAAQI
FT                   KDEARALGAQVAGITELHPQFVFQKDNDGQPVALHHRYAIVIATGLDYRLASPSAPLPW
FT                   RDYYSSIPEEVAAVLSGRSTNPAVPIPPETVQEYRDTLEFYAEGGRVAVELAKAIRSLG
FT                   YPARAHFGRWAEVQVIPLAIAAGLGELGKNGMLINDRFGPRGSFAVVTTDIPLAVDRQR
FT                   DLGVQEFCRVCNKCADACPVSAVPRGEAGAPAGGVSRWQVDGPKCWTYLKINPKCMACT
FT                   GACPFNKKDLLAHRWAVALIARKSVAANRLLVWLDDLLGYGRSAFRLRDEARNALGAPG
FT                   EAPRPAGAFPGPEARS"
FT   sig_peptide     401338..401400
FT                   /locus_tag="A2cp1_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.501 at
FT                   residue 21"
FT   gene            402759..402926
FT                   /locus_tag="A2cp1_0356"
FT   CDS_pept        402759..402926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63715"
FT                   /db_xref="GOA:B8JA12"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA12"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0344"
FT                   /protein_id="ACL63715.1"
FT                   /translation="MRSPGPSRPVKEWLALMAAGLLVGALFNAAFQAAPWSSGGLLGGV
FT                   VAAALLRLLS"
FT   sig_peptide     402759..402857
FT                   /locus_tag="A2cp1_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.749 at
FT                   residue 33"
FT   gene            402923..403090
FT                   /locus_tag="A2cp1_0357"
FT   CDS_pept        402923..403090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63716"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA13"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0345"
FT                   /protein_id="ACL63716.1"
FT                   /translation="MIEIVTTLLLAVGVYALLRRPGAGCDAGCDGGRGGCEGEPVALVQ
FT                   LGRPRGRARR"
FT   gene            403087..404540
FT                   /pseudo
FT                   /locus_tag="A2cp1_0358"
FT                   /note="conserved hypothetical protein"
FT   gene            404537..405028
FT                   /locus_tag="A2cp1_0360"
FT   CDS_pept        404537..405028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63717"
FT                   /db_xref="GOA:B8JA14"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA14"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0347"
FT                   /protein_id="ACL63717.1"
FT                   /translation="MKRALVTVNAIAVGATLAYLGWLLADALRARQPWAITCYDCKACT
FT                   ARCVLGLDPQGFVSAALAGSGDVYVYATNVRLPVRRALEIDPEMLVTVADRHLTAREAA
FT                   AALGPDAELVTFKMRARDAARVCFRCGACEKGCGLRLPLLRLIAQLRGDAGNEWAAHAP
FT                   "
FT   sig_peptide     404537..404593
FT                   /locus_tag="A2cp1_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.794) with cleavage site probability 0.508 at
FT                   residue 19"
FT   gene            405018..405647
FT                   /locus_tag="A2cp1_0361"
FT   CDS_pept        405018..405647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0361"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: ank:AnaeK_0348 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63718"
FT                   /db_xref="GOA:B8JA15"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA15"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0348"
FT                   /protein_id="ACL63718.1"
FT                   /translation="MLRSPAFLATLTFLAVALGARVAQAPWTEQFPGSYPRVHAPADAR
FT                   FEFLPDEIRIHLDEETKSGRIIVFAHAADGSLLGLLKPIVDGAVTVRRGDLADYRLAVR
FT                   GREVGEHRLLKAMDRYVEREDMLERILDARAKGLRFGVQRCLYPICNRCLDGCKSVMRG
FT                   DFPISMRVGERGNVEPVFAKGSCPRCGKCFVWCPSGVIRDSGSLTN"
FT   sig_peptide     405018..405089
FT                   /locus_tag="A2cp1_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.611 at
FT                   residue 24"
FT   gene            405656..406021
FT                   /locus_tag="A2cp1_0362"
FT   CDS_pept        405656..406021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0362"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: ank:AnaeK_0349 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63719"
FT                   /db_xref="GOA:B8JA16"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA16"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0349"
FT                   /protein_id="ACL63719.1"
FT                   /translation="MFEAMEIAVVLLPVVLVAGMVVRLVARGHTQVLLCMECELCMGAC
FT                   PLCVKRGEAFPGPKGILAAAKTGKVDAAIAAGALDCTSCGACTHVCPRGLAPQREVERW
FT                   RAEAERVASRHAAEDPA"
FT   gene            406018..407967
FT                   /locus_tag="A2cp1_0363"
FT   CDS_pept        406018..407967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0363"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: ank:AnaeK_0350 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63720"
FT                   /db_xref="GOA:B8JA17"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA17"
FT                   /inference="protein motif:PFAM:PF07715"
FT                   /protein_id="ACL63720.1"
FT                   /translation="MSASARLAARTAIALACATCPALAAGAAPGPDPDDPVVVLEEQVV
FT                   RLPRATTEARPLASGTVVDRATFEGEAKDVGQLVSTAPGIAVEEHGGLGQLTTISIRGS
FT                   PPSGVKVLLDGLPLNTAFGGGVDLSTIPRSWVDAVEVVRGPEGARYGSGALGGVLNVVT
FT                   RRPEAGSWSLETGGGSFDTARVAADVGTSVGPGAVLLGATAETTSGRFPFRLDPGLPGG
FT                   PTVRATRENAGVRRGGLLAKLIRPQEHGRLDALLEVSGGHRGLPGFAAAPTPWAWQDDA
FT                   RLLAMGRVARFGALGPATLAARGHLRLDRLDARLTGPDDSPIRQRGAAAGLALEATGSH
FT                   RHGVLSASLETTAELLAADGLGGRRDLYGVAAAVADDLSLAGGGLRIAPAARAERAGQF
FT                   GGVSGSLGLSVRLAPALRARAGVGRTFRPPGLAELHLQQGLLVPNPDLRPETAVAADAG
FT                   WVADGRAGLLAVTGHLTRYEDLVVYEPSDAFGRLKPFNSGRASATGLEVEGASAPVGGP
FT                   LRASARGSYTLLVTELLRGAPAEVGHWIPYRPRQRAFLRVALAPGPLSAHVELHRLGRR
FT                   YRDRRGVNPIPSSTSWNAGLGVRVARRPGVRIHLEVLNLADDRTLTDGVGDPLPPRTVM
FT                   VTLRAGSSAQEYAP"
FT   sig_peptide     406018..406092
FT                   /locus_tag="A2cp1_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.550 at
FT                   residue 25"
FT   gene            407964..409451
FT                   /locus_tag="A2cp1_0364"
FT   CDS_pept        407964..409451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63721"
FT                   /db_xref="InterPro:IPR006969"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA18"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0351"
FT                   /protein_id="ACL63721.1"
FT                   /translation="MRPTFLATLAAAALLACSARSSCPEGQVDCGGRCVALSADPLNCG
FT                   ACGTVCGAGGACRAGACDCGPGTVRCGETCAQLESDPANCGACGKTCPGAQVCGTAGGA
FT                   IACADACGAGLTACDRACVDLASDRYHCGACGVPCEPGEACDGGTCRSLQVACFATDDV
FT                   RPLAPDLAGTGSPRPAGDGPVALAGLDGDVWAAAALSGSLVRLPLELAAPSVEHALHAA
FT                   DLEGIAAVGDRLLVSNSGGGSVAVVEPGTGRVLDDVILPGPPGANPRGIAVLDGRAYVA
FT                   LYGKDEASGGQAVAVLDVSGVPGCAGAPCATLERTIDLRGAADAGALPFPAHAVALGAN
FT                   VYVTLANLAKDSDPTSWTYGYYVTPAGPGRLVTIDGASGASRVLSLGDGCKNPGALAAH
FT                   GSTLWISCAGAGAAGLLPVDLSNPAAPEVGGLLLTAFDAPGAVAFCRGAGFVSDQYTGR
FT                   VQRFDPVTRNAQEAVEVCPMGAQGWAWAADLLCAPGR"
FT   sig_peptide     407964..408032
FT                   /locus_tag="A2cp1_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.816 at
FT                   residue 23"
FT   gene            409524..411188
FT                   /locus_tag="A2cp1_0365"
FT   CDS_pept        409524..411188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0365"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; 4-vinyl reductase 4VR;
FT                   Activator of aromatic catabolism; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   ank:AnaeK_0352 putative sigma54 specific transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63722"
FT                   /db_xref="GOA:B8JA19"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA19"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACL63722.1"
FT                   /translation="MKLHDIHLLDLFDVGTEQGWLSMRQQRMVVHSAAAVSIMRAQLIR
FT                   SLGQDAARAIVFRWGFAQGYFDAMMCSDHLASLQPVDRFVFGCTLHTMEGMVRVAPKVI
FT                   EAKGPGKLHMEANWWHCAEADDHARVFGAGMTSSCWATLGYASGFGTYVIGALILFEEV
FT                   ACRCSGAQCCSVVGNDLDGWGDRAAEIEARYTLAGETSFSQQWKEIHAECEHARAIGTA
FT                   AASAKSAPTATVTTVNGPDRTTAPLNFVVCSQAMTDLLVLAERVAPLEMNVLIEGESGT
FT                   GKEFLARFIHEKSMRGDAPMVAINCAALTEGLLESELFGHARGAFTGAVRDKPGLFEHA
FT                   GRGTILLDEIGEMPLCLQAKLLRALESREFRRVGSEKVLRLDARVVASTNRDLRQQVQT
FT                   GAFREDLFYRLGGFVLTIPPLRERREEIPALAHYFLHSTARRWNKGVQTISPGAMRCLM
FT                   SYSWPGNVRELQHAIERATVVASQSVLTVKDLNPEVAGRLGDPAPDGDLDVEANERQLI
FT                   EEALRRYHGNRKEAAAALRISPVTLWRRVRKYGLSLS"
FT   gene            complement(411181..412221)
FT                   /locus_tag="A2cp1_0366"
FT   CDS_pept        complement(411181..412221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0366"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   ank:AnaeK_0353 molybdopterin dehydrogenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63723"
FT                   /db_xref="GOA:B8JA20"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA20"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ACL63723.1"
FT                   /translation="MLARFVKRLGANVPVHGEAHAVSRTRAYPEWHLASSLAEATWRAF
FT                   QGAAVVAGGVDLGERLRLVRRAPRSIVCIRGLAELRRLDVRTDGVCIGTLVTLQELAQS
FT                   PLVLERFPALARAAGLAATPAVREVATVGGNLMQYPRCWQLRTEGRPCRRSGAGRCHSD
FT                   GSWRADGALFDRRACASAHPSSLAPVLIALGARAEAHSVSGLVRVPLDRLYPPRRSSAG
FT                   RPVCTTPADILTCIHLRWPAPGAVTFFDARRTGDTVTAAVAGSVQVRDQVVEAARIVLG
FT                   GVAPSPWRARAAEARLVGARLCPAALRDAVHAELAIAPAPAGSAAKARDLQSAALTALR
FT                   VGEGVS"
FT   gene            412377..412952
FT                   /locus_tag="A2cp1_0367"
FT   CDS_pept        412377..412952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0367"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ank:AnaeK_0354 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63724"
FT                   /db_xref="GOA:B8JA21"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA21"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACL63724.1"
FT                   /translation="MDGAGDRGRAARPARGGARGGLALLAGAALAIGALVVADRRAAAG
FT                   RAPGLDELAPPLVVTSVGGGGAIDLGKLRGRAVAVNFWAPWCGPCRAELPDLAEVKREL
FT                   ADACVELIGVAGDGGREEVAQVAAGQPYPMGFDADGAAMRAWRVDAVPTTYLVDPGGKI
FT                   HAVISGAVGRAELLEALRPIIPATCPRS"
FT   gene            413137..414024
FT                   /locus_tag="A2cp1_0368"
FT   CDS_pept        413137..414024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63725"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA22"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0355"
FT                   /protein_id="ACL63725.1"
FT                   /translation="MKPHPWKPVLALVAAITLATPAAAKEGGDQYPVGVDGLAAGALPP
FT                   PGTYLLSMVALVHGEVQDAAGHDAGVEANAQFGVLRLVHVTKLRVLGAQYAFGAILPYW
FT                   HQSAKIRTPVGKLELDADGPGDITINPVYLNWHLPQNLHLLATVDLNLPTGRFRTDGGL
FT                   SQGVGYYSVSPTVAATWYAPGGVEASGKLLYNLKRENPVTGVQSGDELELDFALAKRFG
FT                   PFEAGVGGYYTVQTTDDELDGREVNDKAEGLALGIQAAYQAPFGTFIGMWHHDVTSDSR
FT                   LQADRVFLKLMLPL"
FT   sig_peptide     413137..413211
FT                   /locus_tag="A2cp1_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(414008..416185)
FT                   /locus_tag="A2cp1_0369"
FT   CDS_pept        complement(414008..416185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0369"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   ank:AnaeK_0356 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63726"
FT                   /db_xref="GOA:B8JA23"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA23"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACL63726.1"
FT                   /translation="MLRSLPVSTKILGSSLLAAGATLAAGMAGWLAARGGLPGGATLAL
FT                   GASAAVAAVIAAGGLFVSLVVGRAIRAMRTESAHVRDAVRAGMLTVRGGEGRIDPEFQL
FT                   IIRTLNETLDAFSVPFAATAEAVERISRGDLPARITAPFEGDFDRLREAVNAVIEVVEQ
FT                   RNDDIRRLVEAATAGRLDVRADVTRYHGYNGAMIGRINLLLDTVIRPIEVATDRVVRLA
FT                   AGEVPPDVDLAVQGRFLDLKRGVNALLEVVRLRNADLALLLRAAAEGRLDVRADPSRYP
FT                   GQNGDLVRGMNALLDAVVAPLRAAAGALERLARGEAPAPIEETYRGEFDTLRRNVNACT
FT                   SAIRALVGEVDVAIEAGRAGDLGRRGDPARCEGDYRRVLAGVNEILDAVSAPVREASEV
FT                   LARLAARDLRARMGGRYLGDHARLQQVVNGTAGALDAALGQVVEAVGGISAAAAQIASS
FT                   SRAVAGGAAEQASAIGRTGASLEAVAGQARATSEHASAADGLTAAARDAAAEGTATVSR
FT                   MTAAMAQVRLAAEQTAQIIKDIDEISFQTNLLALNAAVEAARAGDAGRGFAVVAEEVRS
FT                   LALRSKAAASRTEALIHESVRQAADGDAITRAVAERLEAIHGSSDRLAALAAEISASAR
FT                   EQASGVARITGTVAEIDRVTQQNAASAEQSSAAAAELSARSGMLAELLGEFRLGGAGDR
FT                   AAVRAAPRAACEAGRGSDDPTCLAAGATGGA"
FT   sig_peptide     complement(416099..416185)
FT                   /locus_tag="A2cp1_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.352 at
FT                   residue 29"
FT   gene            complement(416446..417357)
FT                   /locus_tag="A2cp1_0370"
FT   CDS_pept        complement(416446..417357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0370"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: ank:AnaeK_0357
FT                   UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63727"
FT                   /db_xref="GOA:B8JA24"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA24"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ACL63727.1"
FT                   /translation="MDLLVYPTHSLPTAAQPVLVGLGLAVHFGVLSPWPALVGLFGSWV
FT                   IHVAGLFTDNHELLRLHPKLPEHPELVHAVETGALRLATLRLAIVGCLALALATAPYLY
FT                   RIGGAPVLAFGALGIVTSLSYNGGPWAYARRGQADPLFVVMFGVVGVVGTYFIQAAAVQ
FT                   GAPEPWRMLASLPLPVYLVGLPVGALVTAVLLVDDLRDHEFDRLKGWRTGAVLHGPGFN
FT                   RVEISALLALAYLAPLGSWLLLDLGPWMLLPLASAPMAVGALRTLFTVRERARLIPLTP
FT                   RMARVGLVYSALLGAALALAPR"
FT   gene            complement(417535..417912)
FT                   /locus_tag="A2cp1_0371"
FT   CDS_pept        complement(417535..417912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63728"
FT                   /db_xref="GOA:B8JA25"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA25"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0358"
FT                   /protein_id="ACL63728.1"
FT                   /translation="MKSRASPSTAAPSWGALWLTGGPQALAPRLPPPAPRPAPAGRAGT
FT                   GRLLAPRFARAARGSPDLAVGALLAALWIGLWAVFTVGVAGALGEVAAGPAAGWTASAP
FT                   GTPHASVAAARRPAPTPRVRR"
FT   sig_peptide     complement(417835..417912)
FT                   /locus_tag="A2cp1_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.571 at
FT                   residue 26"
FT   gene            417969..418910
FT                   /locus_tag="A2cp1_0372"
FT   CDS_pept        417969..418910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0372"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ank:AnaeK_0359 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63729"
FT                   /db_xref="GOA:B8JA26"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA26"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL63729.1"
FT                   /translation="MSKRALNAQGGAGPAQQRAGLDWGHLEFFLELVRTGSHARAARRL
FT                   GVDRNTVARRVAALEGALGLALFERGPQGWACTTTGQELAELASRVEQDVLALARHADT
FT                   RDRALDGTVRLTTASHLATYLFLPAVGVLRERHPGLVLEIAADQRAFDLTRREADLAVR
FT                   MGRPRDAGLVTRKLSDVAYGLYGGREVVGGKPRAVDFAADPFVGLDEGHAAVPQERWLE
FT                   RVAPARRIVFRCNSTTALLQAARLGVGVAVLPRFVADRDPALVRLEGPEPAPHELWLLV
FT                   HGDLRRTPRVRAVIDWLDGLVERARPALAGQP"
FT   gene            complement(418907..419653)
FT                   /locus_tag="A2cp1_0373"
FT   CDS_pept        complement(418907..419653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63730"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA27"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0360"
FT                   /protein_id="ACL63730.1"
FT                   /translation="MSSGARKHAVPAEAPGAEVPSAAAEVVREYGPFDGAPVAGVSFDG
FT                   ERVWAATGARLIAFDPASGETVRALEVACDAGTAFDGRHLHQLAGDRILRLDPGTGAVL
FT                   GSIPAPEGAGGSGLCWAEGSLWVGRYGERRILRVDPATGAVLRTIESDRFVTGVTWVDG
FT                   ELWHGTMEGGESELRRVDPAGGAVRARLAMPRGALVSGLESDGAGLFFCGGAASGKVRA
FT                   VRRPAPAGGRGASRARRPGPRSLRRR"
FT   gene            complement(419650..420894)
FT                   /locus_tag="A2cp1_0374"
FT   CDS_pept        complement(419650..420894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63731"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA28"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0361"
FT                   /protein_id="ACL63731.1"
FT                   /translation="MPATPPAAAARALQAGDPLGALREVALRRDATGLALRGIAMAQLG
FT                   DLGAARRLLRRAARAFGPAAPIARARCATAEAEVALAARGPDAPAIDLEDAARALEAGG
FT                   DRTNALHARLLAVRRLLLGGRVAEAGRALDRLALRGAPPALAAVAGLAALDVALRSGRS
FT                   AAAAEAHARARRAADRAGIPALVAEVARAGEALASPAARLLSAGAERPLRLGEVEALRR
FT                   SDRLVVDGCRRTAGRGGAAVDLARRPVLFALLRALAEAWPGDAPREVLVRRAFGAARAT
FT                   PSLRGRLRVEVGRLRRAVRALASVHATPAGFALAPRTRAGVAVLAPPAAAGDADGQAAA
FT                   LAALLADGQAWSSSALALALGASRRTVQRGLTALAERGAVRALGRGRARRWVSAPTSGF
FT                   NPALLLPLPRAIGQG"
FT   gene            421040..422272
FT                   /locus_tag="A2cp1_0375"
FT   CDS_pept        421040..422272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63732"
FT                   /db_xref="GOA:B8JA29"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA29"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0362"
FT                   /protein_id="ACL63732.1"
FT                   /translation="MLCIRRMRSDRNLGTLDRRDGVWPRTYRFARRWRLLFHGLGALGL
FT                   AAAVAGSIAALRGALTGPVLIVPLGFGALGAAAVAAAQRGRLLLHADGVEVIELGRSPR
FT                   RLRNDQIAGRRTIPLQYGMEKLVLERRERGEKPVSMGFLFERDATLDAWLESLPDLDVA
FT                   DRASAEAALLASAELGPDEEARRASLAGSHRVAKVLKGAALAAGGWGLLFPRPYPVAIA
FT                   VLAAIPLATLALVLAGRGRYAVEERRNEVRPGVGVPIFAPGVVLMLRALLDYEVVDVAR
FT                   VLGWTAAAAVALTALLVRGDAALRRRWYVPALVLALVAPYPWGALNAADVLLDRAPAEV
FT                   HEVPVLHKHVSSGKHTSYDLRLPPWGPIGAAQEVDVGRELYGQVEVGDLVCTHLRPGAL
FT                   GARWFVVDLCD"
FT   gene            complement(422285..422908)
FT                   /locus_tag="A2cp1_0376"
FT   CDS_pept        complement(422285..422908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0376"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ank:AnaeK_0367 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63733"
FT                   /db_xref="GOA:B8JA30"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA30"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACL63733.1"
FT                   /translation="MTSLVFLPGAGGRGAFWAPVADRLADLGPSVRLDYPGFGGCPPDP
FT                   AIRSSGDLFAWVLARLPAGRSHVVAQSMGGALAVRLALEHPERVERLVLVATSGGVDLR
FT                   GTGAADWRPEYLASLPGVPRWFVDDRTDHTARLGELAAPTLLLWSDADPVSPLAVGRLL
FT                   EARIPGAALEVFAGGTHAFANERPDEVAAAIRAPLTGAPPARGR"
FT   gene            423268..423693
FT                   /locus_tag="A2cp1_0377"
FT   CDS_pept        423268..423693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0377"
FT                   /product="ribosome-binding factor A"
FT                   /note="KEGG: ank:AnaeK_0368 ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63734"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA31"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0368"
FT                   /protein_id="ACL63734.1"
FT                   /translation="MTPERPNRPGAPSRATPFTPQPAASAADAAALRAERLERILLALF
FT                   RSVVREESTDPGLTGVDLVALRLSLDGAEARIGYALEVPRGEGQGAECEAAEALARAAP
FT                   LLRARLAEVIDLPVLPSLTFALERVREVPRAPRAGAA"
FT   gene            complement(423710..424696)
FT                   /locus_tag="A2cp1_0378"
FT   CDS_pept        complement(423710..424696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ank:AnaeK_0369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63735"
FT                   /db_xref="GOA:B8JA32"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA32"
FT                   /inference="protein motif:PFAM:PF03601"
FT                   /protein_id="ACL63735.1"
FT                   /translation="MERSTPEPRTSSARSIPSFLVPAAGLACVAIPHVSPALALAAGVA
FT                   LALSTGNPYAATTRALARRLLPVSVVALGGAMDLRVVAHVGARGVGYTFVSIAACLALG
FT                   ALLARAAHVEARTAALISVGTAICGGSAIAAVAPVVGADEHETSIALGAVFLLNSAALL
FT                   VFPLVGHAAGLAEPAFGLWAALGIHDTSSVVGATLAYGPQALAVGTTVKLARALWIVPV
FT                   TLAIGLVARRARGGGAASAARPPWFILGFVAVAALATFLPALRPAGLLAAEAGRRALVL
FT                   TLFLVGLGLSRQALRSVGAGALAMAVALWLAVATATLAAVRTGLVHL"
FT   sig_peptide     complement(424571..424696)
FT                   /locus_tag="A2cp1_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.740 at
FT                   residue 42"
FT   gene            complement(424773..425696)
FT                   /locus_tag="A2cp1_0379"
FT   CDS_pept        complement(424773..425696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0379"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ank:AnaeK_0370 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63736"
FT                   /db_xref="GOA:B8JA33"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA33"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL63736.1"
FT                   /translation="MPRLDPRRLQSFREVALAGRISVAARTLHLSPSALSEQVRELERT
FT                   CGRPLLLRTAHGVQLTADGQRLLEHAQRVDEALRAAEASMDREAEEGGPLVLGASQTTA
FT                   AWVVPHLVAELRRARPGVAVRVEVGNTDAVLGWLAKGTVPLGLVEGLSRAPHVRLEPFA
FT                   RDEIVAAASSAAPAEILRLRRVAELDRVPIVWREVGSGTRAVVEKALRRAGVRRTRRHA
FT                   DLELGTNDAVKAAVQLGLGVGFLSRWAIRTELATGALRAIPLEGLRIERAFSWALPAGG
FT                   VSGIAGRFLREAQRLAAGTVRPAWFP"
FT   gene            425820..426602
FT                   /locus_tag="A2cp1_0380"
FT   CDS_pept        425820..426602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0380"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ank:AnaeK_0371 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63737"
FT                   /db_xref="GOA:B8JA34"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA34"
FT                   /inference="protein motif:PRIAM:3.5.2.6"
FT                   /protein_id="ACL63737.1"
FT                   /translation="MRMLLTVALAVLPFASLADAHAHGEAEIDLGQRVWARPISRDAWI
FT                   IRSVSPIAGFGDVESNAVLVAGAAESVLIDTPATEAQTAPVLAWAAETLRRPVRHLVVT
FT                   HWHADRMGGIGLARPNRIRTYALGKTRALAQRHGLVVPERELRPEERLALAGVKLETWY
FT                   PGHGHTADNLVVWLPANGLLVGGCFVKAAEARTLGNLEEIDPVQWAKGAAAAARRYPQP
FT                   RTVVPGHGAAGGPELLRHTAELAQAYAAEHGREGERRR"
FT   sig_peptide     425820..425888
FT                   /locus_tag="A2cp1_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.401 at
FT                   residue 23"
FT   gene            complement(426643..427029)
FT                   /locus_tag="A2cp1_0381"
FT   CDS_pept        complement(426643..427029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0381"
FT                   /product="conserved hypothetical Na/H antiporter"
FT                   /note="KEGG: azo:azo2277 conserved hypothetical Na/H
FT                   antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63738"
FT                   /db_xref="GOA:B8JA35"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA35"
FT                   /inference="similar to AA sequence:KEGG:azo2277"
FT                   /protein_id="ACL63738.1"
FT                   /translation="MPHLLPVPYLVALGILVVGVALGGALTQPRWPRAAGFLAAILVAS
FT                   FVALAATATALGWQKAGWLGERLVPHLAAAGLPLVSVLTALVVFRRARAPVRIALAIAL
FT                   GAAGISYAGVAGIATACLLTGDCL"
FT   sig_peptide     complement(426958..427029)
FT                   /locus_tag="A2cp1_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.702) with cleavage site probability 0.375 at
FT                   residue 24"
FT   gene            complement(427137..427586)
FT                   /locus_tag="A2cp1_0382"
FT   CDS_pept        complement(427137..427586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_3625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63739"
FT                   /db_xref="GOA:B8JA36"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63739.1"
FT                   /translation="MVFSVLSFTFHDRFPFPDGKEGAFVHLGLPPYFKVELTIAKALGV
FT                   LALLVPGVPRKVREFAYFGFGLTLVSAAIAHFSVGDARRLSPLYVIDPLLFLGCLATSY
FT                   AGFLRGGPEAFRGPSAQPAVGTSGAATVRSVRVARTPPPSEASPR"
FT   gene            complement(427780..428664)
FT                   /locus_tag="A2cp1_0383"
FT   CDS_pept        complement(427780..428664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0383"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   rxy:Rxyl_2365 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63740"
FT                   /db_xref="GOA:B8JA37"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA37"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACL63740.1"
FT                   /translation="MTDGTETFETQRPALLALAYRMLGELARAEDVVQEAWLRWQRRPD
FT                   EVGSAKAFLLTTVARLCLDELGSARARREESRSDRLPEPVDLERAGLGRVEMLDRISMA
FT                   FLVLLQRLTPAERAVLLLHDVFDMTHAEIAARLERSEPACRQLLRRARENVATERRTLR
FT                   ASRDEHRRLLAAFMEASARGDQRALLELLAEDAVLIADAGPGVVRYGRIRNIGRPVVGG
FT                   VKVAALLASVARQRVGAPLELRERTLNGEPAAVAFEDGRPVSAIVLAVAGGKVRHVYLQ
FT                   VDPERLRHVGPLA"
FT   gene            429649..430860
FT                   /locus_tag="A2cp1_0384"
FT   CDS_pept        429649..430860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63741"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63741.1"
FT                   /translation="MKLLALLLGALGFAPTAVERAALLQFRGDAAAALSAADTILAKDP
FT                   QDARALFVAACAAVEAGDLDRASVYTGRLEQHGRDPHVVVLKRLIERRRERKDEPLREA
FT                   LVLAWRDTGRPDLSGNRILRESESWGQLVPKIDRPVRARLTAGERFMFDGIGSATSAAY
FT                   VKAAIRAAADAEKQPVVVNLDVLGALTPFAAIKGIDAQAASRAAAHVGRVVVAAEPDNG
FT                   YMELASLLAAAPGTVPFNADDLSAIERALGKPRFEYPREGSLTQLRQLAAHFDPGHAEL
FT                   RAWSAALGASVPLFRLWQRAEAVKDPELRVRAGRVLQAVGLRLREAGTALEKSLSFALE
FT                   VKGAELRGDAAAVEAAKAARAQWWAWHQATEDARRRMGNWPFAAGWREWTPAGEVAYMR
FT                   KLTD"
FT   sig_peptide     429649..429714
FT                   /locus_tag="A2cp1_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.590 at
FT                   residue 22"
FT   gene            430887..432503
FT                   /locus_tag="A2cp1_0385"
FT   CDS_pept        430887..432503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0385"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG:
FT                   syp:SYNPCC7002_C0005 MloB like protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63742"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA39"
FT                   /inference="protein motif:PFAM:PF04326"
FT                   /protein_id="ACL63742.1"
FT                   /translation="MKQRGLEELRIWMNSVEAERLEFKEAKNNFDLEKLVQYCVAIANE
FT                   GGGVLILGVTDQAPRRVVGSRAFEDLERTKSQLVDRLKLRVDADVIAHPDGRVVAFTIP
FT                   PRPLGVPLHHNGAYLMRAGESLVAMTPDRLRRIFDEVVPDHSAEIVPAATMADLEPGAI
FT                   EKFRELWRRKSGNEQIDRMGPDQLLADAELAPDGRISVAALVLLGTRAGLGRHLAQAEL
FT                   VAEYRSADASIAPQQRLEFREGFLRYFDELLRFVQARNEVQQFRDGLIIRDIPTINEVA
FT                   AREAILNAVSHRDYRHAGSIFLRLYPRRIEIVSPGGFPPGVTAENILWRQAPRNRRLAE
FT                   ALAKCGFVERSGQGADRMFEESIKEGKPRPDFAGTDDYQVALTLRGDVQDVAFLRFLER
FT                   VGQETLVSFSTTDLVVLDIVHRGEEVPKNLASRVPQLVEKGVLERYGRGRKKLMLSRRF
FT                   YAFVGRKGEYTRRRGLDKPHSKMLLLQHLEQFETATIQEFEQALPGHVRHAIHRLLREL
FT                   KREGKVVMLGSKRGSRWTLKK"
FT   gene            complement(432722..433183)
FT                   /locus_tag="A2cp1_0386"
FT   CDS_pept        complement(432722..433183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63743"
FT                   /db_xref="GOA:B8JA40"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63743.1"
FT                   /translation="MNLLPFDRTELRSTSTPDEIAARVAELVTQGHWAAQRPFRGKLQG
FT                   RRFQLVRNVQRPHAVVVGEIESAGAGSVVRLRFRLRWALAAFLGVWFALFSYAAAANLR
FT                   GLASDVAGIVLALVAGTVTVGFAAALLTTPFRHDVRQALETLRAAVERA"
FT   gene            complement(433303..433378)
FT                   /locus_tag="A2cp1_R0003"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(433303..433378)
FT                   /locus_tag="A2cp1_R0003"
FT                   /product="tRNA-Gly"
FT   gene            complement(433458..435416)
FT                   /locus_tag="A2cp1_0387"
FT   CDS_pept        complement(433458..435416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0387"
FT                   /product="proprionate catabolism activator, Fis family"
FT                   /note="KEGG: ank:AnaeK_0385 proprionate catabolism
FT                   activator, fis family; TIGRFAM: PAS sensor protein;
FT                   propionate catabolism operon regulatory protein PrpR; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; Propionate catabolism activator
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63744"
FT                   /db_xref="GOA:B8JA41"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA41"
FT                   /inference="protein motif:TFAM:TIGR02329"
FT                   /protein_id="ACL63744.1"
FT                   /translation="MTPADRRPIVWAFSTSRLRHVFESVAPLMADVAEVRVFDKGFEEA
FT                   LQVARELRQAGEEVDAFVAAGTNGAYLRDHADVPVVVVTASTVDALQALVQARKLSKRI
FT                   GVVNFRRTVAGLEGVHLIDDTVIEQRPYVTPEEGQAAVDDLSARGFKVIVGPGPICSVA
FT                   ERSGLRAVLLYGQDSLEEAIRQAAEVARIARVEGSRRTHLQAMFQHLEVGVVAVDTEER
FT                   IQAINPALQRLLGVTAAEVQGRKLSAVAPELAMGPVLEGGPPEVEAVQRIGVAAAVVSR
FT                   FPLHEHGVLRGAVLTCQPAAMVQRLERGLRSTHRPPRFVARYALSGLVGESPAMVRLRE
FT                   LAGRYARTDATVLITGESGTGKEMVAQGIHGASRRRDRPFVAVNCAAFPETLLEAELFG
FT                   YEEGAFTGSRRGGRPGLFEAAHTGTLFLDEIGDVPVTLQTRLLRVLQERQVLRLGSNDP
FT                   TPVDVRVIAATHRDLRQAIARGEFREDLYYRLDILPLHLPPLRERGEADVELIASDLLK
FT                   RALLRHGAADAHRRALSMVLPRLRGHAWPGNVRELENVLERVAVLFADRDPRARVTEEE
FT                   LAAVMPEVADPTARAAAPTAPSAVAPPIDLRLARAAQERVLIERTVAECGGNQAEAARR
FT                   LGIGRTTLYRKLGRVRA"
FT   gene            435719..438103
FT                   /locus_tag="A2cp1_0388"
FT   CDS_pept        435719..438103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0388"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   ank:AnaeK_0386 3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63745"
FT                   /db_xref="GOA:B8JA42"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8JA42"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACL63745.1"
FT                   /translation="MDRIERVAVLGSGVMGSTIAAHLANAGFGVLLLDIVPKEPNAEER
FT                   AAGLGLDSPAVRNRLAAAARAGLEKLKPAPLYLPSYASRIDVGNLEDDLPRLASCDWVV
FT                   EVVLEHLEVKRQLLGRIAPHLKPTAVLTTNTSGLSVNAIADTLPEALRPRFLVTHFFNP
FT                   PRYMRLVEIVSSRHTDPAVAAGMAELIRVRLGKGIVTGKDTPNFVANRIGVFAMCNAIR
FT                   HMVELDLTVEEVDAIAGPPTARPKSATFRTADLVGLDTLLHVARNSYELLPGDSRRDEF
FT                   KLPAFLEQMVAKGILGNKSRGGFFRKEKGEGGGLSIYDHRKGEYVPAAKPRSAAVEATK
FT                   GIDDPAQRLRAALAGKDKVAEHAWRNLRDTLLYAFERIPEIADDVVNVDAAMRWGFGWD
FT                   LGPFEMLDAIGVPAFVTRAAQDGVAVPERLRGIERFYAEENGRRRYLDLAGGGYRDVPR
FT                   PADQIDLAVLEKSGAVVERNAGASVLDLGDGVFCLEFHTKMNAIGPDVLAMVHKAVARA
FT                   ERDGQGLVIANRGQPAFSAGANLMLIAVAIAEGAFDEIALTIRAFQKAMMALKYARVPV
FT                   VAAPHGLALGGGCEVCLHATAMNPLAETYMGLVEIGVGLLPAGGGTKEMALRAIRLAEK
FT                   YEIDASPFVFKHFNTVALAKVSASADELVAMGMLREGDAVTLSPDRLVHDAKQKALALA
FT                   ANFRPGTPATGLRAPGRGAAASIASQLWNMRMGGFITEYEERLGRTIAGVMTGGDVPAG
FT                   TLVTEQDLLDLEREAFLKLCGERKTLERIQHMLKKGKPLRN"
FT   sig_peptide     435719..435799
FT                   /locus_tag="A2cp1_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.508 at
FT                   residue 27"
FT   gene            438149..439321
FT                   /locus_tag="A2cp1_0389"
FT   CDS_pept        438149..439321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0389"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: ank:AnaeK_0387 acetyl-CoA
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63746"
FT                   /db_xref="GOA:B8JAT5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAT5"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACL63746.1"
FT                   /translation="MSAAYVLAAVRTPGCKAKKGKLKDVRPDDLAAVAIRALLARTGVD
FT                   PGQVEDVILGCAFPEGEQGMNLGRVAALRAGLPVGVPGQTVNRFCASGLQTIATAAERI
FT                   MAGQADCIVAGGAESMSLVPMGGSHFSANPALVASWPESFAAMGITAELVAARDQVSRE
FT                   DQDAFAVQSHARAARAQAEGLFADELVPVEVEQVTLEKGKPARRTEQVTADDGVRPGTS
FT                   LEALAKLKPAFKIDGTVTAGNASQTTDGAAAALVVSEAFLTRTGLAPLARFVSYAVRGV
FT                   PPEIMGIGPVEAIPAALKRAGLRVEDVGQIELNEAFAAQSLACVRALGLDPEKVNPTGG
FT                   AIALGHPLGCTGAKLTATLLHGMRRTGARHGIVSMCVGGGMGAAAVFERA"
FT   gene            439365..441140
FT                   /locus_tag="A2cp1_0390"
FT   CDS_pept        439365..441140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0390"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ank:AnaeK_0388
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63747"
FT                   /db_xref="GOA:B8JAT6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAT6"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACL63747.1"
FT                   /translation="MARLLKGAEYLISEATKDDVFTPEDFTEEQRQIAETAEQFAESEA
FT                   LPAEHALEQHEPGVAAALMRKAGDAGLLMIDAPEAYGGLALDKATSMLAAERMGTGGAF
FT                   SVSYAAHTGIGTLPLVYYGTDAQKDRYLTKLVTGEWAAAYCLTEPEAGSDAMGGKATAT
FT                   LSPDGKHYLLDGTKQFITNGSFANLFTVFAKVDRKHFTAFLVERTFPGVTVGPEEKKLG
FT                   IKGSSTTSVIFESAKVPVENVLGEIGKGHKIAFNVLNVGRFKLGAAVTGAAKLALATGA
FT                   AYANARKQFGTPIARFGAIREKLADQAAAVYASESLIYRLAGLIDDRLATIPADQPGYY
FT                   EAYQQGIEEYAIECAIAKVFCSEVLADVVDEVVQIHGGYGFIQEYPAEKYYRDERINRI
FT                   FEGTNEINRLLVPGTILRRALKGELPLQREVMKAMDALMNPSLDEADPAVPFAAEKATV
FT                   ANLKRAFLVVAGAAVQKYGEALKDEQEVLLALADVAIQAFAAESVVLRAEKTASTQPEA
FT                   RRALAAAAVKVHTFAAAEKAATAARRAAFYVGEGDTLTILLGGIRRFSKYDAAGLLQAK
FT                   RRLADAVLESERYPF"
FT   gene            441387..442082
FT                   /locus_tag="A2cp1_0391"
FT   CDS_pept        441387..442082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0391"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   ank:AnaeK_0389 oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63748"
FT                   /db_xref="GOA:B8JAT7"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAT7"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACL63748.1"
FT                   /translation="MDDQQRRIAEGVALLRARFGEKMKATPSLADASPQGDGPANRHGM
FT                   PKEPPGQNVFEKHEWPVMDLGTGTPDLAPERWRLVVDGAVETPLELSYAGLLALPQVDE
FT                   EADFHCVTGWSILDVAFRGVRLETVLALARPTAAATHLMAHSADGYSTNLPLEEALKPD
FT                   VLLVHAVEGKPVTREHGGPVRIVVPQLYAWKGAKWLTRLELMTQDRRGYWEIRGYSNTA
FT                   HPWRDDRTW"
FT   gene            complement(442108..442491)
FT                   /locus_tag="A2cp1_0392"
FT   CDS_pept        complement(442108..442491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63749"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAT8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0390"
FT                   /protein_id="ACL63749.1"
FT                   /translation="MDCPRCSVELNEIAHEDSAVQRCAECGGIWVGDAADLNKVLLHAN
FT                   LPALSALGGYVNADEISGMCPACNVDLVVVEGGEKRALAYDTCESCGGIWVDGTEDEPA
FT                   AELDWKGATSQIVAFFKAFAKKK"
FT   gene            complement(442604..443269)
FT                   /locus_tag="A2cp1_0393"
FT   CDS_pept        complement(442604..443269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0393"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: ank:AnaeK_0391 ATP phosphoribosyltransferase;
FT                   TIGRFAM: ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63750"
FT                   /db_xref="GOA:B8JAT9"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8JAT9"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ACL63750.1"
FT                   /translation="MPGTSELITVAVPKGRLLQESSALFERALGVSPRKLLEGTRKLAA
FT                   DAPEAGLRFISIRAGDVASYVEHGAAEVGIVGLDVLREEPRDLYEPLDLGIGRCTVIVA
FT                   RPKGARPLPRGVAPRVATKYLSLAARHFAAKGVPAEIIPLHGSIEVAPSLGLADTIVDI
FT                   TETGETLRANGLVIEEKVLEVSARLVVNRVALKLHPERLRRLIEALRAAVAEAGAEAR"
FT   gene            complement(443269..444537)
FT                   /locus_tag="A2cp1_0394"
FT   CDS_pept        complement(443269..444537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0394"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   ank:AnaeK_0392 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63751"
FT                   /db_xref="GOA:B8JAU0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8JAU0"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACL63751.1"
FT                   /translation="MDKIVIEGGVPLRGSVDVSGAKNAALPVIAAALLAEGEHEVRNVP
FT                   DLADVRTLGKLLGHMGCEVARGEGDRRTVRLRVPAAVAPEAPYELVKTMRASVLVLGPL
FT                   LARLGRARVSLPGGCAIGARPIDQHLKALTALGAEIRLEHGYVNASVPRGRLRGTVFTF
FT                   DAQTVTGTENVMMAAALADGETVLRNCAREPEVKDLGDALVAMGALVEGAGTDEIWIEG
FT                   VPSLRPLSHAVIPDRIEAGTFLVAGALPGNDVTVRGCVAAHQEALVEKLRAVGAEVTKV
FT                   EGGLRVVGDGRPRPVDVRTAPHPGFPTDMQAQLMVLLCLADGTSRITETVFENRFMHVQ
FT                   ELIRLGAHVEVDGRVAMVKGVPELSGAPVMASDLRASAALVLAGLAASGTTEVLRVYHL
FT                   DRGYERIEEKLAPLGARIRRVRG"
FT   gene            complement(444618..445478)
FT                   /locus_tag="A2cp1_0395"
FT   CDS_pept        complement(444618..445478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0395"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; Protein of unknown function
FT                   methylase putative; KEGG: ank:AnaeK_0393
FT                   protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63752"
FT                   /db_xref="GOA:B8JAU1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAU1"
FT                   /inference="protein motif:TFAM:TIGR00536"
FT                   /protein_id="ACL63752.1"
FT                   /translation="MSDGGAWTTLRLLAWTQEFFGRKGVDAPRLTAELLLAHALRCERM
FT                   RLYLDFDKPLGEPELAAFRDLVRRRAEGEPTAYLTGRRDFYGRPFLVDARVLVPRPETE
FT                   LVLEAARDALPEGGAALDLCTGSGALGVSLALERPGARVVATDLSADALAVAAENARAL
FT                   GAAVDLRQGDLWAPLRAGERFDVIVSNPPYVPRGELDTLPREVRREPRLALDGGPDGLS
FT                   LLRRIVEGAPARLAPGGTLVLEMHEGHLELLPRLCRDAGFAQAEARRDLAGLPRLTVAR
FT                   LPGAA"
FT   gene            complement(445475..446587)
FT                   /locus_tag="A2cp1_0396"
FT   CDS_pept        complement(445475..446587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0396"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   ank:AnaeK_0394 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63753"
FT                   /db_xref="GOA:B8JAU2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8JAU2"
FT                   /inference="protein motif:TFAM:TIGR00019"
FT                   /protein_id="ACL63753.1"
FT                   /translation="MLSPDVLKKLEAIEQRFEELTQLLSDPAVAGNGDRFRKVAKERAS
FT                   IEQTVTALRAYRKLLEDVEGNEALLADKDPELRELAKEELAQLRPQVDPAEEQLKLYLV
FT                   PKDPNDEKDVIVEIRAGAGGDEAGLFAAEVMRMYVRYAERRGWRVELMDTSGGALGGVK
FT                   EATLTVSGDAVYSSLKYESGVHRVQRVPATEAQGRIHTSTVTVAVMPEAEEIDVQVNPA
FT                   DVEMDVFRSTGSGGQSVNTTDSAVRLTHKPTGIVVKCQQEKSQLKNRTMAMKMLRAKLF
FT                   EIEQERQRSARDATRKSQVGTGDRSEKIRTYNFPQDRLTDHRVNYTRHNLPAVMDGDVQ
FT                   DVIDACRTFYAAQALREASRGEAGAAERRA"
FT   gene            complement(446863..447444)
FT                   /locus_tag="A2cp1_0397"
FT   CDS_pept        complement(446863..447444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0397"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: ank:AnaeK_0396 transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63754"
FT                   /db_xref="GOA:B8JAU3"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAU3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0396"
FT                   /protein_id="ACL63754.1"
FT                   /translation="MTAAAQRAAAPTSHALQKADLAVADAVGALMELWGFRRQLGRIWA
FT                   VLFLSDRPLAAPDLCDRLQISTGLLSMSLAELRRWGVVRTVEVPGDRKEHFEAETNVWK
FT                   LVARVLREREKRAVEQALAAFERALAEVRAALADVDPAVKAQARFKARRLEVLSDLARA
FT                   ALTVLKLLVDSSRADVGPIKALSEALARRD"
FT   gene            complement(447458..448318)
FT                   /locus_tag="A2cp1_0398"
FT   CDS_pept        complement(447458..448318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0398"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyltransferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: ank:AnaeK_0397
FT                   4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63755"
FT                   /db_xref="GOA:B8JAU4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAU4"
FT                   /inference="protein motif:TFAM:TIGR01475"
FT                   /protein_id="ACL63755.1"
FT                   /translation="MTVAALARMVKLSHSLFALPFAAAAVALVAAEARLDPARLALVAL
FT                   AVVAARTAAMAMNRIADRAFDARNPRTQRRELVTGEVSAAAAWALLGGSSAAFVAAAAL
FT                   ISPVCGALALPVLAVLLGYSYAKRFTWACHLWLGVAQALAPVGVAIALTGTAPLASVVL
FT                   GLGVGAWIAGFDVFYSMQDMDYDRGAGLRSIPARFGVAGALRWARGLHLAAAAAIFAAG
FT                   ALAGRGAGWITGSVILAATLAAEHRYVAPGGALRPERINVAFFNYNAFASIAFALCALA
FT                   DLALR"
FT   sig_peptide     complement(448226..448318)
FT                   /locus_tag="A2cp1_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.870 at
FT                   residue 31"
FT   gene            complement(448315..449553)
FT                   /locus_tag="A2cp1_0399"
FT   CDS_pept        complement(448315..449553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0399"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: ank:AnaeK_0398
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63756"
FT                   /db_xref="GOA:B8JAU5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAU5"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACL63756.1"
FT                   /translation="MIRVVAAPWVLPGLAPGAPAASAPAIADGAVALEGERVRAVGPRA
FT                   EVEARFGPGERLDAVLLPALVNAHLHLELSHMKGWVAGGEGLPGWIQLFVAARRRTREG
FT                   EPEEAMGMAAEDLVRAGVAAVGDISNTLDSLAPLAAAGLGGTIFHEVFGFTPERFEEAR
FT                   AAARQVREAAAPPPGLRVVESPHAIYSTNAAALRALLRSGPGSLHLAEDPAERAFCATE
FT                   SAGPFGRMYATLGAALHALRITGRSPVDAVKAELRPHHLAVHCVDLDDEDLRALAATGA
FT                   TVVLCPRSNRYILGALPRLEALLAAGIPLAVGTDSLASAPSLAPLAELALLRREVPAVA
FT                   ATRLLPLAWNGAALAAPHVGRLAPGAAPGVLAAPLEGARPPDPAEWLVSTFGAEERPFT
FT                   WLARQRPGPERPE"
FT   sig_peptide     complement(449470..449553)
FT                   /locus_tag="A2cp1_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.749 at
FT                   residue 28"
FT   gene            complement(449550..451430)
FT                   /locus_tag="A2cp1_0400"
FT   CDS_pept        complement(449550..451430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0400"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: protein of unknown function DUF178; Radical
FT                   SAM domain protein; KEGG: ank:AnaeK_0399 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63757"
FT                   /db_xref="GOA:B8JAU6"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAU6"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACL63757.1"
FT                   /translation="MPKKIRAAAVSFLNAWPLTAGLEGSERIELVLAEPSRCAAMLEAG
FT                   EVDLALVSVAALTKGQYDIVPGIAIGADGPVQTVVLAGEQSPAIWDEVFLDTASRTSHV
FT                   LAKLVLDAMGVHPKFTPMHADEGLARARGTKGALVIGDRGFGVRANHVLDLGREWTRLI
FT                   GLPMIFALWAARPGAVTPEDVQELTRAAQHGLGIRTELAQKFAAQKGGDPEKYRRYLTQ
FT                   KIRYGLGPYELQGLEAFLERAAAKGFLPPMPLRFVDDVVRTRRVRRAVSVDTALQKGAD
FT                   GERLDADEAATLDEKAPLLELGLAADQRRRALHPGDLVTYIVSRNVNYTNVCTTACHFC
FT                   AFYRPRGHQESYVLTREELTQKIDETVALGGIEILLQGGLHPDLGVEWYEDLFRWVKQT
FT                   WPVINLHALSPEEIWHIARTSELGLEATIDRLVAAGMDSIPGGGAEILDDEVRRRIAPL
FT                   KCSTDEWLTVMKAAHLKGLKSTATMMFGVGEGPEHRVAHLMRLRELQDETHGFTAFICW
FT                   PFQSQNTRLEPGDGSAHAYLRTNALSRLVLDNVPNLQASWVTMGGGVAQAALHMGCNDF
FT                   GQVMIEENVVSAAGTTFKMDSEEVERHIRDAGFRAARRNMKYQLVEETRA"
FT   sig_peptide     complement(451368..451430)
FT                   /locus_tag="A2cp1_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.747) with cleavage site probability 0.383 at
FT                   residue 21"
FT   gene            complement(451445..452611)
FT                   /locus_tag="A2cp1_0401"
FT   CDS_pept        complement(451445..452611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0401"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: ank:AnaeK_0400 radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63758"
FT                   /db_xref="GOA:B8JAU7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAU7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACL63758.1"
FT                   /translation="MLSILANRALERDGLGPIRDKVLAGERLTDADGLRLFEAADLPAL
FT                   GALANHVREARHGALAFYNRNVHLNPTNVCVASCKFCSFARKDDQRASDGYTMSIDEAV
FT                   GKVLSRKPLGVTEVHIVSGLHPDLPFEYYTELLSRIRAGWPEVAIKAFTAIEIHFFAEK
FT                   FGMSYEQVLRRLMDAGLQTMPGGGAEIFAPRVRRKICDDKATADQWIEIHRTAHRLGVK
FT                   TNSTMLYGHIERLDERVDHMRRLRELQDETHGFQVFIPLAFHPEHNMIGKAFPKPTGYD
FT                   ALRTLAVARLYLDNFDHVKAYWVSLGERLAQTALSFGVDDLDGTVLEERIYHMAGSTVP
FT                   QALSERTLHQLIRAAGRVPAERDSLYRVLKVHDAPLPEEPPARLQVTA"
FT   gene            complement(452613..453275)
FT                   /locus_tag="A2cp1_0402"
FT   CDS_pept        complement(452613..453275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0402"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG: ank:AnaeK_0401
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63759"
FT                   /db_xref="GOA:B8JAU8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAU8"
FT                   /inference="protein motif:TFAM:TIGR00421"
FT                   /protein_id="ACL63759.1"
FT                   /translation="MKLVVAVSGASGAPYARRLLDFLAANADLGVSADLVFTQTGKQVW
FT                   KQEIGAEPRYPFKIWKNQDFTAPFASGSSMYDAMVVIPCSAGALARIAYGISVDLVGRA
FT                   ADVMLKERKRLVLVLRETPISLVHARAMTQVIEAGAFVMPASPSFYSGPRTVDQVVDTV
FT                   VARVLDRLGIPNELMKRWDGLRHSDRGDEAPPDPPLAPGQAHPPDPALADLDDPEEP"
FT   gene            complement(453272..453979)
FT                   /locus_tag="A2cp1_0403"
FT   CDS_pept        complement(453272..453979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0403"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ank:AnaeK_0402 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63760"
FT                   /db_xref="GOA:B8JAU9"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAU9"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ACL63760.1"
FT                   /translation="MSVNVPLPGEAHRGSAVRAMFDRIAPRYDLLNRVMTLKVDQAWRR
FT                   RLLSDLAPKDGERMLDLCAGTMDVADLARRRAPGLRVTGADFSMQMLRRGVEKTALPAS
FT                   QADAMALPFLDARFDLATVTFGMRNLERYEVGLAELARVLRPGGRLGVLEFFRSESRGS
FT                   RLVHGAYNRLALPVLGRILSPDPEAYRYLVASMERFASRVEFEDAARRAGFREVRGETL
FT                   FPGVCGLVTAVRA"
FT   gene            complement(453976..455490)
FT                   /locus_tag="A2cp1_0404"
FT   CDS_pept        complement(453976..455490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0404"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: ank:AnaeK_0403 UbiD
FT                   family decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63761"
FT                   /db_xref="GOA:B8JAV0"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAV0"
FT                   /inference="protein motif:TFAM:TIGR00148"
FT                   /protein_id="ACL63761.1"
FT                   /translation="MAYRSLREFLARLDEAGELVRISEPVDPVLEMAALADRAAKQGGP
FT                   ALLFERPGALPVAMNLFGTRRRTSWALSCDDFEQHADALRALLRTAPPQSFWDKLKMLP
FT                   KLGKLAAMAPKHVSSGACQEIVDREPDLRTLPVLTTWPHDGGPFITLPQVITRDPETGI
FT                   RNVGMYRLQVLGPRRLALHWQLHKTATAHYRAYQQRGERMPVAIALGGDPALTYCASAP
FT                   LPPNVDEYLFAGFLRGASVHTVTGVATGLDVPADADLVIEGFVDTSAPLVREGPFGDHT
FT                   GFYSLADDYPALDVVAITRRKDAVYPATVVGPPPVEDQWLGKATERMFLPLMQVVAPEI
FT                   VDICMPVEGVFHNLCLVSIKKEHPGQAKKVIHGLWGSGQMAQTKTLVVFDDDVDVQDVP
FT                   QAAWRAFANVDVKRDLVIADGPVDVLDHAAGGFAFGGKIGVDATRKWREEGGREWPEVC
FT                   VHPPEVIARMDALYDRLVPGAAPLRRPRIAPPPAASWTPRRGGILQ"
FT   gene            455643..455918
FT                   /locus_tag="A2cp1_0405"
FT   CDS_pept        455643..455918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63762"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAV1"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0404"
FT                   /protein_id="ACL63762.1"
FT                   /translation="MERRNRARDLIVLALAELDGELSTNQHRLCPEQLGTCRSRLQGYL
FT                   SALDGDALPPKRDRAEDLGRLILDSWPYDVPLGQVILRAERAWRNA"
FT   gene            complement(455946..458675)
FT                   /locus_tag="A2cp1_0406"
FT   CDS_pept        complement(455946..458675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0406"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ank:AnaeK_0405 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63763"
FT                   /db_xref="GOA:B8JAV2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAV2"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL63763.1"
FT                   /translation="MRACVAALAALLLASCALGRPRLSTPACATGAEALPSGIQLVAYA
FT                   LPHRPDTLVAASYRVGSARDPAGKEGLAHLVEHLSFRARHGDGRALSARLEAEGVEFDG
FT                   RTSADATDFHAVGDPDQLEALLRIEADRLRDPLAGLDEAELRREREVVLQELALRGDPD
FT                   ALWPQVDWLTARALAGHPYGRIATPETLRAITLEDVRAFARAHYRPENLLLIVAGPASA
FT                   KAVAARARAALGELATRPGQAADPPVPPPELGAARPAALDVVRAPVERAWLLLTVPLPG
FT                   DAPAGGARAYLALRALEAQVEQVLSGPDRERALSVELLVHGMDGASLPVIRIGLRGPDD
FT                   ARPLVERLRAGMRFAGWQGGPDPGGEELRDRLVLDAHVRLEALDASEVARWIRLTGRTD
FT                   YLTGMPAAVGAAVTPDRAAFARRWLREERLVALAVVPGEAPRDDAPPRLPGASALDEDD
FT                   PHGAAAAGEPAPARDAARAMRPPHLDSARRRKLKNGVRVIVSPRPGYRVLSAHLVVRTE
FT                   PAGPLERVFEVLALRATRCADRPATVGGDRLEFGARAPTELVDLALAQVACRAGDLGVD
FT                   AAAFERERDAMADALRRRPPTLHEAAGQQLLELLYPGHPYSAEVTEARVRAFRAVDAGK
FT                   WLGLNVRPERAALVIAGDVAATDALFERIEQRLGRWRPRGGDGKLPPRPPAPLPGRREL
FT                   VVVDRPGWRVAEVLVGVRVPPRGARDEAAFRTLSWRLQHALTARLRDDAGLTYRVSLSI
FT                   LEQSLGSALVLSTAVDRARAGEALAAMLGELAASARPLEPEALAQARWRAVRRAGGGLG
FT                   TSWRNALRLTEMFVHGLPPDEWDTFAARTAALDARALVAEAGRWALGREAIVVVGDAAA
FT                   IAPALQDAGVPARVLPAIARRPAPGAAEPAPGPRAAVP"
FT   sig_peptide     complement(458616..458675)
FT                   /locus_tag="A2cp1_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.707 at
FT                   residue 20"
FT   gene            complement(458950..459999)
FT                   /locus_tag="A2cp1_0407"
FT   CDS_pept        complement(458950..459999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0407"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: ank:AnaeK_0406
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63764"
FT                   /db_xref="GOA:B8JAV3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAV3"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ACL63764.1"
FT                   /translation="MAAQEQAILSQLDASAQRGVRPERAQAALAGVPSLPESLLELEAQ
FT                   LTRATEDAEAKLQAAARHLVSAGGKRIRPMVTLLACGACGGEMRGAVPYAVAAELTHSA
FT                   TLLHDDVIDDGPVRRGQPASRVIWGNAVSVLSGDWLLTRALEIVSAEPARSAALPPLLA
FT                   TMRRLVEGEVLQLSLRGGFSATEQAYMDVVMGKTASLFGWAAAAGAWAAGEVGEIPAAL
FT                   VRFGEGIGVAFQLVDDALDYAADPRLLGKRLGTDLIEGKATLPLIRACEAEPALRGRLG
FT                   GVVDGTADVEAVAGEVIAVVKRVGGVDAARALAREHTRTALEALEQVPDGVHRRALHAA
FT                   ALQLTERAF"
FT   gene            complement(460098..461627)
FT                   /locus_tag="A2cp1_0408"
FT   CDS_pept        complement(460098..461627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63765"
FT                   /db_xref="GOA:B8JAV4"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAV4"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0407"
FT                   /protein_id="ACL63765.1"
FT                   /translation="MDPSRPGHRPLVDAPRALAALAFALHAACGGRYGIFRDELYFVAC
FT                   GRRLAAGYVDQPPGIAVVARLASELFGTWVPGLRLPAWLASAATVLLAGRLAARLGGGA
FT                   AGAALASAATLACGVLLALGHYLTMNAFEPLLVLALALLLVRLAEGGDPRLWVAAGAVA
FT                   GLGALFKYTSALVALALLAGVAATPARRALRTRWALAGAAAGLLAVLPNLAWQVAHGLP
FT                   FLELVRNGQLHKNAPTSPSAFALGLLRDANPLLAPLWLGGLGWLLARGAAPAARALGVG
FT                   AALYLALLAATGGKPYYAAPVLPLLLAAGGAAAAPLLRRPALRLAAPALAVLSVAPALP
FT                   LALPLLPEPAFVRWQAALGVEPERMERTAYGVLPQIFADQHGWPELVRGVGEAAATLAP
FT                   AERATAAVFGQNYGEAAAVEVYGPALGLPPAISGHNQYWLWGVPPGRGDPILVISDADE
FT                   DCGGAFHERVLAARLPSSPWVMPYEDARWIWICRGLRRPLAGLWPALRSYQ"
FT   gene            complement(461690..462949)
FT                   /locus_tag="A2cp1_0409"
FT   CDS_pept        complement(461690..462949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63766"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAV5"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0408"
FT                   /protein_id="ACL63766.1"
FT                   /translation="MRTAPVSAVVVLRPVALLAVALAAAALLARCGSGGDGGGAPPPGD
FT                   GGPNPPPAPPPGAPGWAVAAAERFEAALPDGAFAPDPVPDDGPFSDGGAFFASRSVTPP
FT                   AAFRASTPAGAGGWFTIESYTRRAGASTQELAEVVQDPADPSNHALRITSRAHTDATVL
FT                   RPSAPLPARYRISVRVGFPSFGDGVAGGLNGYDGPADAGPWWPGEDATRQNGFYWLTIL
FT                   DRLPRPHVNTWIHHHRKVVVDSDNHYPPWMEIWDGDRFVWSGEHPVMLFALDGTQPGTE
FT                   RAGPPFLSFSNGAWQPSGAIRAVDAYLPGTWYRLTIERDGPRYTIEVSGRFRYGGEQTY
FT                   RATVDAAARCVFHYPVDAAEAAGAARCVDEGAFASVGSAYPRWPAGGAWPDWFMLGDPH
FT                   VNYYEGSVLYDDLVLETWRE"
FT   sig_peptide     complement(462878..462949)
FT                   /locus_tag="A2cp1_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.374 at
FT                   residue 24"
FT   gene            463005..463742
FT                   /locus_tag="A2cp1_0410"
FT   CDS_pept        463005..463742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0410"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: ank:AnaeK_0409 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63767"
FT                   /db_xref="GOA:B8JAV6"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAV6"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ACL63767.1"
FT                   /translation="MPVVKLVLEYDGTAYVGWQVQPNGPSIQAEVERALATLHKAPRRV
FT                   TAAGRTDAGVHARGQVVSFPEERPLPVKAYVMGMNALLPPDVAVRAASLAPDGFDARRS
FT                   ARGKRYRYVIENLPTRAPLTRLQAWQHFHPLELANVREAAAHLVGRHDFAAFQASDCAC
FT                   EHAVREVRRLDVVGEGGGRIEVVIEATAFVKHMVRNIVGTLVEVGRGRRAPGSMLDLLA
FT                   RGDRTEAGPTAPPQGLFLEEVFY"
FT   gene            463848..464936
FT                   /locus_tag="A2cp1_0411"
FT   CDS_pept        463848..464936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0411"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: ank:AnaeK_0410 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase NAD -
FT                   binding; Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63768"
FT                   /db_xref="GOA:B8JAV7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAV7"
FT                   /inference="protein motif:TFAM:TIGR00978"
FT                   /protein_id="ACL63768.1"
FT                   /translation="MSQKKLKVGVLGATGMVGQRFVALLEHHPWYEVTLVAASANSAGQ
FT                   KYADAVKGRWALRSALPTATAGLTVKNASDVAAIAGEVDFVFCAVDMPKDETARLEEDY
FT                   AKHETPVVSNNSAHRGTPDVPMMVPEINPEHAAVIEAQRRRLGTSRGFVAVKPNCSLQS
FT                   YVPAIHPLMKFGPKRIAVATYQAISGAGKTFESWPEMVDNLIPFIKGEEEKSEKEPMKI
FT                   WGRVEGGRIVAAQDPVISAQCIRVPASDGHMAAVFVSFERKPSKDDVLELWKSFSGKPQ
FT                   KLGLPSAPKPFLQYFEDESRPQTRLDRDAGNGMAVTIGRLRPDAIFDYRFVCLSHNTVR
FT                   GAAGGAVLTAELLTSDGYIQAK"
FT   gene            465104..465547
FT                   /locus_tag="A2cp1_0412"
FT   CDS_pept        465104..465547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0412"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   ank:AnaeK_0411 hemerythrin-like metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63769"
FT                   /db_xref="GOA:B8JAV8"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAV8"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ACL63769.1"
FT                   /translation="MRFVDASQIPELPLPFMNEDHAEEMRLLEGLGEALEAHRARTGGL
FT                   ETVLERLSLLAVHTREHFLREEQVMRETGFPAYPQHKGEHDRVLAEMDGEARAFREGGD
FT                   PVRLRGYLFETVPAWFVQHIRTMDAMTARFVVSRPGASGAAAV"
FT   gene            complement(465555..466397)
FT                   /locus_tag="A2cp1_0413"
FT   CDS_pept        complement(465555..466397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0413"
FT                   /product="Water Stress and Hypersensitive response domain
FT                   protein"
FT                   /note="SMART: Water Stress and Hypersensitive response
FT                   domain protein; KEGG: ank:AnaeK_0412 water stress and
FT                   hypersensitive response domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63770"
FT                   /db_xref="GOA:B8JAV9"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAV9"
FT                   /inference="protein motif:SMART:SM00769"
FT                   /protein_id="ACL63770.1"
FT                   /translation="MRPLGHAALAALAALLALTVACGGRAVRTPPLAVDPPAFRPEALL
FT                   PTGADAYGVALALSGRIENPNPVALPVAGFTYAFEVMGAPAGGGQVASDLVLPAGGAVP
FT                   VTVPVRLRWADVPGFLEALATRPAVPVTVSGAARVRAGGGTVAAPYRIDGSVVLPRLPT
FT                   VTLADAVVRESTLFHTVVELRVSVRNPNPFPLPTGRLSYDLSVSGVPVIQAAKSPLDAV
FT                   PPQGQATVVVPVRFSTVGAAAGALAGAVRGRADLSMSGRAGYGALEVGVDLRGALAAR"
FT   sig_peptide     complement(466296..466397)
FT                   /locus_tag="A2cp1_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.397 at
FT                   residue 34"
FT   gene            complement(466526..469138)
FT                   /locus_tag="A2cp1_0414"
FT   CDS_pept        complement(466526..469138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0414"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="KEGG: ank:AnaeK_0413 ATP-dependent chaperone ClpB;
FT                   TIGRFAM: ATP-dependent chaperone ClpB; PFAM: AAA ATPase
FT                   central domain protein; Clp domain protein; ATPase
FT                   associated with various cellular activities AAA_5; ATPase
FT                   AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63771"
FT                   /db_xref="GOA:B8JAW0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAW0"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ACL63771.1"
FT                   /translation="MRMEKLTVKAQEVLAAAQGEARRRDHQAVDVEHLVLALLAQEEGI
FT                   ARPVLEKIGADPRLVASRVEDELRSLPKVSGAEPYPANRLLKLFDRAEDEARKLKDEYV
FT                   STEHLLLAAAEDKGGAGEALRASGATPERVRQAVQEVRGGARVTSPEAESQYRALEKYA
FT                   KDLTDLARKGKLDPVIGRDDEIRRVVQILSRRTKNNPVLVGDPGVGKTAIVEGLARRIV
FT                   DGDVPEGLKNKRLLALDLGALLAGAKFRGEFEERLKAVLKEVTGSEGQIILFIDEMHTI
FT                   VGAGAAEGAMDAGNMLKPALARGELHAVGATTVNEYRKHIEKDPALERRFQPVFVGEPS
FT                   LTDTISILRGLKDRYELHHKVRIQDAALVEAARLSSRYITDRFLPDKAIDLVDEAASRL
FT                   RIEIDSMPTEVDEVRRRIGQLEIERQGLRKEQDEASRARLAAVEKELAARNEEFTALKG
FT                   RWDAEKAVIQELSQARQELEALKVEQAAAERQADFQKAAEIKFGRLPELTRRVKAAEEK
FT                   LAEAQTRGAMLKEEVTPEEIGEVVSKWTGIPVSRLMEGEVEKLLGMEQRLHERVVGQEE
FT                   AVSAVSAAVRRARSGLQDPNRPIGSFIFLGPTGVGKTETARALAQFLFDDERAMVRLDM
FT                   SEYMEKHTVSRLIGAPPGYVGYEEGGQLTEAVRRRPYAVVLFDEIEKAHHDVFNVLLQI
FT                   LDDGRLTDGQGRTVDFRNTVIIMTSNIGSADIQRLAGRPGADMQQIREAALEHLRGEFR
FT                   PEFLNRVDEIVVFRPLGREDVGRIVEIQLGRLRKLIEERHVSLELTEAAREAIADAGYD
FT                   PVYGARPLKRAIQRMVQDPLATRLLQGEFKAGDHVVVDEGKDGNIAFRKGERPEVTVH"
FT   gene            469344..470795
FT                   /locus_tag="A2cp1_0415"
FT   CDS_pept        469344..470795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0415"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: ank:AnaeK_0414 peptidase
FT                   S1 and S6 chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63772"
FT                   /db_xref="GOA:B8JAW1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAW1"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACL63772.1"
FT                   /translation="MASGGQGWKAMALAAALGVLGTPGTAAAGPKAAGAAPAQVPAKAK
FT                   APAGTGLLRALDAALGEVIEKISPAVVQVTVSGYAPADETASGAIVRQRVLGSGVVVDP
FT                   NGYVVTNAHVVAGAQRVRILLPEGRGPAAHTARRIYDARVIGVEPEIDLALLKIDARNL
FT                   PVLALGRREVRPGQLVFAVGSPEGLASTVTMGVVSSVARQPDPARPVVYIQTDAPINPG
FT                   NSGGPLVDTDGNVVGINTFILTQGGGSEGLGFAIPSDVVKYVYESLRRHGRVEHSMIGL
FT                   AAQGITPGLAAGLRLSQDWGVVVGDVAPGSPAEKAGVLAGDVIVSVDGRPIDGMPSLAP
FT                   AIYLHPADAPLALVLRRGEDVLSVKVAGVEPRRPAERLAEVADLARSTVPRLGVVAMDL
FT                   DAQARAAMPELRSPAGVVVVARVPEAGQAGAALEPGDVIHAVNRTPVASLAALKAAVAA
FT                   LPPGGPGVLRVERRGQLSWIELDLD"
FT   sig_peptide     469344..469430
FT                   /locus_tag="A2cp1_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.896 at
FT                   residue 29"
FT   gene            470874..472010
FT                   /locus_tag="A2cp1_0416"
FT   CDS_pept        470874..472010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0416"
FT                   /product="chalcone and stilbene synthase domain protein"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   FAE1/Type III polyketide synthase-like protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: ank:AnaeK_0415
FT                   3-oxoacyl-(acyl-carrier-protein (ACP)) synthase III domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63773"
FT                   /db_xref="GOA:B8JAW2"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAW2"
FT                   /inference="protein motif:PFAM:PF00195"
FT                   /protein_id="ACL63773.1"
FT                   /translation="MQRAPRPRIRWVSPRRSPVPSTSPNPEVLSVGRALPATVADQETL
FT                   IAALSAHWGEAHFNTGRLAELHRATGVARRHLALPLEAYPRLGGFGEANAAYARAGAEL
FT                   GEAAVRDALERAGLAPSDVGHLFYVTVTGVATPSLDARLVNRMALPRSVKRTPIFGLGC
FT                   LAGAAGLARASDALRAFPDEVAVLLSVELCSLTLQRDDASMANVIATGLFGDGAAAVVL
FT                   GGGARPATARPRGPEVVATASVLYPDTEWVMGWEVVDGGFKVLLSSKVPDVIAANLGAD
FT                   VDRFLGAHGLDRGRIRHWVAHTGGPKVLEAVGGALGLPRAALERSWRSLHDIGNLSSAS
FT                   VLFVLGDLLDSGEARPGDLGLLAAMGPGFAAELVLLRW"
FT   gene            472004..472306
FT                   /locus_tag="A2cp1_0417"
FT   CDS_pept        472004..472306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63774"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAW3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0416"
FT                   /protein_id="ACL63774.1"
FT                   /translation="MVSAREVGQPAGDDAEGRVAAEIVRIARDELRLDGAHAALAAGRD
FT                   APLVDALDSLARLSLAVAVEDRFRIALDDEAGLAVRTLGDLARLVVARAAPELLP"
FT   gene            472303..474063
FT                   /locus_tag="A2cp1_0418"
FT   CDS_pept        472303..474063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0418"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ank:AnaeK_0417 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63775"
FT                   /db_xref="GOA:B8JAW4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAW4"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL63775.1"
FT                   /translation="MRLRGPPQPPPRHTTLVHALAAAAAHPSGATFLDLHERETSLPWS
FT                   EVRARAERAAANLVHLGIRRGDRVAIVLRTEPAFLDAFFGAWLAGAVPVPLYPPVRLGR
FT                   LDAYAVDTGRMIQVAGARLVVSAGGTRRLLGGAVERGGPELGCVDVSALSALPARIARE
FT                   PEPDALGLVQFSSGTTVDPKPVALTHRALAAMTDALVAATSAGPDDVLVSWLPLYHDMG
FT                   LIGCLLAAMSYPGPLVLIPPEHFLTRPALWLRALARRRGTISAAPSFAYAYAADRVQDA
FT                   DLAGLSLAPVRLLLDGAEPVSAVALRRFAERFAPHGLDPRALVPVYGLSEAALAVTFAR
FT                   PGGPLGGLGVDAARLASEGVVAPGGREVMPVGTPVPGVEVELRTEAGAPVGEGRIGRVF
FT                   VRGPALMREYLGDPEATARALRGGWLDTGDLGFVVDGALHLHGRARDLVIVRGANHAPE
FT                   EFEAPLAALPGLRPGCAVALGFEPEGGAGEALLVLAERARDEETPDGELEARVRRAVLA
FT                   ATGIAPHTVRLLAPGTLPRTSSGKLRRAEALRRFQAGTLTPPQPVSAIRLALAAARSQL
FT                   AFGRSRRRGG"
FT   gene            474070..475161
FT                   /locus_tag="A2cp1_0419"
FT   CDS_pept        474070..475161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0419"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; HI0933 family
FT                   protein; FAD dependent oxidoreductase; KEGG: ank:AnaeK_0418
FT                   monooxygenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63776"
FT                   /db_xref="GOA:B8JAW5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAW5"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACL63776.1"
FT                   /translation="MRLRDAVVVGGGPAGLAFAAAAAARGLDVLVLERRRGPVDKACGE
FT                   GILPAGVAALERLGLRARLGPAQARPLRELRWVDASGAAARLVLPGPGGLGVRRLALEA
FT                   ALRARAREAGAELQEGAEVTEHRVLADRVRIAVAGGAAAEGRVLVAADGLGSPTRRRAG
FT                   LERPVRAPERFGVRRHVDVPDAGDAVEVHFGDGVEAYVTPVGPRQVGVAFLFERGAARS
FT                   FEALLGRFPALAARLEGAAFASPARGAGPLARAARARVADRLVLLGDAAGYLDAVTGEG
FT                   LSLAFGCALDLAALLPGALARGATARDLGAYEAAWRRRYGPYARWTRLVLALARHPAVR
FT                   RRVIALAAAAPRPFERAVAAAVG"
FT   sig_peptide     474070..474144
FT                   /locus_tag="A2cp1_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.540 at
FT                   residue 25"
FT   gene            475328..476293
FT                   /locus_tag="A2cp1_0420"
FT   CDS_pept        475328..476293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0420"
FT                   /product="Curli production assembly/transport component
FT                   CsgG"
FT                   /note="PFAM: Curli production assembly/transport component
FT                   CsgG; KEGG: ank:AnaeK_0419 curli production
FT                   assembly/transport component CsgG"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63777"
FT                   /db_xref="GOA:B8JAW6"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAW6"
FT                   /inference="protein motif:PFAM:PF03783"
FT                   /protein_id="ACL63777.1"
FT                   /translation="MRIRFALPVAALALQACATVSQPPVEVESPVPKAAQVAAQQQAQA
FT                   PAPSAKRYKTRIAIARFTNETSYGRSLLNDADLDRIGKQASDMLASRLVMSGNFVVLER
FT                   PDLQKLEREQALRGVAGLVGADTVISGSVTEFGRSVGGKKGFLSSTKVQTARAKVDIRL
FT                   VDVKTGHAYFSALGAGEASTESGEIAGFGSRAEYDATLNDRAIAAAISDVIDRLVSTLA
FT                   ARPWRSDILEVQGRQVFISGGRHQGVREGDVLAVMEAGNTVKSRQTGFEVALPPKRVGT
FT                   IKVLSLFGDGETSEGAVCEVTSGTIEKAVLPKLFVAEATP"
FT   sig_peptide     475328..475384
FT                   /locus_tag="A2cp1_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.489 at
FT                   residue 19"
FT   gene            476302..476604
FT                   /locus_tag="A2cp1_0421"
FT   CDS_pept        476302..476604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63778"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAW7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0420"
FT                   /protein_id="ACL63778.1"
FT                   /translation="MRNVVFAAAAAALVAGCAMPQTVVKTVESRPSLAVAGAPAGAVLV
FT                   VDGQPVGEASAYDGNPTVLRVEPGTHQVEIRDPSGAAVYRQTVFVESELKTVRVH"
FT   sig_peptide     476302..476376
FT                   /locus_tag="A2cp1_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.387 at
FT                   residue 25"
FT   gene            476604..477086
FT                   /locus_tag="A2cp1_0422"
FT   CDS_pept        476604..477086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63779"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAW8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0421"
FT                   /protein_id="ACL63779.1"
FT                   /translation="MRASLRAVLVLAATAALLQGCAGRTLYRWGAYDDALYAHYKNPQD
FT                   REAFVERLRVVIDEADQAGEKVPPGCYAEYGYALYEEARYEDASRYFKLERERWPESGV
FT                   LMQKMIGLADRRGGKEPVPPAPAKPASAPPKATKAPAKAPAKAAATHGPAGALERR"
FT   sig_peptide     476604..476672
FT                   /locus_tag="A2cp1_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.455 at
FT                   residue 23"
FT   gene            477089..477763
FT                   /locus_tag="A2cp1_0423"
FT   CDS_pept        477089..477763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0423"
FT                   /product="protein of unknown function DUF799"
FT                   /note="PFAM: protein of unknown function DUF799; KEGG:
FT                   ank:AnaeK_0422 protein of unknown function DUF799"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63780"
FT                   /db_xref="InterPro:IPR008517"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAW9"
FT                   /inference="protein motif:PFAM:PF05643"
FT                   /protein_id="ACL63780.1"
FT                   /translation="MERLASLAGRIASLAALVALLSACGTAQVKKDYGAFNTARPRAIL
FT                   VVPVVNKSVEIDAPEYFLSTLPVPVAERGYYVFPVNLVKRVLEDDGLADASLVHGADPV
FT                   RLCSLFGADAVLLASIEKWEAKYMVVTTQVNVEFEYVLKDGKTGQTLWTERRSMSYQPS
FT                   NSGGGLIGALVNAAVTKASPNYMPLARQANAQAFAWPGPGFPAGPYRPEYGQDLQVMAA
FT                   QP"
FT   sig_peptide     477089..477178
FT                   /locus_tag="A2cp1_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.565 at
FT                   residue 30"
FT   gene            477822..478550
FT                   /locus_tag="A2cp1_0424"
FT   CDS_pept        477822..478550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0424"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; KEGG: ank:AnaeK_0423
FT                   tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63781"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAX0"
FT                   /inference="protein motif:PFAM:PF07721"
FT                   /protein_id="ACL63781.1"
FT                   /translation="MSKLLLFYLLVQLTGSPLGALALLLAVWWATDRMTVGVLPDPLRG
FT                   VARWRRRLQLARALEVNPHDRRARLELADLLLAGRRPARAAQVLRPNVEAGDEDAHTAF
FT                   LMGAALGRSGQSDPAERALAVARAADPDFRAGEIDLELGRQRLGRGDAAGAREALERLL
FT                   VERPGSVEGRLWLARALDKLGDRDGARRRREEGWREYVSLPRFHRKHERPFAWRLQPWR
FT                   PTAVALGVVLVLAAVAAAAG"
FT   sig_peptide     477822..477890
FT                   /locus_tag="A2cp1_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.743 at
FT                   residue 23"
FT   gene            478668..479666
FT                   /locus_tag="A2cp1_0425"
FT   CDS_pept        478668..479666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0425"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   Ketopantoate reductase ApbA/PanE domain protein; KEGG:
FT                   ank:AnaeK_0424 glycerol-3-phosphate dehydrogenase
FT                   (NAD(P)(+))"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63782"
FT                   /db_xref="GOA:B8JAX1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8JAX1"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ACL63782.1"
FT                   /translation="MRATVLGAGSWGTALASLLAGKGYTVTSWDKDAAVLDDIARNHRN
FT                   ERYLPGLQLPPTLHASGEVAKALEGAELVVLAVPSHAVRPVVIEAKRHVHAGTPIVCVA
FT                   KGIELDTLMTMTEVIEDVLPVPLHPYLAVLSGPSFAKEVAKGLPTAVTVAARWERIAKQ
FT                   VQDAFHTKTFRPYTSGDVVGCEIGGCVKNVVAIAAGISDGMGFGANAMAALVTRGLAEI
FT                   TRLAVRKGANPLTLSGLAGLGDLVLTCSSDLSRNRTVGRGLAAGKTADAIQRELGQVAE
FT                   GVRNARSARELAKRLGVEMPITEAIYRVLYEGLAPREAVTALMMRETKPEL"
FT   sig_peptide     478668..478730
FT                   /locus_tag="A2cp1_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.808) with cleavage site probability 0.260 at
FT                   residue 21"
FT   gene            479778..481724
FT                   /locus_tag="A2cp1_0426"
FT   CDS_pept        479778..481724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0426"
FT                   /product="Thimet oligopeptidase"
FT                   /EC_number="3.4.24.15"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: ank:AnaeK_0425 thimet oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63783"
FT                   /db_xref="GOA:B8JAX2"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAX2"
FT                   /inference="protein motif:PRIAM:3.4.24.15"
FT                   /protein_id="ACL63783.1"
FT                   /translation="MSEPLRPEASRELTGTPPAFTEGCRRDMDRARAEAARARALGPAG
FT                   GLATLEAFDAAFAALSEAASRASLARNVHPDPALRDAAEAAEREVDALSTELSLDRGLY
FT                   DALAGLDPSGLDAPTRHLVEKSLRDFRRAGVDRDDATRARVKALREELVRVGQEFGRNI
FT                   KDDVRRLEVEPAALDGLPEDWRRAHAPGPDGRVTLTTDNTDYVPFLTYARSAAAREALW
FT                   RLYRLRGHPRNLEVLSRMLARRADLARLLGYPSWAAYVTEDKMIGSDGAAADFIERIAR
FT                   AAEARMRRDHAQLLERKREERPDADRVEPWDSAWLQERVKAERYGFDSQSVRPYFEYQR
FT                   VKQGVLDVTGRIFGIAYRRAPDAPVWHPEVEAWDVIEDGALLGRVYLDMHPRDGKYKHY
FT                   AQFTLASGQAGRRLPEGVLVCNFPRPAPGAPALMEHGDVRTFFHEFGHLLHHVLGGHTR
FT                   WAGQSGVATEWDFVEAPSQMLEEWVWDPEVLATFARHVDTGEPIPAELVARMKAADEYG
FT                   KGLMVRQQMFYAATSLELHRRDPGALDTTALVAELQERYTPFRHVPGTYFQESFGHLDG
FT                   YSAIYYTYMWSLVIAKDLFGPFREAGLLDPAPARRYRRAVLEPGGSKPAAELVKDFLGR
FT                   PHAFDAFAAWLEA"
FT   gene            481932..482909
FT                   /locus_tag="A2cp1_0427"
FT   CDS_pept        481932..482909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0427"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: ank:AnaeK_0426 oxidoreductase
FT                   FAD/NAD(P)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63784"
FT                   /db_xref="GOA:B8JAX3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAX3"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACL63784.1"
FT                   /translation="MAGRRSPAYVLSMSEPALETRAIRTAVPPEGEPVRAEVPRRRIKD
FT                   LEVMVADVIQETPDTTTLVLFTGNDRLDYLAGHFLTIDPRQFPALERWVAYLEDLKGKR
FT                   EAPRAYSLASAPHERYLAITVKEETYQSGRTRYPPLLSPMLVRRTPRGSRFVITGFTGP
FT                   YVLPPRVEEKTDHLVHVVAGSGSVPNWSILKHALREHPRLRHTFVYSNRTWDDVIYRDG
FT                   LRQLEAEHPDRLRVVHTLTREPEPERHGPGVRRGRISAELLRELVPDPRAALWYACGPA
FT                   VGPIERAAAKERGETPAPRFLEAALAALDELGVPRDRVKRESYG"
FT   gene            482967..483764
FT                   /locus_tag="A2cp1_0428"
FT   CDS_pept        482967..483764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0428"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   ank:AnaeK_0427 protein of unknown function DUF990"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63785"
FT                   /db_xref="GOA:B8JAX4"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAX4"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ACL63785.1"
FT                   /translation="MPRTLRAIPTLLKVGFAEAVAYRAEMVVWLLSTNMPLVMLALWTA
FT                   VARDAPVGRFGQRDFVAYYLATLVVRLLTGAWVIWELNYEIRQGTLAFRLLRPVHPLLA
FT                   YAAENLSAIPVRLLVSLPIALGALLVVGRDRLTGDPLLLALFPVTVLGAWLITFLAMAI
FT                   IGALAFWIDQAGSLFEIWLGLFGVFSGYLVPLELFPHWVATAARFLPFRYMLAFPVEMI
FT                   IGMTPRSAALAELAIQWTFVGALALGARGAWALGLRRFAAFGG"
FT   gene            483765..484553
FT                   /locus_tag="A2cp1_0429"
FT   CDS_pept        483765..484553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0429"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   ank:AnaeK_0428 protein of unknown function DUF990"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63786"
FT                   /db_xref="GOA:B8JAX5"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAX5"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ACL63786.1"
FT                   /translation="MRRYLRLLAVQFRASAAVAMQYRVEFLVEGALALFWTGWSLVPLL
FT                   VVYGSRDAVAGWSFDEALVVMGWFTLMKGVLEGAVNPSLTTVVEHIRKGTLDFVLLKPA
FT                   DAQFLVSTAKFEPWRIIDVLGGLVIFAVAFHRMGRAPAPGGVLAACLLFAAATVILYSL
FT                   WIIVVAAAFFVVKVDNLSFLFVSIYDAARWPASVFRGALRVIFTFVVPLAVMTTFPAEA
FT                   LLGRLAAPRALLIAAGAVAFAGLARAVWLRSISRYTSASS"
FT   gene            484580..485536
FT                   /locus_tag="A2cp1_0430"
FT   CDS_pept        484580..485536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0430"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="KEGG: ank:AnaeK_0429 ribonuclease Z; TIGRFAM:
FT                   ribonuclease Z; PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63787"
FT                   /db_xref="GOA:B8JAX6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAX6"
FT                   /inference="protein motif:TFAM:TIGR02651"
FT                   /protein_id="ACL63787.1"
FT                   /translation="MPPGPRFDYIPAGMLRLTFLGTSAAQPTIRRNLTGHAVRRERELF
FT                   LVDCGEGTQRQLIQFGAGFDVAAIFFTHFHADHYLGAIGFLRTLSMQNRAEPLDLYGPR
FT                   PAKRLLETMLFTGAERFSYEVRIHEVRAGEAVRRDGCAMVPFPTEHRTPSLGWALREDA
FT                   RPGRFHPDKAEALGIPKGPLFGALQRGEPVTLPDGRTVRPEEVVEPARRGRALVITGDT
FT                   RPCAATVEAARGADVLVHDCTFGDGEAERAEETLHSTARGAAQVAHDAGVVRLVLTHLS
FT                   TRYDRAWEPLVEQAREVWQGPLDVAHDGMVLEVPLPA"
FT   gene            485626..486330
FT                   /locus_tag="A2cp1_0431"
FT   CDS_pept        485626..486330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0431"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: ank:AnaeK_0430
FT                   pirin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63788"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAX7"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ACL63788.1"
FT                   /translation="MITVRKSEARGHVDHGWLDTRHTFSFADYHDEAHMGFRALRVVNE
FT                   DRVKPGEGFGTHGHRDMEILTYVLGGTLAHRDSTGGGGRLRPGEVQRMSAGTGVMHSEF
FT                   NGSDREEVHFLQIWILPDRQGVKPSYEQREVPEAERRGRLRLIAAPDGAEGATTLHADA
FT                   RVYATLLAVGERAALPLAAGRHAWVQVARGEATVNGERLRAGDGAALSGEAEVALAGAG
FT                   EGTAELLVFDLS"
FT   gene            486463..487719
FT                   /locus_tag="A2cp1_0432"
FT   CDS_pept        486463..487719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0432"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; Ribosomal small subunit Rsm22; KEGG:
FT                   ank:AnaeK_0431 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63789"
FT                   /db_xref="GOA:B8JAX8"
FT                   /db_xref="InterPro:IPR015324"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAX8"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACL63789.1"
FT                   /translation="MASPRPAAARSLFRRRAGWTRTTGVPNTPADDLARWVPRLLATWR
FT                   AARKGPPRRGPRPPPDALLPEELREVGAAVARLSRGLTRDRELAGARYMDEERLLGAYL
FT                   LFYWPVSYLQARGVLSELPRRPRAVLDLGSGPGPMAFAALDAGAAEVTAADRSARALAA
FT                   ARELARHAGEPLATREWNPARAGLAALAGGRRFDLVSMGHVLNELWKGQDEDRRRAGLL
FT                   EEALALVAPGGSLLVIEPALRDTSRALLRVRDLLVERGAAVRAPCLFRGPCPALLRETD
FT                   WCHAERPVDPPPLVAQIAKAAGLRREAVKMSYLVVAPPGEAWQAPPAGKVFRIVSEPLP
FT                   SKGRLRYMGCGPEGRMGLSLQEKHVRPENRAFERLLRGDVVEVTGAEPRGDGLALGEAS
FT                   TVKVLAPAGRPVPPPRGER"
FT   gene            complement(487728..488732)
FT                   /locus_tag="A2cp1_0433"
FT   CDS_pept        complement(487728..488732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0433"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ank:AnaeK_0432 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63790"
FT                   /db_xref="GOA:B8JAX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAX9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL63790.1"
FT                   /translation="MIQVRALAKHYRVARRPPGLAAAVRALFHRTYETVRAVDGIDFSV
FT                   GEGERVGFLGPNGAGKTTTLKMLSGLLHPTAGDVTVAGHVPRRREPAFLKAITLVMGQK
FT                   QQLIWDLPPAETFELNRAVYDIPRDRFQETVAELTELLELGPLVQKPTRQLSLGERMKC
FT                   ELAAALLHRPRVLFLDEPTIGLDVSMQATVRQFVKAYNERYGASVILTSHYMEDVLQLC
FT                   PRVVVIDHGRIIYDGDLRALAHRMRPDKRIVLRLATGNGAGPSGGDLARFGQVVSAEPG
FT                   SATLQVAAEEVSAVVARLLAAMPVTDLTVEDPPLEEVFSELFRASRRAAEPAK"
FT   gene            488804..489781
FT                   /locus_tag="A2cp1_0434"
FT   CDS_pept        488804..489781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0434"
FT                   /product="ParB domain protein nuclease"
FT                   /note="SMART: ParB domain protein nuclease; KEGG:
FT                   ank:AnaeK_0433 ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63791"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAY0"
FT                   /inference="protein motif:SMART:SM00470"
FT                   /protein_id="ACL63791.1"
FT                   /translation="MAATKKKRPVTKTGRPRARKGVTLKPTELGAQQVALAERPPELEA
FT                   LAQAVEADGGAVLAAYREPLGGHPLLFVALPVEKVERTAFQRDVSDAHVRKLTLAMDKT
FT                   RRYLDPIVAVREGERYLTPNGGHRLTALKELGARTVLALLVPEREVAYQILALNIEKAH
FT                   NLREKALEVVRMYRDLAGALDPRESEMALEFEEPALVTLGFAYEQRPRLSGGAYAPILR
FT                   KVDALSDEKLSRALAERERRAAVLLAFDDAVGEAVARLKARGFDSPYLKNFVVARVNPL
FT                   RFMKGAAPPFDELFAQMTKRTQGMDPGKIKSEDVARSGGAAEAE"
FT   gene            complement(489799..490281)
FT                   /locus_tag="A2cp1_0435"
FT   CDS_pept        complement(489799..490281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0435"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: ank:AnaeK_0434 hemerythrin HHE cation binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63792"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAY1"
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /protein_id="ACL63792.1"
FT                   /translation="MRRSRQLKPLSSEHHQAMLVAFQLKMGLAGHPESAGAPKDLPGLL
FT                   ALARRFDEQVFRTHSRTEEDVLGRHLTGADLHRLGSEHAELTRLLESARTARPQELRAA
FT                   LTAFAELLERHVRWEEREVFPYAEDHVDEATLATIGGELELRLVLARTEARGAQRR"
FT   gene            490451..491758
FT                   /locus_tag="A2cp1_0436"
FT   CDS_pept        490451..491758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0436"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: ank:AnaeK_0435 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63793"
FT                   /db_xref="GOA:B8JAY2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012806"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAY2"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACL63793.1"
FT                   /translation="MGMNGSPPPGRRAAVVAGLRTPFVKAGTDFKDLSATDLGALVVNE
FT                   LVVRSGLPPEAFDSVIFGQVIPSPTVTLIGREMVLRTQLPRSVQAHTVARACATSIQAA
FT                   TDAADQIRLGHSDCAIAGGAESVSDAPIFASRPLAQALVELSRARTLAERARILAGLRP
FT                   KDFTPTPPALKEPTTGLTMGESAERMAQVNGISRAAQDRLAYESHRRAAEAWDAGRFDE
FT                   EVMHVPVPPRYDHVAARDNIVRKDTTVEALAKLRPVFDRKYGTITAGNASPLTDGAAAL
FT                   VIMSEERAKALGMKPLGFLKAYAYAALDPRDQLLQGPAYAAPVALERAGLRLADMDLVD
FT                   MHEAFAAQVLSNLQAFASKDFAERELGRSEPLGEVDPAKLNVNGGSIALGHPFAATGAR
FT                   MILQTLRELGRRGGQHALITVCAAGGLGAAVVLERE"
FT   gene            491811..493988
FT                   /locus_tag="A2cp1_0437"
FT   CDS_pept        491811..493988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0437"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   ank:AnaeK_0436 3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63794"
FT                   /db_xref="GOA:B8JAY3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAY3"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACL63794.1"
FT                   /translation="MMSAEAMTAGQGASRYFRVEVAGGVATLVLDEPGERVNTVHPEAM
FT                   REFAAHLDRLEKDEAVKAVVVASGKPDVWVAGAKVELMQDAKDAAEAERLSRDGQSLFD
FT                   RVERCRKPVVAAIHGACLGGGLEWALACHYRIATDHPKTSLGLVEVQLGLIPGGGGTQR
FT                   LPRLIGIQPALDLILAGKTVKARKALKLGLVDEAVPPPLLRQVAQERAAALASGKLRRA
FT                   PRRAAGAVARVTRAALEENFLGREVLFRQARKLTLAKTKGHYPAPLRALEAIEHGYAKG
FT                   FEKGLEKEAELFGKLAMTPEAHRLMEIFFATTALKKDNGVDDPAVKARPVSAVGVLGGG
FT                   LMGGGIAYVTVNAGLPVRLRERDDAAAARGVAAVRGVLDERVKRRSIDRLERAEKLRLL
FT                   TTTTAWSGLERVDVLVEAVFEDLSLKQEMVRAFEAVNPTGIFASNTSSIPIGRIAEASR
FT                   HPETVLGMHYFSPVHKMPLLEVIVTPRTAPEATATAVALGKKQGKTVIVVRDGPGFYTS
FT                   RILAPYMNEAAHLLVDGAAVEDLDHALVAFGFPVGPITLLDEVGIDVGDKVGKILQEAF
FT                   GARMAPPAALHDVVKAGRLGRKNGKGFYTYGGKEKRVDETVYDLLPGGRRRRRVAADEI
FT                   QERLVLQLVNEAIRCLGEGILRSARDGDVGAVFGLGFPPFRGGPFRWADAVGTKALLDR
FT                   LERLRARHGERFEPAPLLAELGRAGRPFHGG"
FT   gene            complement(494107..496482)
FT                   /locus_tag="A2cp1_0438"
FT   CDS_pept        complement(494107..496482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63795"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAY4"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0437"
FT                   /protein_id="ACL63795.1"
FT                   /translation="MQNVMRYSGALFFAGVLALAGCKGSDGDVGPQGPAGQDGQPGQPG
FT                   QPGQPGQDLTATAKPESCSVCHGSAGGQHQAIYNNFSDGLDPATSKLQISNITVVSVAG
FT                   TAAGTFDSTLTFNVTVDGQPYTAGIAALKQKRFTATQFDVATNTFTTDTAFSWGTPTHV
FT                   ANGQYTATKTGAAFAPETSNAFVYLYLGDKLILPAEGHYNLMDNVASAGVTYGTWSYTS
FT                   VANVAGCEKCHPAPYAKHGYRQATVNGLQDMVACKACHTDQREGTDFVFQILGDDPAAA
FT                   AALTTDASGETIYSADQMTKYAYTATIVNDTHMSHAMEFPYPQSMANCVTCHEGKLELI
FT                   LTDANFTVKTCKSCHPVTGTGANAPALKDVVSVMPYHPTDFYATQVACNDCHKAGGMGP
FT                   VFSRIHTGYNKAIYKDAATKYATAITSAVSSATFDSATNKLTVKFTVTGADADALVKPT
FT                   VVAGLYGYGTKDMYVSGHNGQADGTRNLEWSEGAVQRGDPTKSANSNRLTVTPATAAAG
FT                   QAEWTAVADLTLWANLIADGTVQKVEIAFLPVLGLDQGAAVSATNAAIAVAGKSVTFDL
FT                   AANAIVPDADAYGKAIVSTSKCNACHESLGTTFHSPSYGSAGVVACRICHTPRDGGSHL
FT                   EMQSRSIDSYVHAIHSFQVFDVAGIDFANPVEKMEYEHHIGSAYPNFTILNCKSCHEDG
FT                   TFEVPDQTKSLPGVFSKAAANTSWDRTIGAVPMYVSGPASRACGSCHRSQDINADAAGD
FT                   LASFNQHAATFGFLLETSSATAGADYEAAIAKIFSIFN"
FT   gene            497232..498134
FT                   /locus_tag="A2cp1_0439"
FT   CDS_pept        497232..498134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0439"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ank:AnaeK_0438
FT                   integral membrane sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63796"
FT                   /db_xref="GOA:B8JAY5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAY5"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACL63796.1"
FT                   /translation="MKLRHVLPLIIGFVFVPAALMLTVGILILVYGSVARDYLFGILIV
FT                   SLVGTTIIGSAATLAVLFREARVAKLQTDFVNKVSHELRTPLTSIRMFVETLQLGRLQD
FT                   PQRQREALEIVAEETARLSGLINRLLDWARMESGRRVYELSRQPLGPVLDAALAAFEPQ
FT                   LLHHPVQLERDLPPRLPSVMADRSALVEAVLNLLNNAFKYTGPDKRIRLSAVASGPTVT
FT                   IAVTDNGPGIPLRDQKHVFDKFYRASDPLRRTVEGTGLGLAMVKHIVVGHGGKVSVESE
FT                   PGCGATFRIALPVAGGAHG"
FT   gene            498127..498819
FT                   /locus_tag="A2cp1_0440"
FT   CDS_pept        498127..498819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0440"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: ank:AnaeK_0439 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63797"
FT                   /db_xref="GOA:B8JAY6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAY6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL63797.1"
FT                   /translation="MAERILVIEDDPSILRGLQLNLGMEGYTVRSATDGETGLQLARTE
FT                   QPDLVVVDVMLPRMGGLEVIREIRKEDPELPILILSAKNQETDKVAGLQLGADDYLGKP
FT                   FGLKELLARIDALLRRRRARGEGVQPKAIRRVGGIELDLDARRALVDGRALELTSREFD
FT                   LLAFFVTHPDRVYSREQLMEAVWGSRYFGTARTVDNFVARLRAHIGDDAEQPRHLETVR
FT                   GIGYRFNV"
FT   gene            complement(498832..500307)
FT                   /locus_tag="A2cp1_0441"
FT   CDS_pept        complement(498832..500307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0441"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: L-seryl-tRNA selenium transferase; KEGG:
FT                   ank:AnaeK_0440 L-seryl-tRNA(sec) selenium transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63798"
FT                   /db_xref="GOA:B8JAY7"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAY7"
FT                   /inference="protein motif:PRIAM:2.9.1.1"
FT                   /protein_id="ACL63798.1"
FT                   /translation="MTTPKFAPGPAGAALRGLPRTDRLVEAADQAGMVEKLGHGAVLEA
FT                   VRAELDRHRAAVLAGDPCPSPEAIEAGLLDRLREDARGSLRPVVNATGVVIHTNLGRAP
FT                   LSDDAIAAMGRAARGYTNLEYDLVAGERGDRYGHAEAPLCRLTGAEAAVAVNNNASAVM
FT                   LALAALMDAPPDRSGGGEAGVRPLAAPGRGEAEPGLPEVIVSRGQLVEIGGGFRIPDVL
FT                   RRSGAALVEVGTTNRTYLRDHEAAVGPRTRILLAVHRSNFRLSGFVHDTPLEELVDLGR
FT                   RRALWVVDDLGSGTLLETAPFGLGIEPTVQERIRAGADLVCFSGDKLLGGPQSGILCGT
FT                   REAIARVKRHPLMRALRVDKVTLAALSATLAHYERGEALEKVPVWRAIAAAPEALEARA
FT                   RGWLAVLGAAGAGCAVRPSRSAVGGGSLPEVTLPTSVLALPGPPDALAARLRRGEPPVV
FT                   GRIEEDRVVLDPRTVLPAEDEALVAAVRAALAV"
FT   gene            500388..502418
FT                   /locus_tag="A2cp1_0442"
FT   CDS_pept        500388..502418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0442"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.5.11"
FT                   /note="KEGG: ank:AnaeK_0441 proton-translocating
FT                   NADH-quinone oxidoreductase, chain L; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH-Ubiquinone oxidoreductase (complex I) chain 5/L
FT                   domain protein; NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63799"
FT                   /db_xref="GOA:B8JAY8"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAY8"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ACL63799.1"
FT                   /translation="MPSIVPSPAAAESYLWAIILFPLAGAIVNGLTGRRLGRGNVTVIA
FT                   IGVMVGAFLVSSVAFYHALTGTVLRFRGDPWIQVTGADGRTIISIGWGLLVDRLSATMI
FT                   MVVTGVGTLIHVYSASYMSHEDDAGYARFFTYLNLFVAAMLTLVLGDSLILTFVGWEGV
FT                   GLCSYLLIGFWYTDPAKAYAGRKAFVTNRIGDFGFLIGVFALFSIFGTVGYADLSAIAH
FT                   GVDPSAAIQTGVFAGRTYQAAVTFALIGLFVGACGKSAQLPLYVWLPDAMAGPTPVSAL
FT                   IHAATMVTAGVYLVARNAYLFSLAPAAMATVTLVGALTALFAALIAFVQTDIKKVLAYS
FT                   TVSQLGFMFIGVGVGAWWAGVLHLVTHAFFKACLFLGAGSVMHGMNEDTDIRNMGGLAK
FT                   KMPHTAATFGIATLAITGFVPLSGFFSKDAILGNALFSHNPAWHQVGQIAYVLGSLAAL
FT                   GTAFYMSRLFFLTFTGKPRTAAAAHAHESSPVMYVPLWVLAILSIVALLLGLPGHGPLA
FT                   EVFARYTEPVFAAGTERLHEVGHLHAGAHPAWPFAVAWGLAAVGTLVAFLMYAGALRSA
FT                   PAALARTFPRLYQLAVDKFRVDELYQMVVIEPLKTAAYLLWRIVDVFAIDGLVVNGVAR
FT                   LVGYAGAVLRLAQNGDVQRYAAIMVVAAAVILWTVVGAGGR"
FT   gene            502422..504050
FT                   /locus_tag="A2cp1_0443"
FT   CDS_pept        502422..504050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0443"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.5.11"
FT                   /note="KEGG: ank:AnaeK_0442 proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain M;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63800"
FT                   /db_xref="GOA:B8JAY9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAY9"
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /protein_id="ACL63800.1"
FT                   /translation="MNLLTVVTFLPLLGALAMVLVPRDEPSQHRALALVASLVTFALSL
FT                   GLWFGFDASPGAPEFQFELMVPWMPTIGIGFHVGIDGVALLLFMLTTVLMPVVVLSAWK
FT                   AVGDRVKEFMIALLVLESAMLGTFIALDLVLFYVFWEAMLIPMYLLIGIWGSQNRLYAT
FT                   VKFFVYTFAASVLMLLAILYVYFHDGGTFDYVEARRALAVTPGAASWLFLAFALAFAVK
FT                   VPMFPLHTWLPDAHTEAPTAGSVILAGVLLKMGTFGFFRYALPLFPEAALQHRNLVAVL
FT                   AVIGIIYGALMSLVQTDMKRLVAYSSVSHLGFVMLGLMALSAEGMTGSVYQMLNHGVST
FT                   GALFLLVGMLYERRHTRLISEYGGIAKRVPVIAAAFVIVTLSSIGLPGTNGFVGEFLIL
FT                   SGTWLSRLGGSAVFATVAALGVILGAVYMLLLVEKVFFGPNQNPQNHRLPDLSVREGFV
FT                   LAPMIALIVVMGLLPGPFLAPAKPAVDRLIQRFQVAEARLGKGPQVGTAVPAVMVRAPA
FT                   PAPAAEPAPLPAPAPVPLQQPGGNY"
FT   gene            504052..505527
FT                   /locus_tag="A2cp1_0444"
FT   CDS_pept        504052..505527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0444"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /EC_number="1.6.5.11"
FT                   /note="KEGG: ank:AnaeK_0443 proton-translocating
FT                   NADH-quinone oxidoreductase, chain N; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain N;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63801"
FT                   /db_xref="GOA:B8JAZ0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8JAZ0"
FT                   /inference="protein motif:TFAM:TIGR01770"
FT                   /protein_id="ACL63801.1"
FT                   /translation="MSGFPTQDFVALVPVAILTMGALVLLMTEVFLTSGRRAYQAYLTM
FT                   VFAAAAAGYAAWMPVPGNVFGRQAVVDSFSAFVTVVLCAGLALSALVGQSWLNARNSER
FT                   GEFYALALFGTAGMVLLGMATDLLIAFIAVEVMSLSTYCLAAFLRRGKKPAEAAFKYVV
FT                   LGSISSALLLYGSALLYGASGSTLFSVLPRGQGSALYLAGIALVAGGVAFKIAAVPFHA
FT                   WTPDVYEGAPTPVTAFMAAGVKTAAFAVLVRLFLATESGSAAMSTSLGTVLSALAVLTM
FT                   IFGNLLALPQRSVKRMLAYSSIGHAGYLLVGVVSAVVAGARDKALAGLLFYLAAYTATV
FT                   IGAFAVVGALERRTRGDFEPADAWDLDRFAGLARRRPALAFAMAVFLFSLAGVPPTAGF
FT                   IGKFYIFKAAMGAGLYGLAVLGVLTSVLGAYYYLRVVLYMYFLPSKDEAGEVVLSAPSL
FT                   TIALAAAVAVVVLLGVVADPMVRLAQAASAIIL"
FT   gene            complement(505633..505974)
FT                   /locus_tag="A2cp1_0445"
FT   CDS_pept        complement(505633..505974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0445"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ank:AnaeK_0444 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63802"
FT                   /db_xref="GOA:B8JAZ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAZ1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL63802.1"
FT                   /translation="MAQCFLLVDADRNFREALAIALRLDGHRVEVCVSADEALARLAAG
FT                   GVDCCLVDAHMAGADEVLAAATAAGARPVMTGPYADVLEQAARRHPAATALPKPFRAAE
FT                   LADAGRAAQ"
FT   gene            complement(506284..507729)
FT                   /locus_tag="A2cp1_0446"
FT   CDS_pept        complement(506284..507729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0446"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: ank:AnaeK_0445
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63803"
FT                   /db_xref="GOA:B8JAZ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAZ2"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACL63803.1"
FT                   /translation="MADIPGRMIDPAPPEDPRAPRIAEPPTGGKVLVVDDQKNMRATTA
FT                   ILLRQAGHVVEEAEDGASATQRVQHESFDVVLTDLRMPTVDGMEVLRAVQQASPETQVI
FT                   VMTAYGTIESAVEAIRRGAYDFLAKPFKESEVLLRVAKALEKRRLLGEVNLFAEEFRKR
FT                   YGLEHIVGRSPAMREVLDRVLRVAPTDATVLVTGESGTGKELVARALHVTSRRSDKPFV
FT                   PVNCAAITDTLLESELFGHARGAFTGATRARRGMFEEANGGTLFIDEIGETSPGFQAKL
FT                   LRALQEGEIRRVGESSPVQVNVRIIAATNQDLRRAIAERRFREDLFYRLNVVPLRIPPL
FT                   RERREDVPLLAAHFLQRFVQRTGSERVLTPEAVASLVAHDWPGNVRELENIIEQAAALC
FT                   TGREIRAADVQIEARAAPAGGAGVTLADAVEDTERRAITAALARCGNDLGRVARDLGIS
FT                   GTTLWRKMKRLGIEAREHPPVTP"
FT   gene            complement(507722..512305)
FT                   /locus_tag="A2cp1_0447"
FT   CDS_pept        complement(507722..512305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0447"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-3 domain
FT                   protein; KEGG: ank:AnaeK_0446 multi-sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63804"
FT                   /db_xref="GOA:B8JAZ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAZ3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACL63804.1"
FT                   /translation="MAERFQAGSLVLRDRKIVHASEGAAALAGRTVPDMVGLDVLDLVA
FT                   PEDVARVVERHERRLRGEAAPAEYEVGVLLPDGTRRPVELRVRVHGADVVLEVRDATAQ
FT                   ATRRPRLEALAALGAALQREPSEAAVLERLRGAADELSALVLLARPDGDGLRVDWSALP
FT                   PAAAARLERALERPLDGQPGRWPPMFRSAWDAGAAYSDDLPNEAAAFVPEARAAATREA
FT                   IAAIGIARAVAVRVDTRAGPALGLLIAARWLRSEDLGALRLFGAQLAAALDAARTIADL
FT                   SRHNADLALLNRVGRLAGDAADLDTFFGEVTTVLTSATGCAVVAVYLVEEGGRELVRTF
FT                   ASGTSPDVQARLQRVPVTARIGEVLRDRAARAVPVDDAESGADALRAQGIRAGIWVPLV
FT                   ARGRAVGVMVAAFREDLEAVRPWLGLLGAVGPHVASAVETQGLLGALRRRVAELTLIND
FT                   VAMGSAQLDPVLLLDTSLRRVVETFQADTGAAFVREGERLALVAGHGLSSETLRRAARL
FT                   GLGESLPGLAVKRCAPARYPDDADPTAVQVAQAEGLREAMAVPLLAKGQSAVGSIVLGR
FT                   RTARPFADREVTLLSAMAVQIGVAVENARLFADVRRRLSDLEAVHALALRIFGNAPGDV
FT                   PALLDDGCREVASALSCRGAAVLLVDPQERCLRGVGGWGGPLRAEALRIPAGQDLLAED
FT                   ALRRGAPAWTEDASRDPRSALCGREGLPPTALLVVPLTSRQATRGVLFLFDDAGRSFSD
FT                   PELALANALAGELAVGLENAELYAEASRRVEDLSLLNEMSRTVAGSLDLDHVLSEGVVA
FT                   ARRLLGAGVGVVHLYDPVHLSLRAAAVSPGGPAALERASDALAGGEGLSWRSVRERRTF
FT                   VVEDVDAEPAGLNRLLVEYHRARAAIVAPLLLRGEPLGVLVVVDTERPRRFTPAEVERV
FT                   TAVANQLAVAIENARLYAEARGRLHELSTVIDVARVVSSSLDLEEVLSAGAEHLKQTLQ
FT                   GSDCTILLDDYRRRELRRAATRGAPIGPASVPLAERSLARDALEARTPIAGRLAEPGVP
FT                   DRALLAVPLHVRDQPVGVALVAAATTDRTFSPGELSRAMAIASQLAVAVDNARLYSETR
FT                   RRAEELGLLHEVGRSLVATLDFEQVLDAGVRNLARIVDAPRAVIALTSPGGEQLQVRAA
FT                   WGLPQAAVGVDVPVEPAAPRLAALVFERREPIAIEDAARDPRVREDLALDPSIRAMLGL
FT                   PLLVRDRYIGAAVILETRGPRRFSPAEIERGAAIANQLAVAAENARLYEDLRRSYAELA
FT                   HAQRQLIQQERLAALGELSAVVAHEVRNPLGVIFNSLGSLRRMLRPQGDARMLLDIVGE
FT                   EADRLNRIVGDLLDFARPSTPEVRPEPLDRVVEEALATALAQNGQPIQIQREVDPALPQ
FT                   VPMDARLVRQAVVNVAVNAVQAMPRGGRLTVRLRRDGDAAVLELEDTGAGIPDEVRGRI
FT                   FEPFFTTKASGTGLGLAVVRRIVEGHGGEVTVTSRPGAGTAFALRFPLTPLAGEDGGPV
FT                   EKEAGIG"
FT   gene            complement(512305..514254)
FT                   /locus_tag="A2cp1_0448"
FT   CDS_pept        complement(512305..514254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0448"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; small GTP-binding protein; PFAM: protein
FT                   synthesis factor GTP-binding; elongation factor Tu domain 2
FT                   protein; Elongation factor SelB winged helix 2; Elongation
FT                   factor SelB winged helix 3; KEGG: ank:AnaeK_0447
FT                   selenocysteine-specific translation elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63805"
FT                   /db_xref="GOA:B8JAZ4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAZ4"
FT                   /inference="protein motif:TFAM:TIGR00475"
FT                   /protein_id="ACL63805.1"
FT                   /translation="MKRVVIGTAGHIDHGKTSLVRALTGIDTDRLRDEKRRGITIELGF
FT                   AHLALPDGSVAGVVDVPGHERFVRSMAAGAGGIDLVVLVIAADEGVMPQTREHLDICRL
FT                   LGVPRGLVAVTKADLLPELGADWLPLLEQDVREVTRGTFLEGAPIVPVSSATGEGLDAL
FT                   RAALAALAAEVPERPTDGPLFLPIDRAFSMKGFGTVVTGTLLSGQIAEGDAAALLPASP
FT                   GGDGLRVRSVQVHGKPTPRALAGQRTAVNLPGIEPAAIRRGQVLVHPGVVPPSSIVDAE
FT                   LTLLAAAPKPLRHRAKLLLHVGTAQVPAVISLLDRAELAPGATAHAQLRLAEPAAALPG
FT                   QRFILRGFAVLEGRGKTVGGGRVLAVAAPKRRRGRPDSLAQLTVLAGADPEARLATVLA
FT                   MAGPAGLDLPALVGRTALSPKAAQATLDRLGARGGAVLFDRERRAYVAGTVAQELTRRM
FT                   AAAVAAFHRDHPLAAGMGREALRGKLPPVTDPRLFQRLLAHAAERGELVVEGDAVREKG
FT                   HAAASGESAGGALKEKVAAALAKGGLTPPWLAELPGAVGASAPDVQAVLKLLAAEGRAL
FT                   RVSSELYFDAAAVKTLETKLVAWLRERRQITTQEFKDLVGATRKHVIPLAEFFDREKVT
FT                   LRVGEKRVLRGEGR"
FT   gene            complement(514275..514820)
FT                   /locus_tag="A2cp1_0449"
FT   CDS_pept        complement(514275..514820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0449"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   ank:AnaeK_0448 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63806"
FT                   /db_xref="GOA:B8JAZ5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAZ5"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ACL63806.1"
FT                   /translation="MGVADGFAMDRLAAPAHLRRAPKKAMREIGWAAFGEVARNLAARI
FT                   HESYRPDVVVGIAKGGVFVGGALAAALGAEFQPVRIEKRRRDAGGPGAPASELPPLTGR
FT                   RVLVVDDVAATGATLAKARAAARKAGAREVRTAVLVVRPSGARPDFHAFETDELILFAW
FT                   DYQLDQLGAAVDPGEVGV"
FT   gene            complement(515057..515944)
FT                   /locus_tag="A2cp1_0450"
FT   CDS_pept        complement(515057..515944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0450"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: ank:AnaeK_0449 HSP33
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63807"
FT                   /db_xref="GOA:B8JAZ6"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAZ6"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACL63807.1"
FT                   /translation="MTDRLCRGLLPQRGLRAVFVRVGDTARMARVLHGLYPTSAHLFAQ
FT                   GLAAGALLGALQKEQGRVNLQIECDGPVGGIFVDADRDGNVRGYVRRPAVHFPGDPARA
FT                   ARAALGGSGFLSVLRDPGSGQYYRSAVELEALDVAEDLRRWFAASEQVETALDLAVVGR
FT                   EGEPLADVGGLLLQKLPDGDAAAVQAARERLASGALRAALARGAPAQEVIRDVAGDGFE
FT                   VLADEEIAYRCGCSPERARAAVSALGREGIAQVLAEEKQAVISCEFCRQRYVIGEAELR
FT                   DIARRLAERDAQDR"
FT   gene            complement(516088..516660)
FT                   /locus_tag="A2cp1_0451"
FT   CDS_pept        complement(516088..516660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63808"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAZ7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0450"
FT                   /protein_id="ACL63808.1"
FT                   /translation="MRTPTLLRLSALCAGLLAAAAARAQDVPFEPSGEVRVLAWGTMGT
FT                   SAAFDEGRIVGPTVNLTRREDGTWAGDLAGRNIALEIREGRLTGANVNLVLTQKGSATH
FT                   GEGLFYGIRFRFDLDGKRLSARFGDCTVDAKRLKAPGQLRGDAACLRRGASFPSSSRAS
FT                   VQLIGDAANEPPPLPQLALALLATMAD"
FT   sig_peptide     complement(516586..516660)
FT                   /locus_tag="A2cp1_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(516687..517634)
FT                   /locus_tag="A2cp1_0452"
FT   CDS_pept        complement(516687..517634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0452"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: ank:AnaeK_0451 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63809"
FT                   /db_xref="GOA:B8JAZ8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAZ8"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL63809.1"
FT                   /translation="MPADPVTFPGMPRTVLVTGISGNLGRAVAKHLHTEAQVVGLDRRA
FT                   FPGKPKDIEHHQADLRKARAEDAFRRRRVDAVIHMGIMHDPRMPFSEAHSFNVVGTQRL
FT                   LELCVRHRVKKVVVLSSANVYGPRPQNSNFLPEETPLMGADRASDVRDLVEVDMYAQSF
FT                   MWRHPELETVIVRPVNIVGPTVRNAPSNYLRLESPLTVMGFDPMLQLIHEEDVCRALVL
FT                   ALRPGLRGVFNVSGPGEVPLSAVLRELGRGPVPVPHPLIRPLVRRLFDARLTSFPPDEV
FT                   DHIQYLCVVDGSRFAREAGWAPRFSMRETIRSVL"
FT   gene            complement(517640..518494)
FT                   /locus_tag="A2cp1_0453"
FT   CDS_pept        complement(517640..518494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0453"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   ank:AnaeK_0452 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63810"
FT                   /db_xref="GOA:B8JAZ9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B8JAZ9"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACL63810.1"
FT                   /translation="MAELSEAIKARLRAWTFALGGPGTRGRLEKLTPPRNEYGVDPYGF
FT                   DSEYAVAAIAPLLWLYRKYFRVQVHGLENLPTEGRVVLVSNHSGQLPFDAAMIEVACLI
FT                   ELDPPRAVRALVERWVPTLPFVSTFMARCGQIVGTPENCRRLLAAGEAILVFPEGVRGL
FT                   NKPFSQRYQLQRFGAGFLRLALESGAPVVPIGVVGAEEQAPALFDLKPLAKLLSFPAFP
FT                   ITPTLLPFPLPSRYHIHFGAPMRFQGSPDEEDEALERKVAEVEGAVRGLLARGLAEREH
FT                   VYW"
FT   gene            518636..522127
FT                   /locus_tag="A2cp1_0454"
FT   CDS_pept        518636..522127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0454"
FT                   /product="MJ0042 family finger-like protein"
FT                   /note="KEGG: ank:AnaeK_0453 MJ0042 family finger-like
FT                   protein; TIGRFAM: MJ0042 family finger-like protein; PFAM:
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_4;
FT                   SMART: Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63811"
FT                   /db_xref="GOA:B8JB00"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB00"
FT                   /inference="protein motif:TFAM:TIGR02098"
FT                   /protein_id="ACL63811.1"
FT                   /translation="MRVTCPHCKAAYKIDDARVTPAGVKVRCPRCHQSFPVRRPDDEAA
FT                   AVPLPGGEAASAAGVPLPAPPSATTGGIPLPPPSGTGSTSGTGSTSGTGSIPLPPPDAA
FT                   QAGEPSAFALGPAPEAPSPFAFGPAPEAPSPFALGPAPEPALTGAAGTPAPVELPAPAG
FT                   ADDAPLGFGEVDFSGGTAAPPSGDTPDALDAGPAPVDDADIVVDEPGPDADPFAGAAAG
FT                   VPFAAAPAGGLGMGGPGGPSGAARAGASEELEMLFGDAARPAPATGGDGYQVRRRSGKV
FT                   FGPFSEAQIAEMLSKGELLGNEDVSADGATFEALSAVPAFAAELERLAAQEAAHAPPVA
FT                   AARPPGGQPFGDRMAAAKVVEGEREPLARRLAKPLAAGLAVAAVLAIGVGAGLTGHGWF
FT                   FTGHLRGGDAKVLAPKLAGARAALARGDHASERSALDLAAQAVAADAGSAEAAALHAMA
FT                   VAALERRHAAPGPALDQARRAAEALERDDPGSLPALEARLAVALATAPGAGTAAAEAAL
FT                   GAALARARPDPQAFALLGEAALARGDAVKAAAAFQRLGGLEQGPRAPMGLARAALLRGK
FT                   PDEARPTLEKLAAADAAYLPARLELAVLAEAAGDVGGARTHLAPVLADAAQPRLAPLER
FT                   GRARMVEAALLDRSAATAADAEKALLAALDADPRLAAARAALVRQRLRRGDAAGAVAAS
FT                   DPVAAEAASDPELAAARVRALALAGRALDAAQLADQALRAAPGTPALLVAKAVALSAAG
FT                   KPQEAAALYGEALARDAEAVEPRVALGRLALARGDLPAAREALAQAVEKGPRDPAAHAA
FT                   LGELRAADGDAAGAEAAYRAALALDAEHAAAVLGLARLAQARGDVAAARDGLVRALALE
FT                   PRSAEAQLALGTLEWSARDLAKAEAALAIAVDLQPRNAAALTRLGAVKLERGDAEAAVK
FT                   LLGAATSEAPGAGEAQLWFGRALLARGETPAALVRLRKAVELSPGAAEPRLELGQALER
FT                   SGALQEAIDAYQAAAAAAPALPDPHERTALLYTANGRCDLALAPLARAIELAPRATRLR
FT                   VELGECQGKLGKHADAVRTLRAAQRADPAAAQVLYPLAREVHQADGARAALPLYERAAR
FT                   EDPKNAMPHYFLGYAYKERSQRERAIQAFRTFLALKPDAPERRDIEAEIEDLGGAR"
FT   gene            522209..522760
FT                   /locus_tag="A2cp1_0455"
FT   CDS_pept        522209..522760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0455"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: ank:AnaeK_0454
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63812"
FT                   /db_xref="GOA:B8JB01"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB01"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACL63812.1"
FT                   /translation="MRSTPARPGPGPAADARRVRELLVRLSRRGSLRDPIGGSGHGLDL
FT                   SPVQVHALLWLGLGGALTMGELARHVAVTEKTITGVVDRLERDGLVQRARSRDDRRVVR
FT                   VSLAARGEAAWRALDAEISARLEGLLALLEPRDRRDLVRILVRLDERLGPAAEAAAPGP
FT                   ARARPPRGAGGRQHERREDA"
FT   gene            522757..524127
FT                   /locus_tag="A2cp1_0456"
FT   CDS_pept        522757..524127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0456"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   ank:AnaeK_0455 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63813"
FT                   /db_xref="GOA:B8JB02"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB02"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACL63813.1"
FT                   /translation="MNALITAALALALAQTPGTPSTPAPAPATPPAPDAAPVAAPAPVA
FT                   LPVLTLDDALAAAAAQNLDLKAAQARLRQADELSWKAWSGYLPQVTASGTYTRNETEAV
FT                   LPAGSLGPGSPKITIQAQDQLNGLVEATQALLAPQLLFAIPNASRAEEIARLNVETARR
FT                   EVLFGVAQAYYGAASLRRAMEVSERLLEIAARQEKDARVRYQAGAIAKVGLLRAEIDRA
FT                   RAEQDVKRSQNAFASARIALATLLDRRPDFDVVDPPEPVLAGDADALVAAALRDRPDVQ
FT                   AARLNVELQRGARNQAVARYLPNLGAFGRYTLANEAGFTGTNHAWAAGLALQWKVLDGG
FT                   LRESDIREANAKIDEANASSGSAELKARQEVEQAYLDLESARANAAKAKEQRDLAAENQ
FT                   RLVDVAFRAGTATAVEQADATAQLRTAEVGQITESLTAQLAALRVLKAAGAFHPTRR"
FT   gene            complement(524262..525533)
FT                   /locus_tag="A2cp1_0457"
FT   CDS_pept        complement(524262..525533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0457"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: ank:AnaeK_0456
FT                   putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63814"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB03"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACL63814.1"
FT                   /translation="MRSHDARAAAMGGTGHAGGVIHVPAVADEPAPAPGDLASLTQAQR
FT                   AERALAEGKREPEIPIERAFLQAALDFRQTLRVLVSAVVPRFADWCFVDLIDGDGIPRR
FT                   VEVAHGDPTKAPLAQEMRSIAFGPGWATPGAQTIRDRAPRLFRQVTTEVMEWATHGERH
FT                   LAVLRAIKPNSLLSVPLVARDRVIGSITLIRSAMLPGLDESDLLFAEALAEPAALALDN
FT                   ARWYQVEKAGRGAALEEADRERHDRVEAQRGVLRLRRIESVSASLASVLAPQAIARVAV
FT                   ENGLSVLEPATAMVVRAAPGASVLEVLHCQGWADDLTIDLRELRADSPALLAEAYRIQT
FT                   AIWVSNPEALAHSYPNAAELALRVGDRAWAAVPLRCDGRTVGALGLGFAHPRDLDADEK
FT                   RFVLTVAQIVAQALERARLRDEAR"
FT   gene            complement(525652..526632)
FT                   /locus_tag="A2cp1_0458"
FT   CDS_pept        complement(525652..526632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0458"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Forkhead-associated protein; KEGG:
FT                   ank:AnaeK_0457 diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63815"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB04"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACL63815.1"
FT                   /translation="MPVERRSERTWTTLPTTPCAAGRRHAFLLVLAGPQLGDIYPLASD
FT                   RELVIGRRDDCDLPIHDDGVSRRHAAIRVEGEGALLRDLGSANGTYVDGARAEGEVRLA
FT                   DGGRVSLGGATVLKFAWADELEARWQMKLAEIALLDPLTGVFNRRHLDDRLAAELAAAQ
FT                   RHGRSMSVLLVDVDRFRAVNEAHGQAAGDEALKMVAFVLRGALRREDVLARAGGAAFAV
FT                   IARETTLAGGRALGERIRRAVARSRCAWQPQDGGEAASIGVKVSVGVAEVAEGRTQREV
FT                   MESAGRALQLAKQAGRNTVVALPMAPAEGRPDPAQAAMTRGGAAP"
FT   gene            526736..527638
FT                   /locus_tag="A2cp1_0459"
FT   CDS_pept        526736..527638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0459"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   ank:AnaeK_0458 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63816"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB05"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ACL63816.1"
FT                   /translation="MIRYGPAGWEYRDWAGVVYPPGEGKRFDRLAYLAPWFSTVEVDAT
FT                   FYRPFPAAVAARWCERVREVPTFRFGAKIWRRFTHEREAYGAEEVAQARAALDRLHEEG
FT                   RLGAALLQFPWSFKRSEASEEWLRGLFRAFAGLPLALEVRHASWDDPEVLEELAAAGVA
FT                   LVNVDQPRFQRSLAPAARVTAPVAYVRVHGRNHRDWFRKGAPRDARYDYLYGADELAPW
FT                   AGRIAEMADSPRAPDVYVVTNNHFRGQAPANAKMLEAMVEHRRVAVPPPLLAAYEAALA
FT                   PFAAPAGDAATGNSATTGA"
FT   gene            complement(527560..528354)
FT                   /locus_tag="A2cp1_0460"
FT   CDS_pept        complement(527560..528354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0460"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="3.1.11.2"
FT                   /note="KEGG: ank:AnaeK_0459 exodeoxyribonuclease III Xth;
FT                   TIGRFAM: exodeoxyribonuclease III; exodeoxyribonuclease III
FT                   Xth; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63817"
FT                   /db_xref="GOA:B8JB06"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB06"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ACL63817.1"
FT                   /translation="MKIGTWNVNGIRAREAQVGEFIAREGPDVVCLQEIKAPPSKVPPS
FT                   LCELEGYWCLWHGETAYSGVALLVRKAIAPERPAFVHPPFDLETRIATCELGGVTVASI
FT                   YVPNGGKDLAAKLRFLEAMERFAADAQASGRRLVLCGDLNVARTDLDVHPKERKAGAIG
FT                   QLPEERALFERILSRGLVDVGRALDPANEGLFTWWAPWRNLRQRNIGWRIDYVLASASL
FT                   AASATRCRVLADFGTSDHAPVVAEFPVAASPAGAANGASAAS"
FT   gene            528682..530541
FT                   /locus_tag="A2cp1_0461"
FT   CDS_pept        528682..530541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0461"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: inositol monophosphatase;
FT                   ADP-ribosylation/Crystallin J1; KEGG: ank:AnaeK_0460
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63818"
FT                   /db_xref="GOA:B8JB07"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB07"
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /protein_id="ACL63818.1"
FT                   /translation="MTDLSRALEAALRAARAAADLLRAELFRAGGPRGEPGHCPADEQA
FT                   EDLIRAVLEAEFPGDGFVGEERPERNRPPALPGGRCWLVDPNDGTADFQRGHRGASVSI
FT                   GLVQGGVPVLGVVLAHTAPHGGEDLLAWAEGQGPVRRNGAPLPPVSAAPLRAGDVVLVS
FT                   SSAAKRARGNAEAVQPARFRPLTSIAYRLALVATGEARGAISLHRPRALDIAAGHALVR
FT                   GAGGVLLDEAGREVRYGPAGEGRVAFCFGGAPLVAARLASRSWVEAQAYGPGAPGLCAP
FT                   LAGRAVREDGLLRRGQGALLGQLAGDALGGQVEFSGAARIAAAYPDGVRDLADGGHWST
FT                   LAGQPTDDSELALALARTVIAFGRFDAARVAEAYADWLGSEPFDVGRTVDAALRPALRI
FT                   RASGAPAEQVAEAARAAAPRGSLANGALMRVSPLGIAGHAAPAAEVAAWARADAALTHP
FT                   AAPCQDASAVFAATVAFAIATGASAAEVADRGEALAAELGCGAEVREALAAARTGPPED
FT                   FEASAGLVTIALQNAFFQLRHAPDLEAGLVDTVGRGGDTDTNAAIAGALLGAAHGVLAV
FT                   PERWRRAVLSCWPVEGAPGVRRPRPPVCWPGDALILAERLLGL"
FT   gene            complement(530564..534307)
FT                   /locus_tag="A2cp1_0462"
FT   CDS_pept        complement(530564..534307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0462"
FT                   /product="exonuclease SbcC"
FT                   /note="KEGG: ank:AnaeK_0467 exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63819"
FT                   /db_xref="GOA:B8JB08"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB08"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0467"
FT                   /protein_id="ACL63819.1"
FT                   /translation="MRILAIRGENLASLYGKFELRLDRAPIAGAGIFSIAGPTGSGKST
FT                   LLDALCLALYGKTPRLRDRAAGKRVMVGWSEEGETLDMNDVRALVSRGTAGATAEVEYQ
FT                   GMDGRRYLARWRVRRARDRVEGAFQAQAMTVEDLDTGEVLAEKVTQAVAFNERAIGFTF
FT                   DELKRAVVLPQFEFTNFLRADADVRAAILERVTGTAVYGRLSQAAHQRLGRELEVRERL
FT                   EGELGGVKVLDAEARAALQARQAELARALEEAKAAARAAEAEVRWHQRDAELRDGLERS
FT                   EAELARAARAVEEGAALRAELAEVEAAEPHRAALAEAVRAEQARTGVEARAAEAQVALG
FT                   RAEVGAAAAARGEADARAALEAADAAEARARPELAEARRRDESLAAARRAEADAGAALA
FT                   TARAEQAQAAAEADAAARAREAAATARDAAEAWLAAHAAEAPLAAEWNRWAARLAEHAA
FT                   ECAGAAQAEAGLRAAREADAEAARALAAEARGAEAAARRLEAARAALADAARTAAGADA
FT                   AALTTEVARLGDLRALLGEAWKAAQAAAVATARREQARTEAAAGGAEQVATQRTHAAAE
FT                   AAVRAAEAGAAQARAALRRVELTLGLADRRADLVDGEPCPLCGAAEHPYAHGAPLPALL
FT                   EAQRAAAAEAEEAVRGATREREAVAARASELAARVEAARRAEAQAEVDRAHHAAEYDAL
FT                   RARLAAPAAGGVELPGRAEEAAAAVEARGRDAKAALEAAKAALEAARGAAEAERAARAE
FT                   VDAAREAHEAARARQRALEKARDDAAAAVTAHEAAAARHAAALGRIEAELAPALGFLPD
FT                   WPEAARRGPEAFRAGCAARAEAHAAQVRARDAAAADVAARAAGAEKAAALAGERGARAA
FT                   RAEETAAEARAARERAEAERRAVLAGKPADEVEGALREALERARAAHERARASRADADR
FT                   AHAAAAEAARAGATARDAADADAARAGATLAAALTALGVDRPALEVRLARGHAWAAQAR
FT                   ADLEACAGAAQAAAAVRDERRRQVEAHGGSRPGCDAAGARARHAGAEREATRLGEEHSQ
FT                   VTLDLRRDEDARARHEEVSGALEAARAATDRWERLAKVIGSADGSRFRRYAQGLALDGL
FT                   LAAANVHLRDLARRYELMRVPGADLEIQVVDHDLGDEVRTVNGLSGGELFLVSLALALA
FT                   LGLASLSTRAAHARTLFIDEGFGTLDRDTLEHAMAALEGLRQTGRTVGVISHVPELHER
FT                   IGVQVTVERVSAGRSRLVVPEG"
FT   gene            complement(534304..535563)
FT                   /locus_tag="A2cp1_0463"
FT   CDS_pept        complement(534304..535563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0463"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="TIGRFAM: nuclease SbcCD, D subunit; PFAM:
FT                   metallophosphoesterase; KEGG: ank:AnaeK_0468 nuclease
FT                   SbcCD, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63820"
FT                   /db_xref="GOA:B8JB09"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB09"
FT                   /inference="protein motif:TFAM:TIGR00619"
FT                   /protein_id="ACL63820.1"
FT                   /translation="MAIRILHTADWHLGHALHGVDRGPEHERFVAWLLDTVEAEAVDAV
FT                   IVAGDVFDASNPPAGAQALWYRFLAEAWRRLPRLQLVVVGGNHDSASRLDAVDPLLREM
FT                   GRLHVVGGVPRAAAGAPDLERLLVPLEDAAGRRAAWVAAVPYLRAADLGAGAGAADDDA
FT                   AEATRRFYAAALERARARRAPGEALLATGHLYAVGGKISELSERRLAVGNQAAVPADAF
FT                   PADLAYVALGHLHLAQAVGGRETVRYSGSVLPLSFAERGYRHGVVVADLDGEAVRAQRV
FT                   LRVPRFVELVSVPDAEAPAPLPEVLAALEALPARGDGPDALRPLLEVKVRLERPEPALR
FT                   ALLDQALAGKEARLVRIATTLAGTGRALGDGERRALGDLVPEEVFRRKYDADYGGPPPD
FT                   ALLEAFRALLQEVESEEGAR"
FT   gene            535812..536087
FT                   /locus_tag="A2cp1_0464"
FT   CDS_pept        535812..536087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63821"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB10"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0469"
FT                   /protein_id="ACL63821.1"
FT                   /translation="MGARAQTRSERLRRRLQAERVHLVIEYVTLADGSWAALCGMPEAI
FT                   ALGATYAEARERLCAELGERMGRAALEAATVVEDVPFGAEELGMAY"
FT   gene            complement(536111..536461)
FT                   /locus_tag="A2cp1_0465"
FT   CDS_pept        complement(536111..536461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0465"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: ank:AnaeK_0470
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63822"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB11"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACL63822.1"
FT                   /translation="MKVPWWFPFGSVAEVSAVELNDRLRGRPAPQLVDVRTAAEFAQGR
FT                   IRGAVNVPIGELRSRLDALKLDPARPVVAICLSGHRSVPAVRLLERGGFEAAQLAGGML
FT                   AWRGARLPEVKG"
FT   gene            536520..537854
FT                   /locus_tag="A2cp1_0466"
FT   CDS_pept        536520..537854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0466"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   ank:AnaeK_0471 chromate transporter, chromate ion
FT                   transporter (CHR) family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63823"
FT                   /db_xref="GOA:B8JB12"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB12"
FT                   /inference="protein motif:TFAM:TIGR00937"
FT                   /protein_id="ACL63823.1"
FT                   /translation="MRGGGNPGGGGRVGPGVGAHATPPPGAAPATLSRRPRPTLPALAR
FT                   ASAWLGLTGFGGGLSVLGTMHDLLVERRRWLTDREFTVTATVSQMLPGGAAANALAYTG
FT                   LRFHGPAGAVAAYAAFIAPGAIGVTALAALYVRLGVTPTAAPLLAGLNAAVVGIVASIT
FT                   LQMLRAAVQRPWQMGVAAATLLFSLGAAASAGEMAALGIGAGLVLDLGVKRMRLARFQR
FT                   RARRPPPPVALPDEGMPLPAPERDDDPPATPADAPPRLPALALLSVPALGALGAMALLF
FT                   LRAGLGAYGGGFAIIPHLQASVLAEHWIGPRQFADAVAIGKLTPGPVLLMATFIGYLVH
FT                   GIAGAAVATAAVFAGPLALVLAVGAWLARVRSRRPVRAALRGLTPAVVGLMAAAALALG
FT                   RSLEGRVELAIAAASLLTLVRFRVNPVLVMALGGGVRLALSLAGL"
FT   gene            537935..538432
FT                   /locus_tag="A2cp1_0467"
FT   CDS_pept        537935..538432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0467"
FT                   /product="NosL family protein"
FT                   /note="PFAM: NosL family protein; KEGG: ank:AnaeK_0472 NosL
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63824"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB13"
FT                   /inference="protein motif:PFAM:PF05573"
FT                   /protein_id="ACL63824.1"
FT                   /translation="MSPLRSLLLLAALTTLAAPVQPGAAGAPGAAAATSPGPKDRCAVC
FT                   GMLVAKFPQWVASIRYRDGEVAFFDGVKDLLTYWHDLPRHAPGRAQGDVAAISVTDYYS
FT                   TRPIDGRAAFYVIGGDVRGPMGAELVAFAREGDAKAFLNEHRGERILRFDDATPAVLEA
FT                   LR"
FT   sig_peptide     537935..538033
FT                   /locus_tag="A2cp1_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.558 at
FT                   residue 33"
FT   gene            538429..538713
FT                   /locus_tag="A2cp1_0468"
FT   CDS_pept        538429..538713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63825"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB14"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0473"
FT                   /protein_id="ACL63825.1"
FT                   /translation="MSLRRSDRFLAALAVAAVLGAAALADARARRAVARPAAEERARLV
FT                   ARLGLTDPCLFNDARYTRHLSQADRFAPFQDHPRALEHFPSGSLTAGAR"
FT   sig_peptide     538429..538506
FT                   /locus_tag="A2cp1_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 26"
FT   gene            538710..539858
FT                   /locus_tag="A2cp1_0469"
FT   CDS_pept        538710..539858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0469"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ank:AnaeK_0474 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63826"
FT                   /db_xref="GOA:B8JB15"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB15"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACL63826.1"
FT                   /translation="MRLRAALERQRSLLDFALGALGRRRGKTLALVAVHALLVFALASV
FT                   LLFTGGLREQVREALRGAPDLVVQRMAAGRHEQVPAGWVETLGALRGVSAARGRLWGYY
FT                   FEPVSGANLTVMVPDGGWATPGGAVAGPGVARVLGLKEGDRLPLRTYDGEALDLGVAAI
FT                   ASPAVELVASDLLLVSEGDYRALFGAEPGRFTDVAVAVPNPDEVTRLAEKIVRMFPDAR
FT                   VVTRAEMIRTYDAVLDWRSGLAAAVLAGAVLAFAILAWDRASGLSAEERHELGLLKALG
FT                   WDPRDVLAAKAWEGAAVSLSAFAVGALAAYAHVVLGGAALLRPILEGWAALYPDLRPAP
FT                   PVEPLALGTLFFLTVIPYVAATVVPCWRAATVDPDALMRGDA"
FT   gene            539855..540541
FT                   /locus_tag="A2cp1_0470"
FT   CDS_pept        539855..540541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0470"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ank:AnaeK_0475 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63827"
FT                   /db_xref="GOA:B8JB16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB16"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL63827.1"
FT                   /translation="MIQLREVTKVFDEGRPGALAAVDRVTLEVAGGAVTVLVGPSGSGK
FT                   TTLLTLLGAMARPTEGRIFLDGRELTSLPEHFLAALRRRTFGFVFQQNHLLPALTALEN
FT                   VMLPALPSGEPRRAVEARARAALARLGVEARAGVRAGRLSGGEAQRVALARALADDPKV
FT                   IVADEPTAHLDSARARALMEIVRGLKAEGRTVVVASHDPIVYAADCVDRVVRMRDGRIV
FT                   TPGAEP"
FT   gene            540538..541530
FT                   /locus_tag="A2cp1_0471"
FT   CDS_pept        540538..541530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63828"
FT                   /db_xref="GOA:B8JB17"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB17"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0476"
FT                   /protein_id="ACL63828.1"
FT                   /translation="MILSPPVLALQAGAAASSGFLLVALRWAAPVVRRWDPASGSRAQL
FT                   RLERRALLVGVLVRTALAVQLASLALFVHASDALAPMFTGAMCAAGTLSASRYGWPALA
FT                   VQVAATVLAGAWLALDRADGLAPDQPLVRVKHALLPAVAIPVVAGAALQAAHFLALRPE
FT                   IITSCCGSLFGREGRGGWAGLAWLPPRAAGALLVALPGAAALAALALRRTGRGASAVAA
FT                   LSGLAGPAAAAGVIAWLSPYVYEAPGHRCPFCLLQPEQGWVGYPLHAAVLVGCVAGVAV
FT                   GVLQPFRRVPSLAGPLPALQRRLAGAAALAWTALLAGAAALVAASGLRA"
FT   sig_peptide     540538..540624
FT                   /locus_tag="A2cp1_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.873 at
FT                   residue 29"
FT   gene            542494..543567
FT                   /locus_tag="A2cp1_0472"
FT   CDS_pept        542494..543567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0472"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   ank:AnaeK_0477 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63829"
FT                   /db_xref="GOA:B8JB18"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB18"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACL63829.1"
FT                   /translation="MHLEDLGPWKHGHAFGTAVEASGERRTRWVVALTLAMMVGEIAAG
FT                   MVYGSMALLADGWHMGTHAAALGVAAFAYAYARRHAADPRYSFGTGKVGALGGFASAVG
FT                   LAVVALLVLGESAVRLASPVAIRFDQAIGVAVLGLLVNLFSAFLLRDEDHGHAHGHGDH
FT                   EDHDDHPVHDHGAHGHAHHDHDHDAHAHAVHDPELDLEAELGMDEHRDHNLRAAYLHVL
FT                   ADALTSVLAIVALLAGRVLGWTWMDPVMGIVGALVIARWSVGLLRDTGAVLLDAEVAEG
FT                   RRAAIRAALEQGEDRVADLHLWRVGPRHLAAIVSVVATAPRAPAEYKERLHAFPDLVHL
FT                   TVEVHACEAAPGARAAR"
FT   gene            complement(543568..544092)
FT                   /locus_tag="A2cp1_0473"
FT   CDS_pept        complement(543568..544092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63830"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB19"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0478"
FT                   /protein_id="ACL63830.1"
FT                   /translation="MSAREAGRIERFLSDDHLRLDGLLTRAAADPAAIDRPPYDAFRAG
FT                   LLRHIALEEKVLLPAAREAQGGEPLPLARRLRIEHGAIASLLVPTPTHALIGEIRKILA
FT                   PHNLLEEAPDGLYATCDRLLAARAQEIVARMAAYPPVKVAAYNDGPRVLRTAEAALEQS
FT                   AKQAEARPGPR"
FT   gene            complement(544089..544562)
FT                   /locus_tag="A2cp1_0474"
FT   CDS_pept        complement(544089..544562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63831"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB20"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0479"
FT                   /protein_id="ACL63831.1"
FT                   /translation="MPTPAAEVVTRYAAGAATHPNGKPLAPDAAAAWAALGRPDAGRLG
FT                   AARVRDSARREWLLEAHRELERGRFVVLRPAHGDLEPFRASADGYRPEAYLPISEQDWL
FT                   LLALLTAGHDGDAGRDDPELAGAAFPLVDRIVREAQHRQLMGEASDEDDEESP"
FT   gene            complement(544572..545297)
FT                   /locus_tag="A2cp1_0475"
FT   CDS_pept        complement(544572..545297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63832"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB21"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0480"
FT                   /protein_id="ACL63832.1"
FT                   /translation="MTPKKLVPLLSLALAALLAPAAARAHCDTLDGPVVVAAKAALESG
FT                   KLSPVLAWVQPADEAEIKAAFAKTRAARKAGGEARDVADTWFLETLVRVHRAGEGAPYT
FT                   GLKPAGADLDPAVVAMDRAIAKGDPAEVERLLQAAVHQGLEKHWTRLAAEKAPADDVAA
FT                   GRRWVAAYVPLVHWAEGVNAAATQGGAHAGHADAGAADPHAAHAKPGAQAPAADPHAAH
FT                   GRAPARAPVKPAADTHHAH"
FT   sig_peptide     complement(545220..545297)
FT                   /locus_tag="A2cp1_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 26"
FT   gene            complement(545303..545974)
FT                   /locus_tag="A2cp1_0476"
FT   CDS_pept        complement(545303..545974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0476"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ank:AnaeK_0481
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63833"
FT                   /db_xref="GOA:B8JB22"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB22"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL63833.1"
FT                   /translation="MQSSSASRSARKPGTDRRREIADAALRVIAAQGAAHFTALAIARE
FT                   VGVSDAALFRHFPTKDAIAAAAIDRMEELLFEGFPPEAAEPLARLGAFFRQRVAVIRAN
FT                   PAIARVFASDDVGLVGDGAGAARLEAFRRRSTAFVRGCLEEARRAGGLSPAAGIDEAQV
FT                   LVLGALLALAHSPGAASRPPELVERVWRTLETFLRRPDGRAAAAERRPPRAPRSRRTDE
FT                   R"
FT   gene            complement(546076..546786)
FT                   /locus_tag="A2cp1_0477"
FT   CDS_pept        complement(546076..546786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63834"
FT                   /db_xref="GOA:B8JB23"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB23"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0482"
FT                   /protein_id="ACL63834.1"
FT                   /translation="MWEAVAITLRESFQRLAVNAARLVPGLLATLVFALLSLALAWACA
FT                   RLVRRILKAVQLDRLLRRWAPAEDRSRLPSLVTAATRFTFWLTFAVGLALSLTSVESRW
FT                   TSALAERVLTYTPSVIVAGVLFAAAVALSRWVEASVLVSAVNMQIRSARLLATGARWLV
FT                   TVLGGAMALQHLGVGGALVTISFSILFGGIVLALALAVGLGSREVVTRSWERRLRDRDE
FT                   AHPHDEEPPRIAHL"
FT   gene            546990..549161
FT                   /locus_tag="A2cp1_0478"
FT   CDS_pept        546990..549161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0478"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /EC_number="2.4.1.15"
FT                   /EC_number="3.1.3.12"
FT                   /note="KEGG: ank:AnaeK_0483 HAD-superfamily hydrolase,
FT                   subfamily IIB; TIGRFAM: HAD-superfamily hydrolase,
FT                   subfamily IIB; PFAM: glycosyl transferase family 20;
FT                   trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63835"
FT                   /db_xref="GOA:B8JB24"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB24"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ACL63835.1"
FT                   /translation="MSRVVIVSNRLPVTVERAGEAVRVVPSVGGLATGLRRPHEQGGGP
FT                   WVGWPGDLAGLDPEQQARVEARLSDLRLAPVHLTSEEVQRYYQDYSNALLWPVFHSFPG
FT                   EVPLEMGGAAEYERVNGRFADAVAATARPGDVIWIHDYQLLRLPALLRERLPEARIGFF
FT                   LHIPFPSSDLFRVLPQREALLEGMLGADLIGFHTASYMRHFSSSVLRVLGAWTDVDRIR
FT                   WRGREVRIGVFPMGVDAADFAGTAHGADMDEEVRALRRDGSRLIVGIDRLDYTKGIPRR
FT                   LLAYERLLREHPELRGKVRLVQVAVPSRTEVGAYQEFRDQVDGLVGRIHGAFATPTWSP
FT                   IHYLSRGLDRAQVVALYRAADVMLVTPIRDGMNLVAKEFVAVRDDGDGVLVLSEFTGAA
FT                   AELAEAVQVNPYDEAGTAAAIQRALEMPEDERRTRMTGLRRRVTRYDVHWWARTFLERL
FT                   REAPAPVRPQGLEVSPRAAVQDALSRLRAAPHATLLLDYDGTLVPFAPTPELARPDREL
FT                   RDLLRDLARHPRLAVHLVTGRQRDTVDRWFGDLGIGLHAEHGFWSKLPGNGWQLAAPVS
FT                   TAWREPARAILEEFAARTPGSLVEEKSAGFAWHYRTADPDFGAAQAHDLMLHLSTVLSN
FT                   APVEILPGALVVEVRPQGVDKGKVVARAAAASPEGSLLAALGDDRTDEDMFAALPDGAI
FT                   AVHVGPSPSRAPLRLAGVPESRAFLRGLL"
FT   repeat_region   549216..549450
FT                   /rpt_unit_range=549216..549236
FT                   /note="CRISPRs"
FT   gene            549766..550629
FT                   /locus_tag="A2cp1_0479"
FT   CDS_pept        549766..550629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63836"
FT                   /db_xref="GOA:B8JB25"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB25"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0484"
FT                   /protein_id="ACL63836.1"
FT                   /translation="MLYPELFRSLERARWSLEDDVPWSSFDPTALSDEQALTVKMNAIT
FT                   EWSALPATEMFLRDNRHDSDFSAFMSIWFYEEQKHALVLMEYLRRFRPDLVPTEDELHA
FT                   VRFEFDPAPALETLALHFCGEIRLTQWYRRAAEWHTEPVLKQVYGLISQDEGRHGGAYL
FT                   RYMRQAIERHGDAARAAFAKLGVLMASSGRSGKPLHPTNLHVNQRLFPRDTVQSRLPDP
FT                   GWLDRWLDGQIRFDEGCERRVVRTMLRSLSALLGESFETVRDLNRYRKSLAGAAAPAAS
FT                   AAPMHA"
FT   gene            complement(550639..551604)
FT                   /locus_tag="A2cp1_0480"
FT   CDS_pept        complement(550639..551604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0480"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ank:AnaeK_0485
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63837"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB26"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACL63837.1"
FT                   /translation="MTSSIPQRRRLGATDLSVFPVCLGGNVFGWTADRAASFAVLDAYR
FT                   EAGGNFVDTADVYSAWVPGHRGGESEEVLGAWLRERRCRDEVVIATKVGMGGPDSAAGL
FT                   SAEKILHACDGSLRRLGVERIDLYYAHRDDAATPLEETLGAFDRLVRAGKVRHLGASNY
FT                   AAPRLAAALDLSARAGLARFAVLQPEYNLVSRGGYEGALADLCAARGLGVCTYYALASG
FT                   FLTGKYGPGLPPPTARAGKVNALLADPGAKAVLAAAREVARAHGATVAQVALAWQLRSP
FT                   RVTAPIASATSAAQVRDMAGAVEVALTPDDVARLEGAGGR"
FT   gene            complement(551688..552359)
FT                   /locus_tag="A2cp1_0481"
FT   CDS_pept        complement(551688..552359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0481"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: ank:AnaeK_0486 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63838"
FT                   /db_xref="GOA:B8JB27"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB27"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACL63838.1"
FT                   /translation="MPPRAPRRRPARPAPPPAAASARRASPDAPGRFDAAYYRRHYRGK
FT                   DRVHSAAEIARLASGVCGLAGWLGVDVRSVLDVGAGTGLWRAWLRRHRPAVAYRSVDVS
FT                   PYACARYGHEQRDISRWRARERFDLVVCHGVLHYLDDRAAARAIDNLGAMCRGLLYLEV
FT                   ITRGDLETVVDLERTDTAMHRRTGAWYRRRLARHFVQVGAGLWAARRAGLPFYELEAAR
FT                   G"
FT   gene            complement(552404..552595)
FT                   /locus_tag="A2cp1_0482"
FT   CDS_pept        complement(552404..552595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63839"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB28"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0487"
FT                   /protein_id="ACL63839.1"
FT                   /translation="MRERMKTPGPCGPITGNRRLGDPVHEVRAALDRSLDPACRRRAER
FT                   RVRMIAALLDGGAPTLDV"
FT   gene            552707..553501
FT                   /locus_tag="A2cp1_0483"
FT   CDS_pept        552707..553501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63840"
FT                   /db_xref="GOA:B8JB29"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB29"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0488"
FT                   /protein_id="ACL63840.1"
FT                   /translation="MPEPTQRERRPLRGGDLAAIVLALAVAGAIAYFWVQRRPAAPATP
FT                   PAVPEQSAPAATPSTAPPSAAVQADPAQVKTLLEAASADPEYRRWLGAGGDLVRLWAVL
FT                   TDNLAEGVSPRKQLPFLVPEQPFSVTEQGGRRVIASASYARYDRFGDAVASIDAKAMAA
FT                   AYRALRPAVETAYRLLGYPDAVLDRVTARALHRLESAPHPGGPVEVVPHAEPGAGWAYA
FT                   DPALEHLGAVEKHLVRLGPRNASKVQAKAREIREALGLREPR"
FT   gene            553920..555419
FT                   /locus_tag="A2cp1_0484"
FT   CDS_pept        553920..555419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0484"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; LysR
FT                   substrate-binding; SMART: AAA ATPase; KEGG: ank:AnaeK_0489
FT                   ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63841"
FT                   /db_xref="GOA:B8JB30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB30"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL63841.1"
FT                   /translation="MPQRPEAARAGPVAGPDATRSAPPGPALALRGAGRAYGAVRALRP
FT                   LTLEIRRGERVALLGPSGAGKSTLLRLLDTSLAPSEGVVEVLGQPIAAADARRLRALRA
FT                   RIGTVHQQLLLVPQATTMQNVVAGRLGRTSLARTLAALVSRREAARVRALLDDVGIGDK
FT                   IFERVDRLSGGEQQRVAIARTLYQDPELILADEPLASVDPARAADIAALLTRAFAGRTL
FT                   VVSTHRIEPLLAHVDRVIGLREGTLAFDKPAASLTLRDLGELYEARRGAADPARAPAAR
FT                   PPSDPDLAPGGALRIGASSTPGEHLLPPLVRAFARAYPGTRVSLSLSDSAAVTEQVRAG
FT                   ALDLGFVGAREDDPALAYEDVARDEIVLVAAPALELPPEPLPLEVAARLPRVDREPGSG
FT                   TRAVVEQHLANMGAALDPAAAVLEAGALVALKAAVVSGMGVAFVSRRAVGDDLRSGHVR
FT                   VVRVEGLSIPRHVFAVARRSPGPSAAARAFLEVARAEVPPA"
FT   gene            555416..557146
FT                   /locus_tag="A2cp1_0485"
FT   CDS_pept        555416..557146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0485"
FT                   /product="phosphonate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: phosphonate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ank:AnaeK_0490 phosphonate
FT                   ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63842"
FT                   /db_xref="GOA:B8JB31"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB31"
FT                   /inference="protein motif:TFAM:TIGR01097"
FT                   /protein_id="ACL63842.1"
FT                   /translation="MSQAALHERPPLPLLLRWPGLVLAAVLGIAWRMSEGSLGALLAPE
FT                   ARSAAAEFARGFWPPAHSPAFLRFLARPLAETVAIAFAGMTLALVLAAPLAYLATAPDV
FT                   GRVRGDAPGPLRRAAWIGARTVLNLMRSVPELVWALVFVRALGLGPAAGVAAIGIGYAG
FT                   VVGKVFAEIWESSPCAPARALAAAGAPPRRAFALAVLPGSAPLLASYALYRLDCALRAS
FT                   AVLGLVGAGGMGVQLELSLKMFAYDEVATLVLALFAVVAAVDLLSAWARRRLAESRGLY
FT                   PAGPGALRWRAAILGTWLALAAGAAAYLELPLGELFSGATLRSAAAFFGSMFPPDLSPG
FT                   FLRGLAPAVAETLAVSVLGSALASVLGLGLALAAVHPGARGLAGAPGDSRLRAGARLAV
FT                   TAGARGAMNLLRTLPELLWALVAIFAVGLGPFAGALALGIHNAGVLGRLYAEALEEVPP
FT                   GPVAALRGAGARPLAATLLGALPQAWPQLVAYTLYRWEVAVRASAVLGVVGAGGIGALL
FT                   HVSLNLFQHHRTLTLVAAIVLLVTAVDLFSGWLRARILAGPASRAAPRAGCAPGLANAT
FT                   "
FT   gene            557322..558173
FT                   /locus_tag="A2cp1_0486"
FT   CDS_pept        557322..558173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0486"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; SMART: extracellular
FT                   solute-binding protein family 3; KEGG: ank:AnaeK_0491
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63843"
FT                   /db_xref="GOA:B8JB32"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR030836"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB32"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ACL63843.1"
FT                   /translation="MHRIAALAVAAVLLFPPAARALDALRVSAIPDESPTELQRKFEPL
FT                   GKYLEKQIGIPVKFVPVTDYAATVEGLAAGKLDMVWYGGFTFVQARRRTGNAIPLVQRA
FT                   EDARFHSKFIVPSASKAQSLKDLKGGSFAFGSVSSTSGHLMPRYFLLQTGIDPDTDFGK
FT                   VAYSGAHDVTAKWVEAGKVDAGALNESIWQRLVDEKKIDTSKVRVLWTTPEYQDYNWTV
FT                   RGDLDPKLVEMLRAAFLALDPAKPEDKAILDLQRASRFIPTSPDAYKNIEQAAKSAGLI
FT                   KD"
FT   sig_peptide     557322..557387
FT                   /locus_tag="A2cp1_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            559151..559819
FT                   /locus_tag="A2cp1_0487"
FT   CDS_pept        559151..559819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0487"
FT                   /product="transposase"
FT                   /note="KEGG: ank:AnaeK_0493 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63844"
FT                   /db_xref="GOA:B8JB33"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB33"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0493"
FT                   /protein_id="ACL63844.1"
FT                   /translation="MARVPRFALVERDSSNHCTWRAHDLEFVFEEPGARDEFLELLGRY
FT                   KERYGVEIRSYCLMGTHPHVTCTCRQEQAQFSRFWQVVNGQFARWYNKVRNRRGQVVME
FT                   RMRTPRIQEGGAHQLTVMRYGDLNPVRAGLVKSPKDWKWSSYRHYAFGEPNPLITDAPE
FT                   YLALGKTAPERRKAYQTLFALPLSESLRTRRVELVSFPFVGDASWVRRRLELAGLSPPD
FT                   "
FT   gene            complement(559922..560026)
FT                   /locus_tag="A2cp1_0488"
FT   CDS_pept        complement(559922..560026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63845"
FT                   /db_xref="GOA:B8JB34"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63845.1"
FT                   /translation="MIRWSAAWSAAFGAVLALAGFAVFAAGLYLELRG"
FT   sig_peptide     complement(559949..560026)
FT                   /locus_tag="A2cp1_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            560481..561080
FT                   /locus_tag="A2cp1_0489"
FT   CDS_pept        560481..561080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63846"
FT                   /db_xref="GOA:B8JB35"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB35"
FT                   /inference="similar to AA sequence:KEGG:PHYPADRAFT_25968"
FT                   /protein_id="ACL63846.1"
FT                   /translation="MTVALTAAGFGALHAVSGPDHLLSLAPLSLGQGRRAWRIGLQWGL
FT                   GHAAGTAFAAAVLLAVLSGAGLHVVDAWAERAAGLALVAMGAANLVALHRGRGMAAGGT
FT                   RGGRRAVFSVGLVHGVTGAAALLLLLPAAQAGAPVKALALAGFVAGSTAAMVAVTAAIA
FT                   ALSAAAAPRLALATRRLPALASAVSVAVGIAWTIAG"
FT   gene            561342..561692
FT                   /locus_tag="A2cp1_0490"
FT   CDS_pept        561342..561692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63847"
FT                   /db_xref="GOA:B8JB36"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL63847.1"
FT                   /translation="MGAANLVALRRGRTVAAGLAASGARRAVFSVGLVHGITGAAALLL
FT                   LLPAAHASAPVKALALAGFAAGSTAAMAALTAGIAALSAAAAPRLALATWRLPALASAA
FT                   SVAVGIGWAVAA"
FT   gene            562300..564024
FT                   /locus_tag="A2cp1_0491"
FT   CDS_pept        562300..564024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0491"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: ank:AnaeK_0496
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63848"
FT                   /db_xref="GOA:B8JB37"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB37"
FT                   /inference="protein motif:PRIAM:6.4.1.3"
FT                   /protein_id="ACL63848.1"
FT                   /translation="MTTKAIIPTLTNPLDPPEKVEFTIPGEIARATGGYEEAMKEGWEL
FT                   IQRPIRSVPVDQIEKQHIKKRMTVWERIRVLSDKEPMVLYQNWGKNLDGASLVTAVLNI
FT                   GGRDVAVYGHDFTVRAGSMDATNGSKLARLFRMAGEKGIPLIGMNDSAGAYVPAGVGGL
FT                   DGYAEAFTALRRISGVVPSIMCMFGFNAGGGSYLPRQGSFVIQPADTFFGLTGPGVVKS
FT                   VLGEEISPEDLGGPKVHGASGVADLTVIDELAALRQAVRLLNYVPDNNRTMAPFQETSD
FT                   PLDRKTWEINTLLKKAFNSPTGFNTPFDVSIIIQQVCDYGDFFEIQPERAREVVTAFGR
FT                   LGGHVVGFVANNSAIGSGQIDCDTALKIARFVRFCNVYNIPIIFMEDTTGFLPGREQEA
FT                   RGIVQAGRSMLDAIVDVRTPRILLILRNAFGGAYASYNNYPTGADVVLALPTTRLAVMG
FT                   PAGKEFVYKDELRKMRSAAAERAKKGAQQRVAAGMEGEAARKDAEKEAAEWLKGEEAAL
FT                   GRRYEKELMNPKEGLALGSISSLVMPTDLRKVLGQNLHFLLRHYTPSPMSGPQREFH"
FT   gene            564065..567043
FT                   /locus_tag="A2cp1_0492"
FT   CDS_pept        564065..567043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0492"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   KEGG: ank:AnaeK_0497 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63849"
FT                   /db_xref="GOA:B8JB38"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB38"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ACL63849.1"
FT                   /translation="MASNVDHYRNNPLIHRDRRLGSSPSAWVRSFACEDLKPLIVCRGP
FT                   IRKEAMDVFAEMGITHVGILLSEKDSIVYANALAPELRQLANHDRVHRVPDYTGATKEE
FT                   RVERMNQIVQIALDNGYDSIFAGYGFMAEDEEFVATVERAGLKFIGPNSTTQARAGKKD
FT                   EAKRTALEVKVSVTPGVNDVAARTLLAKHRTRKQLLALVEAEGLACDAKVLADEKVELP
FT                   VLAEHVLQASYARGLDLFTIDELGAQVQVEVAEMFRKYPRSRVRLKAIGGGGGKGQRIL
FT                   GASLLTAKAADEKAVAAAAAEAPAMVREVLSEVKATGVGDNKNVLIELNIEQTRHNEIQ
FT                   LLGNGEWCVSLGGRDCSLQMHEQKLLEVSVTQEALAATIARAANNGKTARAKALAVDLE
FT                   ILKRMEDDAARFGQAVGLDSASTFECIVDRDRYYFMEVNTRIQVEHRVSELCYSLEFAN
FT                   PDDPSDTFVVESLVEAMALLARHKKRLPKPRRIPRFGAAVEARLNATDASLSPHAGGVI
FT                   RYWSKPIEGEIRDDQGISMPNPDTRMFMRYKVAGAYDSNIALLLTKGDRRLESYKHMAR
FT                   VLARMELRGTTLATNMEFHYGLVNWFLGQSVNAKPTTRFVVPYLTLVGMLKDEANKLDT
FT                   AYAFAEMKKHYAKLMATENPGDAAAQKAMTDVLDRKVTLLTRVIDRFLDDPHLFAGWLS
FT                   MNRRHYRIENGKLLWIRNPLGVLNDAYAYLNMAFHPRRPASQVMWEHDHELLTKSLRFY
FT                   VALRERFGLKREEYYKLNEILQKEEPQDGFDAETWTRIRSAHLGYEAGNELLGLLFMVA
FT                   ESVRFFDFKVEDDLEVTIPEHLHDPELQARMKKVLCPPPATKADELVAPFGGMFYRQEA
FT                   PGRPPFVEEGQHFEKGQPLYIIEVMKMFNTVRAPFSGTIEKVLMQGADGTVVQKGQPLF
FT                   KITPDEKFVPVDPKAVERERRTRTQKHLEGVLMTFAEKFTTVEPVRFEEPEEEVAWAGV
FT                   EAV"
FT   gene            complement(567120..567587)
FT                   /locus_tag="A2cp1_0493"
FT   CDS_pept        complement(567120..567587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63850"
FT                   /db_xref="GOA:B8JB39"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB39"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0498"
FT                   /protein_id="ACL63850.1"
FT                   /translation="MTDRTDRDEIHRTAPAYWALRIALGVVPIVAGLDKFTNLLADWAG
FT                   YLSPLAVRLLPVSPAAFMRAAGVIEVIVGVGILSGRARTFGWIAMAWLAAIALNLIASG
FT                   AFLDVAARDAVMAVAAFALARLAAVHEPVRARRATAVEPQATAAHPAATRP"
FT   gene            567688..568374
FT                   /locus_tag="A2cp1_0494"
FT   CDS_pept        567688..568374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0494"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: ank:AnaeK_0499 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63851"
FT                   /db_xref="GOA:B8JB40"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB40"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACL63851.1"
FT                   /translation="MAVQAGRTRVVPTLAPADDEVVARVLEGDVALFEVLMRRHNPRLY
FT                   RAIRSVLRDEAEVEDAMQQAYLQAYAHLGDFQGQAAFSTWLVRIGVNEALMRLRGRGRL
FT                   VLAAEPPEGGRVGEEEHVADPSPEDQAATHEARALLEQAVDRLPLHLRTVYVLREIEQL
FT                   STAEVAAALELGEEAVKVRLHRARLALRELIAARVGQSAPKAFGFLAPRCDRVVAAVLA
FT                   AIPARR"
FT   gene            complement(568438..568941)
FT                   /locus_tag="A2cp1_0495"
FT   CDS_pept        complement(568438..568941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0495"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="KEGG: ank:AnaeK_0500 blue (type 1) copper domain"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63852"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB41"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0500"
FT                   /protein_id="ACL63852.1"
FT                   /translation="MMSWKTWRLGAAALAAAGVAACGGSSDSGSASSTRPTAAGYYIQI
FT                   SGMRFNPLDLKVPAGATVTVINDDSMAHSVTSEATPGAYTPGEVSGIAFDTGAFNGVHT
FT                   FSIPATAAQGTVIPYYCSTHLGGMATPNGSITIDPAAQPAPPPARPGTGGGGGGGGGGG
FT                   GGGY"
FT   sig_peptide     complement(568849..568941)
FT                   /locus_tag="A2cp1_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.275 at
FT                   residue 31"
FT   gene            complement(569070..571739)
FT                   /locus_tag="A2cp1_0496"
FT   CDS_pept        complement(569070..571739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0496"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: cation transporting ATPase
FT                   domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   ank:AnaeK_0501 ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63853"
FT                   /db_xref="GOA:B8JB42"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB42"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ACL63853.1"
FT                   /translation="MANVPEWHALSADDARARLGSGPDGLAPAEAARRLAEHGPNELAR
FT                   ARRAPWIALLAAQFENVLVVILMVAIALSLFLGHDLEALTIGAILAFTVVLGFVQEHRA
FT                   ENALAALRQMAAPHATVIRGGAERRVPARELVPGDLLLVHAGDRIPADARVIEAVNLQA
FT                   DEAALTGESVPVPKVAGPLPAGPIPVGDRTDMLFGGTAATYGRGRAVVVATGASTELGA
FT                   IARMLAEVKPARTPLQLELDRVGAQLARAAGVVVVLLAGLGLLRGQPFLEMVVFAIALA
FT                   VAVVPEALPAVVTIALALGVQRLARRNALVRRLAAAETLGSTTVICSDKTGTLTRDEMT
FT                   VRALHVDGRTLEVTGSGYRVDGDFRHDGAPVDSPPALLALLAGAVLASDAKVERTPSGE
FT                   LTVSGDPTEAALVVAALKAGLDRAELDARAPRVGEIPFTSELKRMTTLHRTERGPLAFV
FT                   KGAPEVLLPACARVASGEGERPLDEAGRAALLEVVRGMAERALRVLAVARREGVSLAES
FT                   DRDLTLLGLVGMIDPPRPEARAALERCAAAGVRVVMITGDHPVTARAIAAELGLLRTGA
FT                   VVTGPELARLSDAELAGRVQALEVYARVSPADKLRIVTALQSRGEVVAMTGDGVNDAPA
FT                   LKKADIGVAMGITGTDVTREAAAMTLTDDNFASIVGAVEEGRAIFANVKKYLMYLLSSN
FT                   VGEIGLMAAATLLGLPLPLTAVQILYVNLATDGLPALALAVDPPDADLMRQPPRDPRAG
FT                   IFTRPVVALIATGGAWSTAVNLGLFAWARASGRGDAEAMTMCFMSLVLVQFAKAFAFRS
FT                   ERHSVLRRPFANRWLDLAVAWELALLLLVVYLPPLRAAFGTYALPAADWLLVTGAALTV
FT                   LPVLELAKLAVRRATPSA"
FT   gene            571854..573041
FT                   /locus_tag="A2cp1_0497"
FT   CDS_pept        571854..573041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63854"
FT                   /db_xref="GOA:B8JB43"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB43"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0502"
FT                   /protein_id="ACL63854.1"
FT                   /translation="MSASAPVLLGYGTRPLPFPSGVPARVLAAPPAPAVADLPAALDAA
FT                   LAHPEGARPLQEVAGPRTRVLVIVSDASRDEPRAELFAAVRRALAVVPDDHLTVGVANG
FT                   THGPGPLAALGLPEDVFRRHRVVNHDARDEASMVEMGRTSRGTRLRVNRCVAESDLVVT
FT                   TGRVKPHYFAGWGGGAKGIFPGLGHDDDIRQNHKLKADPASSLGRADGNPCREDLEEAI
FT                   RRLGRDTYMLNVVEAGGVVLGAVAGDVVYAHRAGVRMARPWCEVAAEPADVVVVSAPLP
FT                   VSGSLYQASKLVPPAGMLLREGGVVIVCAECPGGVGPLRTVNEGIFQLGVRRFLPERYA
FT                   LLLVSGMPETTVRETYATFAPSLDAALASAREIVGKAEPDVLVLPDAGDLVPRRR"
FT   gene            573076..574374
FT                   /locus_tag="A2cp1_0498"
FT   CDS_pept        573076..574374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0498"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ank:AnaeK_0503 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63855"
FT                   /db_xref="GOA:B8JB44"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB44"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACL63855.1"
FT                   /translation="MTDEPIPQGGKLSSFRQVPRTGVIYATSEATKLGFSMQDPEWCNL
FT                   GQGQPETGPLSGAPDRVHSVAVSVDDQEYAPVAGLWELREEVAGLYNRLYRRGLPSQYK
FT                   AENVSISGGGRTSLTRAAASLGRVNMGHFLPDYTAYEELLDLFRTFTPIPILLEGERGY
FT                   AFTVDDLRREVTGRGLSALLLSNPCNPTGKLVQGEELARWVELARELECAMLMDEFYSH
FT                   YVWTAPPGRLPVESAARYVEDVDRDPIVLFDGLTKNWRYPGWRVTWTVGPRKVIDAVAS
FT                   AGSFLDGGGSKPLQRAAIPLLAEEAVRQETEAIHRGFGEKRRHMLDALETMGVRIDRAP
FT                   DGTFYVWGNLANLPAPLNDGMGFFREALRRKVIVVPGEFFDVNPGKRRARHVARFRSYV
FT                   RFSFGPSLETLEKAFGRLAAMIQERSSSTASVG"
FT   gene            complement(574396..575250)
FT                   /locus_tag="A2cp1_0499"
FT   CDS_pept        complement(574396..575250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0499"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: ank:AnaeK_0504
FT                   hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63856"
FT                   /db_xref="GOA:B8JB45"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB45"
FT                   /inference="protein motif:TFAM:TIGR00073"
FT                   /protein_id="ACL63856.1"
FT                   /translation="MCTTCGCGDPELVPVELHEKILAGNDRAARHNREHFLEAGVLALN
FT                   IMGSPGAGKTGVLEATAKAAASKGWKLGAVSADLATDNDARRLEKAGIPSKAITTGQAC
FT                   HLDAELVHRSLHDFPWRDTDVFFIENVGNLVCPAIYDLGQAANVVVLSVTEGEDKPLKY
FT                   PVMFKAADLVLVSKVDLVPHLDVDLPKLRDAIAHVMPTAKVIELSARTGEGMDRWIAWL
FT                   EELRRPILRPAHARSHTHEHGHGHDHTHADDHAAEHTHAAEHTHDHGHGHDHGHGHDHG
FT                   HRH"
FT   gene            complement(575250..575594)
FT                   /locus_tag="A2cp1_0500"
FT   CDS_pept        complement(575250..575594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0500"
FT                   /product="hydrogenase expression/synthesis HypA"
FT                   /note="PFAM: hydrogenase expression/synthesis HypA; KEGG:
FT                   ank:AnaeK_0505 hydrogenase expression/synthesis HypA"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63857"
FT                   /db_xref="GOA:B8JB46"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB46"
FT                   /inference="protein motif:PFAM:PF01155"
FT                   /protein_id="ACL63857.1"
FT                   /translation="MHEYSLVEALVRRVEQEARRREALAIRGLTVSVGELSGVDPELFR
FT                   TAYETFRAGSLCADTPLTLKRLEARWSCPACRAPIARGAVLRCPTCDVPARLDEGSDAL
FT                   TLDSIDMEVP"
FT   gene            complement(575609..576634)
FT                   /locus_tag="A2cp1_0501"
FT   CDS_pept        complement(575609..576634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0501"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: ank:AnaeK_0506
FT                   hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63858"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB47"
FT                   /inference="protein motif:TFAM:TIGR02124"
FT                   /protein_id="ACL63858.1"
FT                   /translation="MDTKVQQKIGLKHGSGGRAMRQLIEDVFLSLASPVDGIGLSALDD
FT                   GAAIRVGDRWLVITTDSHVVHPIFFPGGDIGRISVSGTVNDLAMMGATEPVGLTCAVII
FT                   EEGFPRADLERVVASMRETAKEAGAPFVTGDTKVMGKGQVDGLLLNTTGVALADRVVSD
FT                   AGLRAGDLLVVTGSIGDHGMAVMARRHDLRLEGDLRSDVAPINGLVRAALAAGGEDVVA
FT                   MKDPTRGGVAGVLHEMAAKGGVGIVVDEPSLPVNDEVRAAGEMIGIDPLLVANEGKAVI
FT                   GVRARSADKVLAALRAHPLGARATVFARAIAERPGAVILDTGFGRRMLAEPEGELLPRI
FT                   C"
FT   gene            complement(576651..577787)
FT                   /locus_tag="A2cp1_0502"
FT   CDS_pept        complement(576651..577787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0502"
FT                   /product="hydrogenase formation HypD protein"
FT                   /note="PFAM: hydrogenase formation HypD protein; KEGG:
FT                   ank:AnaeK_0507 hydrogenase formation HypD protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63859"
FT                   /db_xref="GOA:B8JB48"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB48"
FT                   /inference="protein motif:PFAM:PF01924"
FT                   /protein_id="ACL63859.1"
FT                   /translation="MSNEDLFRQLKFRDPARARALAEALRHNMDAIGREVSVMHVCGSH
FT                   EQAIARFGLRAVLPPGLELIMGPGCPVCVTDGPEVDEAVALAMQGVRVCTYGDMLRLPG
FT                   TARSLADAQADGGKVEVVYSISQAVELAHAHPDEQVVFLASGFETTAVATAAVALASPP
FT                   PNFSILSVHKYVPAAMEIVAASKETHIEGYIAAGHAAIITGWAIFEPFAARTGAPVVVA
FT                   GFEPLDILAALVKLTELIREGRPEVANVYPRCVTKEGNLPAQRSLWRAFRTVTGRWRGI
FT                   AEVPGGNLELVPELASLDARKRFRIDTAGVRDAAAEEEAKGCLCGRIMLGLATPEHCAL
FT                   FGTTCVPESPVGACMVSSEGQCRIWHTYGGVPDLRKVG"
FT   gene            complement(577800..578087)
FT                   /locus_tag="A2cp1_0503"
FT   CDS_pept        complement(577800..578087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0503"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: ank:AnaeK_0508 hydrogenase assembly chaperone
FT                   HypC/HupF"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63860"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB49"
FT                   /inference="protein motif:TFAM:TIGR00074"
FT                   /protein_id="ACL63860.1"
FT                   /translation="MCLGVPGKVIAIDGLDATVDFFGVRKSLRLDIVDEPVQVGDYVLN
FT                   HVGFAIRRIPPEEVQETLALFDQILEVSGAKEDLMAADVRGEMAAGKDQK"
FT   gene            complement(578115..580436)
FT                   /locus_tag="A2cp1_0504"
FT   CDS_pept        complement(578115..580436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0504"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="TIGRFAM: [NiFe] hydrogenase maturation protein HypF;
FT                   PFAM: acylphosphatase; SUA5/yciO/yrdC domain; zinc finger
FT                   HypF domain protein; KEGG: ank:AnaeK_0509 (NiFe)
FT                   hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63861"
FT                   /db_xref="GOA:B8JB50"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB50"
FT                   /inference="protein motif:TFAM:TIGR00143"
FT                   /protein_id="ACL63861.1"
FT                   /translation="MTTQRTTDGGPDLSAEGRRIAVSGTVQGVGFRPFVYRLAHQTGVT
FT                   GRVRNDAAGVTIEAFGSPAALDAFQARLVSDRPPAASIAALRAEVIPAEPAPRFEIVES
FT                   GRSAERRVAIPPDLATCPECLRELGDPADRRHRYPFTNCTACGPRFTIALDVPYDRPAT
FT                   TMAGFRMCPACAREYGDPLDRRFHAQPNACPACGPRVALRDAAGAPRPSADPIRDCADL
FT                   LRAGGIAAVKGLGGYHLACDASAPAAVRTLRERKRREEKPLAVMVADLDAARALAEVSP
FT                   AEAALLTSPERPIVLCRRRPDAALAAEIAPGSPIVGLMLAYAPLHHLLLADAGVPLVMT
FT                   SANLSDEPIAFEDGEALARLAGIADLFLVHDRAIASRCDDSVARVVAGRPMVMRRSRGF
FT                   VPRPVRTARRFARPVLAAGAQLKNACCLARGDEATLGPHVGDLDGLETYGAFEAAVARL
FT                   ETFLAFRPELLACDLHPLYLSTRWARERAGALALPLVEVQHHHAHAAACMAEHGLEGPA
FT                   LALCWDGTGLGTDGASWGGELLLAEAARFDRLATFRPVPLAGGDRAIRDPWRIALAALL
FT                   DAFGEDAPLDRLPLFAGVPARELEVVRRMLATGLNAPPAHGAGRAFDAAGALALCRPSA
FT                   RFEGQVALALDAAAHGHEAAPYPFDLDASGPVEALDLRPLWRALAADVLAARPAGEMSA
FT                   RFHAALAAAGAEQVRRAARRTGKLPVVLTGGCFQNARLAEAIRARLDGEFAVYQHGEVP
FT                   PGDGGIALGQAVVADAVARA"
FT   gene            complement(580581..581108)
FT                   /locus_tag="A2cp1_0505"
FT   CDS_pept        complement(580581..581108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0505"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease; PFAM:
FT                   peptidase M52 hydrogen uptake protein; KEGG: ank:AnaeK_0510
FT                   hydrogenase maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63862"
FT                   /db_xref="GOA:B8JB51"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB51"
FT                   /inference="protein motif:TFAM:TIGR00072"
FT                   /protein_id="ACL63862.1"
FT                   /translation="MARIAVFGIGNVLTGDDAVGPYVVKVLEAGWELPGVEVVDAGTPG
FT                   LDLTAYFAGLDAAVLVDAVKARAAPGELRTYSREDLVKRSPVLAVSPHEPGLREAVMNA
FT                   EFMGVCPATVRLVGVVAERTDLGCALSPAVQAAVPAAVEQVLSELRALGVAPRPRDPPA
FT                   EPDLWWEKGRAG"
FT   gene            complement(581205..582938)
FT                   /locus_tag="A2cp1_0506"
FT   CDS_pept        complement(581205..582938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0506"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: ank:AnaeK_0511 nickel-dependent hydrogenase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63863"
FT                   /db_xref="GOA:B8JB52"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB52"
FT                   /inference="protein motif:PFAM:PF00374"
FT                   /protein_id="ACL63863.1"
FT                   /translation="MSKLITIDPVTRIEGHLRIDVEVDGGAVKNAWSSGTMWRGIETIL
FT                   QGRDPRDAWIFTQRICGVCTTVHAIASVRSVENALGLEIPLNAQLIRNLIVTAHTLHDH
FT                   IVHFYQLSALDWVDVTSALKADPVKAAQLAESISSWPGNSKHELAAVKARLEGFVKAGQ
FT                   MGIFTNGYWGHPAMKLSPEVNLLAVAHYLQALEIQRKANMAVAILGSKTPNIQNLAVGG
FT                   VANAINLDSPAALNMEKLYQVKTLIDEVATFIQQCYLPDVAAIGGFYPDWFKYGAGVTN
FT                   YLSVPELPLDEKMSKFDIPGGVLWNGKLEVAHKITSWNDDYLKQNVTESIAHAHYDGAW
FT                   AKGPWEEDDKPKFAGEWKHETPAPDRYTWVKAPRLEGKAVQVGPLACVLVGLASGHEPT
FT                   TRWATAAIGAVKAVHKIDLTPAHLHSTLGRHAARAIRAAMMAEMAQKQWKLLVENIGKG
FT                   DTRIWVDPMANLKPGIYKGVGFHEAPRGTLSHWCVIEADKKGMKLKNYQAVVPSTWNAG
FT                   PRDASGALGPYEKSLVGNPIADPKLPLEALRTIHSFDPCLACAIHTVDAEGEEISRVKV
FT                   L"
FT   gene            complement(582950..584197)
FT                   /locus_tag="A2cp1_0507"
FT   CDS_pept        complement(582950..584197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0507"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   ank:AnaeK_0512 polysulphide reductase NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63864"
FT                   /db_xref="GOA:B8JB53"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB53"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ACL63864.1"
FT                   /translation="MSGHDHPQAIGGKMLDPLMKILLAVFGVSAVVMAYRFVMGVGAVS
FT                   NMTDGFTWGIWEPINVVVFTGIGAGAYGVGLLCYLLNKGQYHGLVRPAVLLGAIAYTLG
FT                   GSSIMIALGRYWNAVTLPIVPWWNLSSALLEVAVCVMMYVMVLWIEVLPAVFDGAAQSK
FT                   SPRWSAVGKKWGARMAKAMPYIIALAILLPTMHQSSLGGLYLIAGPKLHPLWHTALLPT
FT                   LFLVSCLSMGYGAVVVLVNILRLNWNAKQDQALFASMSKVNAGFLLLYVVLRLGDVVLN
FT                   GKLRFLGADFATFLFVVEMALFIAPAVMFVMPGVQRNRGKLFGAALLALLAGAVYRADT
FT                   YMTMYRPAGWTADGKSIAAGWDYFPSLGETVVTVGMAAVGMAIFIFISRLFPVVVVDQG
FT                   KKSTIGRGEVRAASGH"
FT   gene            complement(584194..585147)
FT                   /locus_tag="A2cp1_0508"
FT   CDS_pept        complement(584194..585147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0508"
FT                   /product="hydrogenase 2 protein HybA"
FT                   /note="KEGG: ank:AnaeK_0513 hydrogenase 2 protein HybA"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63865"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB54"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0513"
FT                   /protein_id="ACL63865.1"
FT                   /translation="MTISRRDLLKGAVAAGAAVAIPATAEARHEIEPLPDAVGMLFDST
FT                   LCVGCRACQSACKASNKLPEDKVEANGGVYDAPNDLNSTTKNVIKAFPAGDVQHYMKQQ
FT                   CMHCVDPSCVSVCMLGALHKEGEGKRDFKGEKKGTGIVLWDKWTCVGCRYCQIGCAFNV
FT                   PKFEWFEAFPAIVKCELCRHRRDEQKTGPYAVANPACCEVCPREAVVFGYRKDLLAEAK
FT                   RRVAADPQRYNPHVYGEHDGGGTQVLYLAAAGVQFHDLGLPDLPERSQAEFSESVSHAP
FT                   YLHGVTPVALYAAMAFVINRNKKKEKAAEHGEEGKR"
FT   sig_peptide     complement(585070..585147)
FT                   /locus_tag="A2cp1_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.871 at
FT                   residue 26"
FT   gene            complement(585153..586277)
FT                   /locus_tag="A2cp1_0509"
FT   CDS_pept        complement(585153..586277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0509"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="KEGG: ank:AnaeK_0514 hydrogenase (NiFe) small
FT                   subunit HydA; TIGRFAM: hydrogenase (NiFe) small subunit
FT                   HydA; PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63866"
FT                   /db_xref="GOA:B8JB55"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB55"
FT                   /inference="protein motif:TFAM:TIGR00391"
FT                   /protein_id="ACL63866.1"
FT                   /translation="MDNIGSQMISGPETKGVSRRDFIKVCSVAAAAVGLPAWAGEKMAE
FT                   NVGKKKPSVVWLHFQECTGCTESLLRTSHPDVGALILDLVSVDYHETLFAAAGKQIEAA
FT                   LETAKKAGGYVLVVEGAIPKKDDGIYCMVGGKTAVDSLVECAEKAAAVICIGSCSSWGG
FT                   VPSAAPNPTQAVGAPEILKEKGIKKPVVTLPGCPANPYNLLGTVLQFATFGTLPKLDEK
FT                   GRPAFAYGRVIHEDCPRRPHFDAGRFAQAYGDEGHRNGWCLYKIGCKGPQTHANCSLLS
FT                   FCEVPGAWPIGIGHPCVGCTEQGIVFNVPINQNLPIEHPTAPMAYPAIHPEHGVVGGSP
FT                   VAVGLGGAVIGALVGAGVVASRKMAAADDADGKE"
FT   sig_peptide     complement(586158..586277)
FT                   /locus_tag="A2cp1_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.601 at
FT                   residue 40"
FT   gene            complement(586746..587234)
FT                   /locus_tag="A2cp1_0510"
FT   CDS_pept        complement(586746..587234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0510"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: ank:AnaeK_0515
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63867"
FT                   /db_xref="GOA:B8JB56"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB56"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACL63867.1"
FT                   /translation="MALPEPSIGLLVLLARHGIRDVVGPRAGRHRLTVQQFWALYWLLH
FT                   QPGLAPGELAAAMLLDPPAGSRLVSELAKRKLVEARPDRADRRRARLFLSEKGEPLARR
FT                   VAEDAARYHAESLRGMEPAEVEALRSGLRKLIDNLAELAGAPAQPAAARRNGRGARAG"
FT   gene            587365..589062
FT                   /locus_tag="A2cp1_0511"
FT   CDS_pept        587365..589062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0511"
FT                   /product="MutT/NUDIX family protein"
FT                   /note="KEGG: ank:AnaeK_0516 MutT/NUDIX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63868"
FT                   /db_xref="InterPro:IPR039461"
FT                   /db_xref="UniProtKB/TrEMBL:B8JB57"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0516"
FT                   /protein_id="ACL63868.1"
FT                   /translation="MNAVRNLSTSLLASIAALAAAVPGASRAAEAAPPGVAALRRAEAR
FT                   FAPVDLKVDLSKLPASERTALAKLVEAGRIMDALFLRQVWAGNEALLLRLVDDRSPLGE
FT                   ARLRLFLRNKGPWDRLEEDRAFLPGVPEKPQQANFYPAGAGKDEVERWAAGLAPEEKDR
FT                   AMGFFTTVRRDAAGKLVAVPYSLEYQGELARAAALLREAAAATQDAGLRTFLEARAAAF
FT                   VGNAYRDSDVAWMRLDSAVEPTIGPYEVYEDGWFNAKAAFEAFIGVRDEAETAKVARFA
FT                   AELQGIEDALPIDAAFKNPKIGALAPIRVVNEVYAGGDAAKGVQTAAYNLPNDEWVTRT
FT                   MGSKRVMLKNVQEAKFQKVLLPVARRLLSPADRAHVAFDPFFTHILMHELVHGLGPHHA
FT                   KVNGEEVTVRAALADTYSALEEAKADVAGLFALEKLLDDGKLDRRMRATLYPTFLCGAF
FT                   RSIRFGLNEAHGKGMAIQLNWLLDHGAIVARKDGTFAVDAAKMRDAVAGLTREIMTIQA
FT                   RGDRAGAKAMLEKLGVVRPEVARALARIEDLPVDIAPRFVTADALTAR"
FT   sig_peptide     587365..587451
FT                   /locus_tag="A2cp1_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.862 at
FT                   residue 29"
FT   gene            complement(589203..591311)
FT                   /locus_tag="A2cp1_0512"
FT   CDS_pept        complement(589203..591311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0512"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: ank:AnaeK_0517 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63869"
FT                   /db_xref="GOA:B8JBU7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBU7"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACL63869.1"
FT                   /translation="MSRNWKLARLVAALTLLPAPGAAEEPAAEPRTEVLLEEIVVKSRR
FT                   EPRADGLEVREVRETPARDLGEALEQTLGLGKVRKAGIASDVVLRGLKRDDVNVLVDGT
FT                   RTHGACPSRMDPPAFHLDWAEVDGVEVRRGPFDVSQPGGLGGVVDVRTRGARPGPGAEV
FT                   NLGAGSSGAMESSAVASYGGGRASLLLGGAFKRSDPYLAGDGRNITEVIPATSTGRYRD
FT                   TSDHQTAYDVRSGWAKVGLTPAEGQQLEVAYTRQEADDVLYPYLLMDGIRDDTDRVNAT
FT                   WRAGALGPLASARAQLYWTRVAHDMDDRDRCSSAADPAACAGGLAEAWSMRTEARTRTL
FT                   GAKLEAGLGGADAAVEARIGADLVVRNWDNETIRVRRAMPGQPYVGEASIPDVTQTTGG
FT                   AYAELRHALAPSVRATAGARLDVAESYAGVDRRDFYATWRPDTTPERSRTDLLFAGNVQ
FT                   LDWDAARGLTVFAGYGHGTRLPDPQERYMALAGLMGKPAWVGDPSLRPTRSDELDAGLR
FT                   FTADRLLAKAQVFHAWVEDEITLVPLALASGATARTYAGVSARRVGGEASARLALPLRL
FT                   HAGAAVAYVWARNDTAGTPLAEVPPLRASASLRWDDGRFFAEAEEQWAARQDRVDPALG
FT                   ERPTAAWFITNLRAGAGWRGVKAFVGVRNLLDKTYAEHLSYLRDPFAAGVKVPEPGRTL
FT                   YANAQWTF"
FT   sig_peptide     complement(591240..591311)
FT                   /locus_tag="A2cp1_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.912 at
FT                   residue 24"
FT   gene            complement(591416..591904)
FT                   /locus_tag="A2cp1_0513"
FT   CDS_pept        complement(591416..591904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63870"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBU8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0518"
FT                   /protein_id="ACL63870.1"
FT                   /translation="MLAVAGRPAARVAAALLALALSGGVRLLPAGPVSGPHRCSCRSHG
FT                   EDHLCACAVCNAQARRARKAARPEDLPPCHRDAARRAAAQEEARARRAALPGLLPTCGD
FT                   PEGGLAAPGALDPFAVPARPALALAEWRTTPAAPAATAPERAPRPAVPPPRPSAVRAL"
FT   gene            complement(592012..596307)
FT                   /locus_tag="A2cp1_0514"
FT   CDS_pept        complement(592012..596307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0514"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ank:AnaeK_0519
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63871"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBU9"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ACL63871.1"
FT                   /translation="MNLRVLPALAAASLSLLAARAGAADAPWEGAPFSADPKAMLAAAQ
FT                   ALAPPKAAGVDVLLEEGRFRYDARGALTLEHRLVFRLLTAEAARSWSRVERSYAPWQQA
FT                   RPELRARVITAQGEVHELDPSTLTEQGVADRADLMYSDRRAVAGPLPAVRAGSLVEELI
FT                   VVRDTAPAFDGGTSTRFFLAQALPARRIRVEVAAPAGLPLRWVVRGIDAAPKETKDRGE
FT                   RRLVIDRRDVPGWTAVEPGAPRDTPPAPYLAFGWGRSWADVSARYAATWERQLAGSDLA
FT                   AAAREALGEGKAPDRAEAVRRVVAWVHRSVRYTGLELGEAALVPATPTEVLKRRYGDCK
FT                   DLSLLVAGLLRAAGHDARLALVRTDWHEVNPELPGISQFDHVVVRVEGSPAIWVDATDP
FT                   YTPPGVLPPAVEGRLALVTPGGRELVRTPERAAADNRVRIVRELFMAESGRGRIRETRE
FT                   LVGALAASERAFRERIPPERRDEVAEHYAKEVLRAAEVLSATTEGLDDPSAPLRLVVDA
FT                   KETDAVRTADDEAALPVTPDQVFDALPGFLTGDPEGHAAAPAKRTADLLLVVPYQWEVT
FT                   YRIHAPDGFQPRPLPASTTERFGPATYSQAYALEPDGTVTATFRLDTGGRRLSAADAAR
FT                   LGKRAREVVRGGSPVVALDRTAAALLAAGKVPEALAEMRRLAALHPKEALHHVQLAAAL
FT                   VRLGFSEQAAAEVRQAIALEPDSAWAHRILGWILQHDAVGRYQGPGHDRAGALAAYRKA
FT                   KDLDPDHAGGRAALAELLAREANGAPAATIGEAIEEFEAIRSDLHEQAFDGPYLRTLFD
FT                   AGRDADAEKLARDVPRGRERDALLLAAVAMQRGAPAAEDEARGMGEGRRDALRDAARLM
FT                   VGRRSYAAAAALAGAAAQGAPNAAEIRQQADLFLGLKPWESLAPQGSEAARLVKRLFVV
FT                   ALRSPEPGKELPGMVARARLGPELARIADQGLGGPVAGARRSLHEQGIPPDVLLDLVLS
FT                   RVEMLEDGDPRAAVRVRVQFPFTPGDGRSAVFVVRDGKEPKVLATDTAWPILGAEALRL
FT                   AGAGDLAGARRWLDWARETLPGAESDPSTPAGVLARLWRPGAEAGAPEVRRAAAAVLAW
FT                   ADEAGRTLPTLSEARAQAADPAERRALGFALAQAYRAAGKREDQLRVARELLQDDPASR
FT                   EAFALGAVALADLKRPADLEALAAGVLQRLPDDPEVLGLLGNLRLGAGKVDEAAKAFRR
FT                   LIDAGKASPLVLNNAAWLELFRATPGKDALDWARRAVEGERGQNHPSLNTLAAIYAASG
FT                   QPAEAREVFLRSLDVSGDALEPADWFVFGRIAEAWGVPEAARAAYARVAPDPLDPTAPH
FT                   ALAQRRLALLGPAPAVPGAPAQPVPAGPAPAAAPVVKPAGPAPAPAPSAAPPPAPATPD
FT                   GAKPGKKAPARKKPAPPAPKAPAAGERPA"
FT   sig_peptide     complement(596236..596307)
FT                   /locus_tag="A2cp1_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 24"
FT   gene            complement(596408..597109)
FT                   /locus_tag="A2cp1_0515"
FT   CDS_pept        complement(596408..597109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0515"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: ank:AnaeK_0520
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63872"
FT                   /db_xref="GOA:B8JBV0"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBV0"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ACL63872.1"
FT                   /translation="MPPAIVDAEDLRILAHLCVALVVGGAIGIERSYHGRPAGFRTHAL
FT                   VCLASSLLMLLTLYQQRWFPSAESVRLDPTRMAQGIMTGIGFLGAGVIFKEGITVRGLT
FT                   TAASIWITSAIGVMVGSGMYFPALAATVLTLGVLSGFRLIEARLPAHQYAAHRLRFHRD
FT                   EALGEEAVRELLARHGCKVSSMSWRLTDEGRCVEYRMTVRTSDARNFSRLAATLQGLAV
FT                   VREFVLSPAGD"
FT   gene            complement(597194..597757)
FT                   /locus_tag="A2cp1_0516"
FT   CDS_pept        complement(597194..597757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0516"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   ank:AnaeK_0521 protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63873"
FT                   /db_xref="GOA:B8JBV1"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBV1"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /protein_id="ACL63873.1"
FT                   /translation="MESILGSFLLVAASEMGDKTQLLAFSLATRFRKPWPIMAGILVAT
FT                   LANHGLASSLGAWISANVPARMLAGVLALTFLLFGLWTLRPDSLEASKGPERFGAFLTT
FT                   TVLFFLAEMGDKTQLATVALAARYGDVIRVTMGTTLGMLAADGLAVFLGEKLAARVSSA
FT                   RIRWAAAGLFFLFGLISAWAAIAG"
FT   gene            597855..599408
FT                   /locus_tag="A2cp1_0517"
FT   CDS_pept        597855..599408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63874"
FT                   /db_xref="InterPro:IPR025079"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBV2"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0522"
FT                   /protein_id="ACL63874.1"
FT                   /translation="MRGSAVPARRVLIAAACLALSWPQPHDAADPRSPPPAAEDEVAAA
FT                   SAPAAPLRAVAPDAPAATAATLPASVLPPPALSPRPSPHPLPPGANVFLPAAESAAVTL
FT                   AMMGWNRWVGEAPWADITGDSIGRNLRSAWVLDDDQFWINQFGHPYQGMWSMTAARSAG
FT                   LGFWGSTPYTIASSLVWEIAGETEPPSINDQITTPIGGIVLGEVLFRLAGILRGDGRNP
FT                   WRELGAGLLAPMDALNHGLLHDGHDELDEPRAWTLSAGPVAARLAWDAAGPPPGWETSP
FT                   EVAFRMVHGLAWHPAFRFERPFDHFELEAAYAGRSNPDATLILRGLLAGATYGDPAGWR
FT                   GVYGLYGSFDLDTPGVFRVSTSALGLGTSGGRLLAHDVRVEGTAIVSGILIGGGGQVAR
FT                   DAEGKGRDYRLGPGGQSVLELQLTAAERATVRLGLRHYLLFGAGTIGGDELIGAGDAAV
FT                   VVRIAGEHGVGIEGTLHTRTLWPETGGREAFTGRSVRVFWEMNGFHAPPEPLDPALLTQ
FT                   "
FT   gene            599589..600419
FT                   /locus_tag="A2cp1_0518"
FT   CDS_pept        599589..600419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63875"
FT                   /db_xref="GOA:B8JBV3"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBV3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0523"
FT                   /protein_id="ACL63875.1"
FT                   /translation="MPSQPIIARQAPEAPAAAPAKRRSMLPHEHGAWGQLAMPLLTALA
FT                   IARPGAAAWLLTAAVVLAFVAHEPLLIVLGQRGRRAVAEDGARARRWLAALGALTAATG
FT                   LAGIALAPPAARLALLLPAALAVVVGVLVWRRLEKTVAGEITVAAALASAGYAVALAAG
FT                   AEHPAALAALLAWILAFGAATLAVQVILVRVRSKGAADPGRRHAVLAGLLAVAAVALSA
FT                   AGLPGALALATLPTALFSIVVCLVRVSPKRLRELGWALVGSSAVTLVILVVGLR"
FT   gene            600452..601213
FT                   /locus_tag="A2cp1_0519"
FT   CDS_pept        600452..601213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0519"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   ank:AnaeK_0524 nuclease (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63876"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBV4"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ACL63876.1"
FT                   /translation="MIRSRPPLLALCCLALALAAPSEARARRGRSARAAEGRVVLDGEA
FT                   AAVRWTDGDTFRLLTGPRAGQRARLAGVNTLETYGPVHRWGGWRPEALLAVARAAGPRA
FT                   AAGTWDCRSVRGRGGRDRYGRLLVDCPGLSRALVREGLATVFAMDGPADPALLAAQQEA
FT                   QRAGAGMWAEGVPDVIVSSAHSAGEAGLGRRGAYDRLVDVRTGAATARPHARTYRACEE
FT                   VCAGEGGGRSCLVYVPYERRFRDRPRCLGGR"
FT   sig_peptide     600452..600526
FT                   /locus_tag="A2cp1_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.558 at
FT                   residue 25"
FT   gene            601389..601820
FT                   /locus_tag="A2cp1_0520"
FT   CDS_pept        601389..601820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0520"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   ank:AnaeK_0525 hemerythrin-like metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63877"
FT                   /db_xref="GOA:B8JBV5"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBV5"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ACL63877.1"
FT                   /translation="MIEAHAWNEKLDLGHEAMDHEHHLQIALVTALTEAIEQARPWMAR
FT                   QLSAQLLSYSGIHFGSEEMLMQASAFVGLPDHASEHRTLLEAMREIQGALERGEDDLAL
FT                   AFAVELRAGLAGHMAGSDRRLADHVRPVQPAGAVVIPIR"
FT   gene            complement(601844..602620)
FT                   /locus_tag="A2cp1_0521"
FT   CDS_pept        complement(601844..602620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0521"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ank:AnaeK_0526 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63878"
FT                   /db_xref="GOA:B8JBV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBV6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL63878.1"
FT                   /translation="MDVGRMELRGRPVLRELRFSVAAGERVVLLGVNGCGKTTLLKLMD
FT                   GLAFPQEGAVRWRGRALDAPALAGAAFRRAFRGEVALLFQNVDAMLFNPSVADEIAFGP
FT                   RQLGVAEPEVEARVARWAGAFELTALLERPPFELSGGEKKRVAMAALMAVGPKVLLLDE
FT                   PTAGLDPASAGRLVDFLAGLERVTVVTSTHHLTLAEELGTRAVLLGPDRPGVLFDGPTA
FT                   ALLGDERALVESGLAHRHVHAHGVEVHAHFHVHDTE"
FT   gene            complement(602635..603201)
FT                   /locus_tag="A2cp1_0522"
FT   CDS_pept        complement(602635..603201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63879"
FT                   /db_xref="GOA:B8JBV7"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBV7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0527"
FT                   /protein_id="ACL63879.1"
FT                   /translation="MAPPDPRRERLLLAGWLAAAFALSAVTDLRTLGLAALAAAVAFRR
FT                   GLPRALARVARLVLPVTLGMSALSWAFLRLGAPAAPPIAPFLALTARTLLLAFLAFSVL
FT                   ARVNLLRALAPWPAATRLVVIALAQIHALRLLATESADGLRSRLPRRPGPLDVVRNASG
FT                   ITAALLVLAVRNAREVSDAMRSRGF"
FT   sig_peptide     complement(603124..603201)
FT                   /locus_tag="A2cp1_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.526 at
FT                   residue 26"
FT   gene            complement(603188..603820)
FT                   /locus_tag="A2cp1_0523"
FT   CDS_pept        complement(603188..603820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0523"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: ank:AnaeK_0528 cobalamin (vitamin B12)
FT                   biosynthesis CbiM protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63880"
FT                   /db_xref="GOA:B8JBV8"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBV8"
FT                   /inference="protein motif:PFAM:PF01891"
FT                   /protein_id="ACL63880.1"
FT                   /translation="MHVPDGFLSPAITLPAYAAAAPLWALAARRHLGRDAADALPVVGA
FT                   LTALAFVVQTLAIPVPGGTSTHLVGVTLLALLYDPLLAFLCQSLVLLLQALFFGAGGVT
FT                   VLAVNALAMGLLGPLAGWAVHRLLRRRAARAAAFLGAWVSMQVAAAAVALVLGLQHRIA
FT                   PEYFPVPFAVSGAALLAPSLAVTGPVEGLYTLLALALLRRADLRGAA"
FT   sig_peptide     complement(603758..603820)
FT                   /locus_tag="A2cp1_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.842 at
FT                   residue 21"
FT   gene            complement(603849..604289)
FT                   /locus_tag="A2cp1_0524"
FT   CDS_pept        complement(603849..604289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63881"
FT                   /db_xref="GOA:B8JBV9"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBV9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0529"
FT                   /protein_id="ACL63881.1"
FT                   /translation="MRAALMLLSVLLAPAAARGHEVLHELVPGHAAGLRVYESDGEPLA
FT                   DRAYELWSPSDARAPWQAGRTDRAGWIAFVPDVPGAWRVKVVDPGGHGLDTTVQIAPGG
FT                   PAAGAPSGPGAGFVLRPLLGAAVVAAIFAALFLVQRRRGVRR"
FT   sig_peptide     complement(604230..604289)
FT                   /locus_tag="A2cp1_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            complement(604417..604836)
FT                   /locus_tag="A2cp1_0525"
FT   CDS_pept        complement(604417..604836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0525"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; NikR nickel binding; KEGG: ank:AnaeK_0530 putative
FT                   transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63882"
FT                   /db_xref="GOA:B8JBW0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8JBW0"
FT                   /inference="protein motif:PFAM:PF08753"
FT                   /protein_id="ACL63882.1"
FT                   /translation="MLERIGISLEDGLLEQFDKLIAEKGYVNRSEAIRDLIRDALVQRA
FT                   FTESSGREERVAVVTLVYDHDSSSLAQKLAHIQHENHRAVVSALHVHMDPHNCLEVLVL
FT                   RGRGKDVVAMGESLVATRGVKYGKLVPATAGHDLG"
FT   gene            604938..605795
FT                   /locus_tag="A2cp1_0526"
FT   CDS_pept        604938..605795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0526"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: ank:AnaeK_0531 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63883"
FT                   /db_xref="GOA:B8JBW1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBW1"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACL63883.1"
FT                   /translation="MTSPARPPLRLAVVGHVEHVTIGRVAAVPRAGEIAHLEAPRWFPG
FT                   GGGGVAFWQLARSPAEVLLYTALGDDEAGAQVERALGAAGARVRVHAARRAEPHTRDLV
FT                   LLTPDGERTIVVVGEPLHPRADDPLPWGALAGCDAAYFTAQDPAALRAARAARLLVVTA
FT                   RRREALARSGVAADVVVGSRLDAREVSARADYPMPPAALVLTEGAAGGIIETAAGVERF
FT                   PAPPSPEAVGGAYGAGDSFAGALVFFLAAGLPLRDACAAAGRHGAAVLRAVDPRDGQLP
FT                   LEAP"
FT   gene            605792..606400
FT                   /locus_tag="A2cp1_0527"
FT   CDS_pept        605792..606400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63884"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBW2"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0532"
FT                   /protein_id="ACL63884.1"
FT                   /translation="MSGARRLRPLVLFAPGAGAPSTSAWMERWAGHLSALGEVGRFDYP
FT                   YRLAGRRSPDRLPVLLEAHRAALRTLRGRSRRPVVLAGKSMGSRVGCHLALEEEVAALV
FT                   CLGYPLRGASGALRDEVLLALRAPVLFVQGTRDPLCPLDALEGVRRRMRAPSALHVVED
FT                   GNHSLEAGVRALRARGTTQAEVEARALEAVRAFLADAVR"
FT   sig_peptide     605792..605866
FT                   /locus_tag="A2cp1_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.881) with cleavage site probability 0.653 at
FT                   residue 25"
FT   gene            606551..607273
FT                   /locus_tag="A2cp1_0528"
FT   CDS_pept        606551..607273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63885"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBW3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0533"
FT                   /protein_id="ACL63885.1"
FT                   /translation="MKRWIIGAAAALLASGAARAQTTPTTDSVQQQDHDRLHDGTGTGD
FT                   QLRQHDRLHDGSGIGDQVRQMAKDPAHQADPTAMGDQVREMAQDRDRLHDGTGTGTGDQ
FT                   TRARMHDQARAQMHEAMMQHAPVGAAHPELPGQAMQGMAQRSAAEAREAQATRAAERHA
FT                   LRHQAGQAATQRPEGAQGHHGTGHGEGMNGAGECGEAAGAHHLMEMHGGTMGGHGGTGG
FT                   MDGGSGTGGGMGDHGGMR"
FT   sig_peptide     606551..606613
FT                   /locus_tag="A2cp1_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            607285..607893
FT                   /locus_tag="A2cp1_0529"
FT   CDS_pept        607285..607893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63886"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBW4"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0534"
FT                   /protein_id="ACL63886.1"
FT                   /translation="MSTHALILLGVALAAGADAGEHLLAGARHFREGRYTEALVEFRVA
FT                   ERMGDPDARPYAGATLVKLGRPEEALEAFGTGAAAGGDALIAYYQALACYDARLYLCAD
FT                   ALLAGVGERSGPRVAAEAARLRADIARTLRAEPSTAAVDFYLARCQALGGERRPAAAAA
FT                   FCREAAGLSARRRDGYRRDDARKLLAGLTARAEAAEARP"
FT   sig_peptide     607285..607344
FT                   /locus_tag="A2cp1_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.794 at
FT                   residue 20"
FT   gene            607890..608027
FT                   /locus_tag="A2cp1_0530"
FT   CDS_pept        607890..608027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0530"
FT                   /product="tetratricopeptide TPR_2"
FT                   /note="KEGG: ank:AnaeK_0535 tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63887"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBW5"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0535"
FT                   /protein_id="ACL63887.1"
FT                   /translation="MIAALLLAAAAAATSPCAPVAAAAAPDASAAAEYRAVAEAGARRR
FT                   "
FT   sig_peptide     607890..607958
FT                   /locus_tag="A2cp1_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.455 at
FT                   residue 23"
FT   gene            608317..609294
FT                   /locus_tag="A2cp1_0531"
FT   CDS_pept        608317..609294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0531"
FT                   /product="tetratricopeptide TPR_2"
FT                   /note="KEGG: ank:AnaeK_0535 tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63888"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBW6"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0535"
FT                   /protein_id="ACL63888.1"
FT                   /translation="MPAHRELARLYLGLVALRAGQGAEAASLFDAATANPALARMATDL
FT                   SRLASRDGRLVLSAWAESGWDSNVTLASPGSAGSGDADGIWAVGATGLWRPRGAVGPYL
FT                   RAGGAAHEQFQLGAYDLAALDGAAGWQARAGAASLLAEYAYGYRTLAGDRYLSAHRLLA
FT                   SAGLPLGRAVLSGTAFVRLESYSGAYDPFSGVLTRGEVKLAFPVGLAWLGLAYGAGRDA
FT                   ADVGYLSWVEHGPRAELRLPLGARARLAGEVGASFRTYDAADPVLLDTRRDTYLDAALL
FT                   GELDLGRRLTARLGLQARRALSSIPSLEYDKLVPTVGLQWTAGY"
FT   gene            609294..610538
FT                   /locus_tag="A2cp1_0532"
FT   CDS_pept        609294..610538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0532"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ank:AnaeK_0536
FT                   integral membrane sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63889"
FT                   /db_xref="GOA:B8JBW7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBW7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL63889.1"
FT                   /translation="MGRALAPLLAGLLGLAGALGATLALHRAASAALDRVLEERLAGAG
FT                   ATAAELLGRAGADPAALRAVMAANGLEGAYLVDRDLRVLADATGAAGGRADLLRADPAR
FT                   VARALRGEPSVAFAYAVGDLPVATGYFPVRGPDGAPVAALALEAGQGFAAARAGLRRAL
FT                   WTGVALSALAALALALGAAGFARAERRSARAAARAARGEALATMAAMVAHEIRNPLGVI
FT                   RGAAELVRARSGAALAPRDQEALADVLGEVERLRRLTEDFLDLARDPAIAAEPADLAEL
FT                   AAEAARALGRAHPSVEVALSVPPLRVRADAARVRQVLANLLENAALAGARRVAVTAGPA
FT                   GPMARLEVRDDGPGVDAAVRARLFEPFASGRARGAGLGLAISRRIAERHGGALELADPG
FT                   PPGAAFALTLPLEPG"
FT   sig_peptide     609294..609389
FT                   /locus_tag="A2cp1_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.546 at
FT                   residue 32"
FT   gene            610548..611879
FT                   /locus_tag="A2cp1_0533"
FT   CDS_pept        610548..611879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0533"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: ank:AnaeK_0537
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63890"
FT                   /db_xref="GOA:B8JBW8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBW8"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACL63890.1"
FT                   /translation="MSRVLVVDDEPKLGRFVQEMLELDGHEVVRAGGGVEALARLGEGA
FT                   FDVVVTDLRMPQVDGLAVLRAARARTPPPEVVMMTAHGSAESAVEAMKAGAADYVTKPF
FT                   PMDELRLRVRRLAEQRAAAARSAGLVARLAPDLVAESAGMRAAVAAAEQVAATDATVLL
FT                   LGESGTGKSQLARLVHWRSRRAAGPLVEVHCAALPDTLLEGELFGHERGAFTGAAQRRP
FT                   GHLAAADGGTLFLDEIGEIPPSTQVKLLRFLQDRSFVPLGATAPRTVDARVVAATNRDL
FT                   AAAVGAGAFREDLYYRLDVFAIRVPPLRERREDVLPIAERHLAGHGVPPERLGPDARAR
FT                   LLERPWPGNVRELENALERALILAGEGEIRAEHVAPGAAPRAAGRAAELLVEGFGLDAF
FT                   EREVIEAALARAGGNKTRAARLLGVTRRRLYSLLASHGLAVEGE"
FT   gene            complement(612030..613202)
FT                   /locus_tag="A2cp1_0534"
FT   CDS_pept        complement(612030..613202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0534"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="PFAM: DSBA oxidoreductase; Vitamin K epoxide
FT                   reductase; KEGG: ank:AnaeK_0538 vitamin K epoxide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63891"
FT                   /db_xref="GOA:B8JBW9"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBW9"
FT                   /inference="protein motif:PFAM:PF07884"
FT                   /protein_id="ACL63891.1"
FT                   /translation="MPASHVPDTSRGKQPDRGGLPARSRALALAILVLALAGAGLAAEL
FT                   TLLHGRAHAGGASSFCAISERVNCDKVALSAWSSLLGVPLAAWGLLAYLVVAALALSAL
FT                   RRPRGDAGWPAGLLFAASAFMAAGAVFLAAISELVIGSLCIVCAGSWLVSFALAGCSFA
FT                   LARRAGGPAAALRSDVATLRARPLASATAALALLAASGGLLARYAGPPPAPAGAPAAAP
FT                   AASLGPPGSIVLYEYSDYECPFCARSHEANKPILASRPDVKVVRRHFPLDDTCNPKLIR
FT                   PFHVGACDLARAAICAEAQGRFEQMDDALFRNQAEKAPVRELARRIGLDLPRFEACLSS
FT                   PETEKRLADDIESAIQAGVRGTPSYVYGGKVYPGDLATLLGAKPAAASGG"
FT   sig_peptide     complement(613074..613202)
FT                   /locus_tag="A2cp1_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.940 at
FT                   residue 43"
FT   gene            complement(613259..614410)
FT                   /locus_tag="A2cp1_0535"
FT   CDS_pept        complement(613259..614410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0535"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ank:AnaeK_0539 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63892"
FT                   /db_xref="GOA:B8JBX0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBX0"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACL63892.1"
FT                   /translation="MSDPSDHRPHPAGPGHLQEQEQLLRLLVDSVKEYAIFMLDPSGHV
FT                   LSWNPGAERIKGYPAHEIVGRHFAVFFTPEDVRRGKPAAELREAAEQGSSEDEGWRVRR
FT                   DGTRFFASVVVTALRGPDGALRGFAKITRDLTERRRGEEARRNLAEAREAVRSRDDFLA
FT                   VASHELRTPLTCVQLVAQSLARQTHEGQPVTGQQVERLHQLQRHVARLGELVSGLLDLA
FT                   EMSRGALQLEPAPFDLSELVQEVAARFEPDVRRKGTALSVHAPGPIPGRWDRRRVADAI
FT                   AAVLGNAVKYGGRSPIEVTASRDDRRALVVIEDRGPGIAPEDQSRVFERFERAAPVAHY
FT                   PGLGVGLWTARQILNAHGGDIAVESASGKGARFSLRLPLESPA"
FT   gene            614666..615694
FT                   /locus_tag="A2cp1_0536"
FT   CDS_pept        614666..615694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0536"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ank:AnaeK_0540 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63893"
FT                   /db_xref="GOA:B8JBX1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBX1"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACL63893.1"
FT                   /translation="MAGTEGSPVVIVGAGVAGLSCARALAEGGRRALVLDRAHGVGGRC
FT                   ATRALEGQPVDYGAVFLHGRDPAFLAALDAVPATRLDWPADVHGSGPPCQPEAFSPGEV
FT                   RRAFAEGVNAFPRHLAEGLELRLQRKVVGLVPGDGTVALRLDDGSFLEAETAVLALAAE
FT                   QADELLATVLPAPPAVAAARALLATASSHCALALLAVYGPAAPRPPWHVSYPETSRIVQ
FT                   LVSHESSKRPGSPLLVLTYQAHPAWSRQHLDDPDWPRRVLDEAARLLGPWAADPRTAHP
FT                   HRWRWARTDLAAELARPLLLALPGGARLGVAGDRFAPGGGIEAAWRSGRALAGRVLAGE
FT                   GA"
FT   gene            615691..616437
FT                   /locus_tag="A2cp1_0537"
FT   CDS_pept        615691..616437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0537"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: GTP cyclohydrolase II; KEGG: ank:AnaeK_0541
FT                   GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63894"
FT                   /db_xref="GOA:B8JBX2"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBX2"
FT                   /inference="protein motif:PRIAM:3.5.4.25"
FT                   /protein_id="ACL63894.1"
FT                   /translation="MTGGGDALAQLVLRDRDHECEGFGPGRVCVRVVAVARLPTRAGPF
FT                   RIVAFWNNRDAKEHVALVHGDVVGAADVPVRLHSECLTGDVMGSLRCDCRDQLTEGLAA
FT                   IQREGRGVLLYLRQEGRGIGLINKIRAYALQEQGLDTVEANLALGFRDDERDYAVAAHM
FT                   IHGLELRSIRLITNNPEKIRQLTAYRVDVSGRIPHVIPPGEHNRFYLETKARRSGHLID
FT                   LAALEPRSEQADPVVVAPAPGTPGGE"
FT   gene            616558..617715
FT                   /locus_tag="A2cp1_0538"
FT   CDS_pept        616558..617715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0538"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="PFAM: glucose sorbosone dehydrogenase; KEGG:
FT                   ank:AnaeK_0542 glucose sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63895"
FT                   /db_xref="GOA:B8JBX3"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBX3"
FT                   /inference="protein motif:PFAM:PF07995"
FT                   /protein_id="ACL63895.1"
FT                   /translation="MRPARPALAPLLLLLACGAASARRPAPGCTMVEEGFGPAGAIPIR
FT                   VERVASGLEVPWGLAFLPGGDVLVTERPGRVRLIRHGQLQPEPVATVAIAPGGEGGLLG
FT                   IAADPRFAENRRFYLYATVEAGGAPVNQVSRWTLSADGRAATREKVLLDGIPAARYHDG
FT                   GRIRFGPDGMLYVGTGDGGHPDRARDPASPSGKLLRVTPDGAPAPGNPRPDSPVLLSGV
FT                   RNLEAFDWLDAGTLILADHGPSGERSRTGQDEVTVARAGDDLGWPAVSGCDAEPGTVAP
FT                   ILSFRRAAPPGGGSVYRGSAVPQWRGSFLFGTLGSRHLHRVVLDGRGGLRAHEVYLAGD
FT                   PPSGLGRVREVVEGPDGALWVTTSNCDGRGTCPAERDLVVRLVGG"
FT   sig_peptide     616558..616626
FT                   /locus_tag="A2cp1_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT   gene            618016..618432
FT                   /locus_tag="A2cp1_0539"
FT   CDS_pept        618016..618432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0539"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="KEGG: ank:AnaeK_0543 GreA/GreB family elongation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63896"
FT                   /db_xref="GOA:B8JBX4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBX4"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0543"
FT                   /protein_id="ACL63896.1"
FT                   /translation="MSRDRIYVSETDHERLRALVEQHQEGRDAAAAERLDAELDRAVRV
FT                   PDGQVPPDVVAMNSRVVYEDGATGRLREVTLVYPTAADLREGRLSVLAPVGAALLGLST
FT                   GQSISWTLPDGREVELRVRSVQQPPAAPAASAAV"
FT   gene            complement(618448..619671)
FT                   /locus_tag="A2cp1_0540"
FT   CDS_pept        complement(618448..619671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0540"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   ank:AnaeK_0544 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63897"
FT                   /db_xref="GOA:B8JBX5"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBX5"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACL63897.1"
FT                   /translation="MLRTVSSELAYIALLFALFVIPKALQRFRIPGAITSLLLGLAAAR
FT                   AGLFTGDPTLALLATLGITGLFLFAGLDVDAKDLRRGAALVAQHLVIQALLLAGVAWAI
FT                   AAATGVDWRPATLVALALVTPSTGFILDSLQSFGLDADQRFWTRTKAVATELLALAVLF
FT                   AVLQSTSAARFAGASAALLAVVVLIPLVMRAFAVAIAPWAPRSEFAFLVMLAVMAAFAT
FT                   RKLGVYYLVGAFLVGVAARRFRERLPAFSSDRLLHAVEVFASFFAPFYFFSAGAHLHPE
FT                   LLTLSSLATGVVYLAAMIPLRVGLVAVHRKLALREHLGQARRVATALVPTLVFSLVLAE
FT                   IVIERFEGVPPWLVGGIIPYALLNTMLPALTLGATASFDEVHLEVTEPEPGPALAAAPP
FT                   PAGPGQAG"
FT   gene            complement(619721..620065)
FT                   /locus_tag="A2cp1_0541"
FT   CDS_pept        complement(619721..620065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63898"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBX6"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0545"
FT                   /protein_id="ACL63898.1"
FT                   /translation="MPLLVSVRDLVFRSKIHAAGERLGVALRFAPRGGRLSEAARDLGQ
FT                   GTILADLSEPGVLDEVRATRAAGLPVRIIGFLGHVEVELAGAARAAGVDEVISRGQFVQ
FT                   RLDALLTEHA"
FT   gene            complement(620123..620629)
FT                   /locus_tag="A2cp1_0542"
FT   CDS_pept        complement(620123..620629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63899"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBX7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0546"
FT                   /protein_id="ACL63899.1"
FT                   /translation="MNRTAWIATAALALTLSGCASVAAQRARTRYLEAELDRLRYPQPA
FT                   EEIWGDVRRLLMQNEFPLADEEDPREGIQGLVVNLFTPARPTEIDKAGRRKLDTGWRKD
FT                   QTRVHAEASPGEGGVQVRLTRLVEDQTEHGRGKPSRDVDLELELARLLAPQEAARIEAG
FT                   IPKPR"
FT   sig_peptide     complement(620558..620629)
FT                   /locus_tag="A2cp1_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.508 at
FT                   residue 24"
FT   gene            complement(620626..621612)
FT                   /locus_tag="A2cp1_0543"
FT   CDS_pept        complement(620626..621612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0543"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   ank:AnaeK_0547 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63900"
FT                   /db_xref="GOA:B8JBX8"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBX8"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="ACL63900.1"
FT                   /translation="MVESIGSPALWIGFLAFVALMLALDLGVFHRKAHVIRVREALGWS
FT                   VVWVALALTFNALVWWQFGADRGLEFLTGYLIEKSLAVDNIFVFVIIFSALGVPPLYQH
FT                   RVLFWGILSALVLRAGMIFAGTALLARFHWTIYLFGALLVATGVKLFLGRNEAPDPTGG
FT                   RLMRLVRRVIPSTHELRGAHFLTIENGRRVATPLLLALVLVEISDVIFAVDSIPAIFAV
FT                   TLDPFIVFTSNIFAILGLRSMFFLLAGMVERFSGLKTGLSAVLVYVGVKMLAMDWVKVP
FT                   PALSLAIVAALLVAPVLLGAWRDRARGHRAAPASGRVLGPSRPEESR"
FT   gene            621764..622144
FT                   /locus_tag="A2cp1_0544"
FT   CDS_pept        621764..622144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63901"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBX9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0548"
FT                   /protein_id="ACL63901.1"
FT                   /translation="MRYDGSMTSLRRAARWCLPALALAAAPAVRAQGEPAADAPFPLTL
FT                   DVGEVKPLCPTGTVQCPPRAILCDDPKVAVGADSPEGGALRGVGPGTTTCSAAGGSPLG
FT                   ARRVYRVTVVAPGDGGARGGGR"
FT   sig_peptide     621764..621859
FT                   /locus_tag="A2cp1_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.920 at
FT                   residue 32"
FT   gene            complement(622311..623723)
FT                   /locus_tag="A2cp1_0545"
FT   CDS_pept        complement(622311..623723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0545"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: ank:AnaeK_0549 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63902"
FT                   /db_xref="GOA:B8JBY0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBY0"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ACL63902.1"
FT                   /translation="MRSPGLATLVAASALAVSGCTLAPRYQRPAAPVAAEFPAGAGAAT
FT                   GPAASDLGWRDVFQDPGLQAVIDQALRENRDLRVAALNVELARAQYGIQRSYLLPTVGA
FT                   TGSGSRARTAKDLSFTGEPSVGNTFSAGVGLTSFEIDLFGRVRSLRNQALEQYLSTEEA
FT                   HRSAHLALVSEVAVQYLASRALQSQVALAEQTLQTVQQSYDLAKRTFEAGRTSELDFRT
FT                   AEAQVETARVNLSAYQQQLAQAENALVLLAGGPLPKDLPTAPLESQPPVAELPAGLPSD
FT                   LLQRRPDILSAEHQLKAANASIGAARAAFFPSISLTASVGTASTELSNLFTAGSGTWAF
FT                   SPRIDLPIFTGGRNKANLDAANVRKQIEIASYEKAIQVAFREVADALVARGRLDEQLEA
FT                   QTRRVQAEQRRYDISELRYRKGVDSYLNVLTAQRDLYGAQQQLIQTRLTRFSNSIGLYR
FT                   ALGGGWLEHGKS"
FT   sig_peptide     complement(623664..623723)
FT                   /locus_tag="A2cp1_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.823 at
FT                   residue 20"
FT   gene            complement(623716..626886)
FT                   /locus_tag="A2cp1_0546"
FT   CDS_pept        complement(623716..626886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0546"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   ank:AnaeK_0550 transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63903"
FT                   /db_xref="GOA:B8JBY1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBY1"
FT                   /inference="protein motif:TFAM:TIGR00915"
FT                   /protein_id="ACL63903.1"
FT                   /translation="MARFFIDRPIFAWVISIMIMLAGGLAILGLPVSQYPAIAPPVVTV
FT                   YATYPGANAQTLENSVTQVIEQKMTGIDHLRYMSAASDSSGNASVTLTFEAEADPDIAQ
FT                   MQVQNKLQNAMPLLPQQVQQQGVRVLKTVSNYLLIAGLISEDGSMTRDDLNDYAFSNIV
FT                   DPISRVTGVGEVTAFGTQYAMRIWLDADKLASFKLTPLDVSGALRAQNAQVSTGSLGAA
FT                   PAVPGQQLNATVTSQTRLQTPEQFLNILLRVNPDGSQVRLRDVGTANLGGETYELESYY
FT                   NGKPAGGMGIRLASGANALKTADLVRAKLTELSQYFPPGMKVVYPVDSTPFVRISIEEV
FT                   VKTLAEAIILVFLVMFLFLQNFRATLIPTIAVPVVLLGTFGVLAAAGFTVNTLTMLGLV
FT                   LAIGLLVDDAIVVVENVERVMSEEGLSPREATRKSMGQITGALVGIALVLAAVFVPMAF
FT                   FGGSVGVIYRQFSITVVSAMALSVVVALTLTPALCATILKPVEKGHHASEKGFFGWFNR
FT                   LYGQGSGIYEKSVGWILRRAGRALIVYAVLLAALGGLFLHLPTGFLPEEDQGSIINMVQ
FT                   LPAGATMDRTRTVMQEVTRHYLEDEKDNVEAVMAITGFSFSGRGQNAGLAFVRLKDWSE
FT                   RPKKEQHAPAIAGRAMRAFSQIKDGLAFAFVPPAVPELGNATGFELQLQDRGNLGHEAL
FT                   MAARNQLLGMAAQDPRLAKVRPLGLEDTPQYRIDVDQQKAAALGLSLSDINATLSSTWG
FT                   VNYVDDFVDKGRTKRVYVQAAAPFRMKPEDLNRWYVRNAAGQMVPFSAFSTGTWVHGPT
FT                   KLERFNGSPAMVIQGEPSPGHSSGEAMAAMEEHVKALPAGIGLEWSGLSYEERLSGANA
FT                   PALYTISLLVVFLALAALYESWSIPFSVMLVVPLGVLGAVLFTELASMDAGVYFQVGLL
FT                   TTIGLSAKNAILIVEFARALYEQGMSLFDAAVEAARMRLRPIIMTSLAFILGVLPLAIA
FT                   NGAGAAGQNAIGVAVIGGMVSATFLAILLVPVFFVKIAGKRKTPPPDLVAGPRDDEDEA
FT                   APKEIAHA"
FT   gene            complement(626973..628205)
FT                   /locus_tag="A2cp1_0547"
FT   CDS_pept        complement(626973..628205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0547"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ank:AnaeK_0551 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63904"
FT                   /db_xref="GOA:B8JBY2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBY2"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACL63904.1"
FT                   /translation="MNPSLRSPRAATRRAHGLLFGKRALALAALALVAAGCGKKPEARP
FT                   PGPVEVGVITVSPQAVTLTTELPGRVSAFKVAEVRARVNGIVLKRLFTEGSDVKQGQPL
FT                   FKIDPAPYQAALDSARAQLARADATLASAKLTSERYTELVAANAVSRQEHEDAVAALKK
FT                   AEADVAAGKAAVDAARINLGYTTVTSPVSGRIGRSGVTEGAYVQAAQATLLATVQQLDP
FT                   VYVDVTQSSAELLRMRRDLEAGKLQSAGAGKAKVALTTEDGREYGLPGTLQFADVTVDP
FT                   GTGSVALRAIFPNPRAELLPGTYVRARLAEGVNPAALLVPQRAVARNNKGEPTALIVAG
FT                   GKVELRNLVTERVIGDAWLVTSGVKPGEQVIVEGLQKVRPGAPVNPVPAGGAKQANAAT
FT                   PGQQAPAGAAR"
FT   sig_peptide     complement(628086..628205)
FT                   /locus_tag="A2cp1_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.843) with cleavage site probability 0.325 at
FT                   residue 40"
FT   gene            628372..628998
FT                   /locus_tag="A2cp1_0548"
FT   CDS_pept        628372..628998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0548"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ank:AnaeK_0552
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63905"
FT                   /db_xref="GOA:B8JBY3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBY3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL63905.1"
FT                   /translation="MAENQLQRPPDWCVGKRQQILDGARKVFQEHGYERASVDVIAARS
FT                   GVSKATLYNHFHDKSALFVACFEQGSNQMQADLEALFAETSDDLESALQAAGERLLGKF
FT                   LSSEAVALYRSALDGFRLPDIGKMLYERGPRVTHELIAAALSRWAARGLLRLDDPYYAA
FT                   VQFVNLCHGDVMMRLHLGVLQEASPDDVRATVRRAVQTFLRAFRP"
FT   gene            629118..630731
FT                   /locus_tag="A2cp1_0549"
FT   CDS_pept        629118..630731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0549"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: ank:AnaeK_0553 alpha
FT                   amylase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63906"
FT                   /db_xref="GOA:B8JBY4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBY4"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACL63906.1"
FT                   /translation="MTPARSPRRTPLALLAAIALAALACGGGSTPPPPVDVSPVPAADP
FT                   GSALPDGWERGPFAEIYVRGYQDSDGDGVGDLRGLASRLDHLADLGVRGIWLMPVTASQ
FT                   DHDHGYAVADYRGVEPGYGTLEDLDALVAAAHARGIGVILDYVMNHSAATNPLFLNSAD
FT                   DKSNPYRGWYVWRSSQPSGWSVYGGNPWRQSGTGWYYAPFATNMPDFDLANPAVAAYHA
FT                   DSQRFWLNRGVDGFRFDAVGMLYENGPGAWNDQPENYVRMAEVRALLDGYERRFMVCEG
FT                   PDDPAGFTAACGSAFAFGLQSDVMGAARGDAAAVARVAAYFEDPARLAASTLLSNHDAF
FT                   AGQRPWDQLGGDEARYRLAAATYLLLPGIPFVYYGEEIGMGGAASLSGDWRLRTPMSWT
FT                   GDARTAGFTTGKPFRALSSNAATHNVEAEQGRAGSLLEFYREVIALRRAVPALDRGGYE
FT                   GARASGATLSFRRTLGTSHALVLLNYDVVPLTLPVTGLPPGAALAPRLPATAPAVTADA
FT                   AGAASFDLPALSVRVYTWDG"
FT   sig_peptide     629118..629192
FT                   /locus_tag="A2cp1_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.697 at
FT                   residue 25"
FT   gene            complement(630733..631524)
FT                   /locus_tag="A2cp1_0550"
FT   CDS_pept        complement(630733..631524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0550"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   ank:AnaeK_0554 phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63907"
FT                   /db_xref="GOA:B8JBY5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBY5"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACL63907.1"
FT                   /translation="MRRHPLLVPSALAAALALAAVPAPARPAPADLQVNVAADGAVTAA
FT                   AFAAALGVRLLERDLLPVSCRWCSPGRLDAWAHRTLAWKTASRAATASDLLGVGVPLGA
FT                   TAALAVPDLAAGAPRRAAEDALLVAEAVSIATLGTELVKVGTDRIRPDAWDGSGPVHAL
FT                   DSRLSFWSGHTATAFAAVAAAGTIATLRDAPAAPWIVGGGAAAASAVGYLRLAADRHWA
FT                   TDVLAGAGWGTAVGILVPLLHWHPIAHVRLMPSPGGIAGEF"
FT   sig_peptide     complement(631465..631524)
FT                   /locus_tag="A2cp1_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.905 at
FT                   residue 20"
FT   gene            complement(631521..632405)
FT                   /locus_tag="A2cp1_0551"
FT   CDS_pept        complement(631521..632405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0551"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ank:AnaeK_0555 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63908"
FT                   /db_xref="GOA:B8JBY6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBY6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACL63908.1"
FT                   /translation="MDTLALQANGLRFAALADGPGDGPLALLLHGFPELARSWRHQLPA
FT                   LAAAGWRAVAPDLRGYGGTEKRGPFDLATLAADAAGLVRALGRERAVVIGHDWGGAVAW
FT                   AVAGRHPEVVSRLVVLNAPHPSAFARELRRNRRQLLRSSYMLLFQVPLLPEWLLTRDRA
FT                   AGVARALRGGSYVRSAWPAEELEPYRRAFLQPGAARAALGYYRAAFRGRRSRGPRPRPI
FT                   SAPTLILWGVEDRFLGVETIARAKLAPYLAPGNAPEIVPIEGAGHFVQNEAPEQVNAAL
FT                   LRWLGAATGRSAT"
FT   gene            632599..633354
FT                   /locus_tag="A2cp1_0552"
FT   CDS_pept        632599..633354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63909"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBY7"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0556"
FT                   /protein_id="ACL63909.1"
FT                   /translation="MRTLTCLAALLPALAAADTSPLLLAGAQIDATGTTAVQTQPMPKG
FT                   WFSTRNVLDRTKTSLVTRLAAGATTCSADQGVVATLSSVTAGNFTEVLNPQDRTVRYVW
FT                   DTVTDLSPFQNRWHYYTGCDGVQVVLGCPEAIPVTFTIEAFAKSGTCQTYVNDLGQTVC
FT                   AADQAVAMLPAVQEADQVATGCVEEGGDPSCGIGPCESACTQSCDAAFPVGRGADKGNV
FT                   ALLKACKEACPCTCKYERPARCPQPQNCE"
FT   sig_peptide     632599..632652
FT                   /locus_tag="A2cp1_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.766 at
FT                   residue 18"
FT   gene            633454..633912
FT                   /locus_tag="A2cp1_0553"
FT   CDS_pept        633454..633912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0553"
FT                   /product="protein of unknown function DUF454"
FT                   /note="PFAM: protein of unknown function DUF454; KEGG:
FT                   ank:AnaeK_0557 protein of unknown function DUF454"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63910"
FT                   /db_xref="GOA:B8JBY8"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBY8"
FT                   /inference="protein motif:PFAM:PF04304"
FT                   /protein_id="ACL63910.1"
FT                   /translation="MRDPPYTSPVPPDPEPTTAATRAAPARRLLLLALGWTAFALGAIG
FT                   LLLPIVPTTPFMLVALWAFSASSERFHRWLYTHRLFGPPLQKWQRDRAIPVWVKAIALG
FT                   SMAVSLAWLAFVVRPPRYALLAAAALVACGAAFVLRIPSRPRQPVREP"
FT   gene            633912..634274
FT                   /locus_tag="A2cp1_0554"
FT   CDS_pept        633912..634274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63911"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBY9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0558"
FT                   /protein_id="ACL63911.1"
FT                   /translation="MARRRRAPLALLGAAALLAACGGDRGHRGDGARPPAVTGGCGAGC
FT                   PEGQACVDVPGDACTWPSDAGCPGACVVPVSCGGFAAIRCPDGRACVDDPRDDCAPPRG
FT                   ADCGGLCAPAPAAGAR"
FT   sig_peptide     633912..633980
FT                   /locus_tag="A2cp1_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.653 at
FT                   residue 23"
FT   gene            634302..635216
FT                   /locus_tag="A2cp1_0555"
FT   CDS_pept        634302..635216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0555"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ank:AnaeK_0559 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63912"
FT                   /db_xref="GOA:B8JBZ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBZ0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL63912.1"
FT                   /translation="MKDLPLNALRAFALVFAHRGVRPAARELGVAHSSLSRHMAELEAW
FT                   AGTPLTRGPGGRAGLSFTPQGEALGQAALAALRELERAAAAVREARSERSVVISTTASF
FT                   ASRWLLPRLPALEARHPDLEVSVLVDPRPVDLGTAGAGEVDLAIRLGRGPWRDLDCQPL
FT                   LDEVLYPVMSPAAWRAAGSPRRPPALARLRLLHDRDPGATWELWRRAHGPASLDVRRGP
FT                   RLASTDLVLRAAAQGQGVALARHRLAADDLAAGLLVRPFERSVALGPAYWLVLPPHARG
FT                   RAATAGVVAWLEQEARACGPLPA"
FT   gene            635295..635900
FT                   /locus_tag="A2cp1_0556"
FT   CDS_pept        635295..635900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0556"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pde:Pden_3627 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63913"
FT                   /db_xref="GOA:B8JBZ1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBZ1"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACL63913.1"
FT                   /translation="METWIATAGLVAVGVFTPGPSNFVVMHRAAAAGLRGAAPAIAAVL
FT                   LGLVALLGLAAAGGGALLAAAPALGRVLQAGGAVYLAWGGVALVVESFRRGPAEGGAAG
FT                   GALPQRPAAVFLFQFTNPKAWAMVLTAASACGGGGAGAAFLRLVPLFTALSLAGLLTWA
FT                   VLGSALERAMRVPRWRRRIDRAMGALLAASAALLLAGA"
FT   gene            635948..636652
FT                   /locus_tag="A2cp1_0557"
FT   CDS_pept        635948..636652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0557"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; KEGG: ank:AnaeK_0560 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63914"
FT                   /db_xref="GOA:B8JBZ2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBZ2"
FT                   /inference="protein motif:TFAM:TIGR00035"
FT                   /protein_id="ACL63914.1"
FT                   /translation="MQPIVGIVGGLGPEGTVHYYRKLTALLAGLPLDLGRPGIVVDHVW
FT                   IDRFSGLLRAGADPEALELLLGSLRRLERAGATLALFAAVTPHRFLPALRPRSPLPIAD
FT                   LVGATCEDVRAAGHRVVGLVGTRFTVSEPFFRDALEAAGVRVVVPDEAGTDYLDALIFG
FT                   PLARGEKTPTMKGELAAIVGRMARREPLDALVVACTDLMDLMGTEVPLLDPIDSHLRLA
FT                   LRMLAASGARAQ"
FT   gene            complement(636657..637121)
FT                   /locus_tag="A2cp1_0558"
FT   CDS_pept        complement(636657..637121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0558"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ank:AnaeK_0561
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63915"
FT                   /db_xref="GOA:B8JBZ3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBZ3"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACL63915.1"
FT                   /translation="MPAVKHIPDGYQALTPYLVMKDAARAIDFYAKVFGAVELMRMPGP
FT                   EGRVGHAELKIGDARLMLADEHPEMGALGPKSIGGTAVGLVVYVPDADATVARAVAAGA
FT                   TVKGAVEDKFYGDRMGSIVDPFGHLWHVGTHKEDVSPEEMQRRMAALPPM"
FT   gene            complement(637204..637803)
FT                   /locus_tag="A2cp1_0559"
FT   CDS_pept        complement(637204..637803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0559"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   ank:AnaeK_0562 phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63916"
FT                   /db_xref="GOA:B8JBZ4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBZ4"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACL63916.1"
FT                   /translation="MLAAITHDLHTAGEAWLFRALNADGGPILDGLMVVLSSKPFGAAW
FT                   AILLAVLIARAVRGPARLRLVAALGAAIAMSDGLGSQLLRPLLARRRPCYALPPGTFRW
FT                   LAPAADVGSLPSLHAANFFAMATVAAAAGPRLGLAALGVAVLVALSRVYVGVHWPTDVL
FT                   AGAAWGVVCGMVARLLATRLWAARQRRRAAPPPPVP"
FT   gene            complement(637873..639690)
FT                   /locus_tag="A2cp1_0560"
FT   CDS_pept        complement(637873..639690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0560"
FT                   /product="thermosensitive mutation transmembrane protein,
FT                   SuhR"
FT                   /note="KEGG: ank:AnaeK_0563 thermosensitive mutation
FT                   transmembrane protein, SuhR"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63917"
FT                   /db_xref="GOA:B8JBZ5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBZ5"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0563"
FT                   /protein_id="ACL63917.1"
FT                   /translation="MQTGTTEAQGLLECDLVMKGGITSGVVYPLALVELARRYRFRSVG
FT                   GSSAGAIAAAAAVAAEYGRQTGATADGAGFAGLAALPASLGERLPDGRSRLVSLFQPSR
FT                   RTRPVLEALLGAARGRSAAGKVARALAPLVLAAPGCWVALAGLLLAGAVGALAARQEGA
FT                   AAAMALALSAAAVLVLAALGAVAASAASALGAIAGNGLGVCSGFAPPGGDRPPPLTPWL
FT                   HGLIQRLAGTREVLTLGDLERHGLRLEVTTTSVTHQRPFRLPLHPDDPVFFFREMEFRA
FT                   LFPAEVVDRLVEAGRAEEAERRARTDGRRVRLPAHDPSMVLFPRGPGLPVVVLARMSLS
FT                   FPLLLGAVPLYGVDWTRKRNQRRRAAPELERAWFSDGGICSNIPIHFFDAALPTRPTFA
FT                   IDLREQHPDHPLGAWLPANNASGIAQRWHRLGEGRAAPLRFLAAVVTTMQTWVDEMQLA
FT                   APGYRDRIVHVSHAADEGGLNLEMPPEVIERLAARGAAAGERLRDRFRWEDHRWIRFRS
FT                   LLDVMQRYVAPTWTAHAPGTAGRAALLELLEAHRGRRGSYPVTGPQADCARAALEGVDR
FT                   LVEATAATGGDLTERAPRPAPELRARPRV"
FT   gene            639853..640797
FT                   /locus_tag="A2cp1_0561"
FT   CDS_pept        639853..640797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63918"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBZ6"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0564"
FT                   /protein_id="ACL63918.1"
FT                   /translation="MTRVSAAAAWPDLPLAPWDGTRHALHMWTQIMGKTLLALAPPWNH
FT                   WWHTALRVSARGLASPVPIATPDGWLDLELDLVDHVLAMRTERRTAAIPLGPRSVHAFH
FT                   DEYRALLDALGVRARLSTVPCEVPDPIPFDRDDAPRPYDAEAANRFWRVLRRCAAALES
FT                   LCDGFLGKQSPVHFFWGSFDLAATRFSGRRAPERPGADAVTREAYSHEVISFGFWPGGP
FT                   AASGVRVEEPVLYAYAAPEPAGFRDADLGVAGARYDARLGEFLLPYAAARAAPDPAAEI
FT                   RAFCEAAYRAGASLGGWDRAALERTAGAAAPGP"
FT   gene            640880..642076
FT                   /locus_tag="A2cp1_0562"
FT   CDS_pept        640880..642076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0562"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ank:AnaeK_0565 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63919"
FT                   /db_xref="GOA:B8JBZ7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBZ7"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACL63919.1"
FT                   /translation="MDVVTRQIRSEMEGASWIRRMFDAGLELKQRIGADQVFDFSLGNP
FT                   DVPPPAAAAAALRDLAGKVTAPMGLGYCPNAGLPSVRAALARRLAAEQQAPVEARHLVL
FT                   TCGAAGGLVTFFRAVLEPGDEVLCFAPYFVEYGAYAGHFGGVLRAVPSIVPDFTPDLAA
FT                   LEAAIGPRTRVVLVNSPNNPTGRIYDAATMQALGALLSRVNQGRERPVFLVSDEPYRRL
FT                   AYGGAAVPAILPLTPFSLVVGSFSKSLSLAGERVGYLLVNPAMPDAQVLVDALTLTNRT
FT                   LGFVNAPVVGQRLVEALVDESVDVGVYDRRRRAMAEALTGAGIPFHLPEGAFYFFPEVP
FT                   GGDDQAFVRLLLEENILAVPGRGFGMPGYMRLTFCVDEQVIRRAAPGFARAARKARGG"
FT   gene            complement(642073..643158)
FT                   /locus_tag="A2cp1_0563"
FT   CDS_pept        complement(642073..643158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A2cp1_0563"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ank:AnaeK_0566 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:A2cp1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACL63920"
FT                   /db_xref="GOA:B8JBZ8"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="UniProtKB/TrEMBL:B8JBZ8"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACL63920.1"
FT                   /translation="MTPAQTDRTLTLPLSRDLALRRRFMVVDEPLQGNLRFGLLLEALD
FT                   KLAEEAALDYARSAHPQARVVTAAVDNILVRHPPDVERDLELSARVNHVGRTSMEVGIR
FT                   VTQPGDPPLHVASCYFTMVARLGEGDEARSVPLPPLEYPDERARHRERRALERRDEYRR
FT                   HLAASDEPPDRAEFELLRGLHRAQDVPGFTGLLAAELATDAWERMFPEQENVPRKIFGG
FT                   YVMRRAYELSSICAEHAAPERPVLAAVNRVNFFHPVRLGDTLHFSCRVVHTAGSFVSVE
FT                   ASIERRSRDRTVRALSNSCLFTFVNVDREMRPRDALAVYPTTFAEDARLLAARRQHAAL
FT                   LRHAHRGWISEGWTSEAPAGD"
FT   gene            643417..644043
FT                   /locus_tag="A2cp1_0564"
FT   CDS_pept        643417..644043
FT                   /codon_start=1
FT                   /transl_tab