(data stored in ACNUC7421 zone)

EMBL: CP001368

ID   CP001368; SV 1; circular; genomic DNA; STD; PRO; 5528136 BP.
XX
AC   CP001368;
XX
PR   Project:PRJNA30045;
XX
DT   24-JUL-2009 (Rel. 101, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Escherichia coli O157:H7 str. TW14359, complete genome.
XX
KW   .
XX
OS   Escherichia coli O157:H7 str. TW14359
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-5528136
RX   DOI; 10.1128/IAI.00198-09.
RX   PUBMED; 19564389.
RA   Kulasekara B.R., Jacobs M., Zhou Y., Wu Z., Sims E., Saenphimmachak C.,
RA   Rohmer L., Ritchie J.M., Radey M., McKevitt M., Freeman T.L., Hayden H.,
RA   Haugen E., Gillett W., Fong C., Chang J., Beskhlebnaya V., Waldor M.K.,
RA   Samadpour M., Whittam T.S., Kaul R., Brittnacher M., Miller S.I.;
RT   "Analysis of the genome of the Escherichia coli O157:H7 2006
RT   spinach-associated outbreak isolate indicates candidate genes that may
RT   enhance virulence";
RL   Infect Immun 77(9):3713-3721(2009).
XX
RN   [2]
RP   1-5528136
RA   Brittnacher M., Jacobs M., Zhou Y., Chang J., Fong C., Gillett W.,
RA   Haugen E., Hayden H., Kulasekara B., Larson Freeman T., Radey M.,
RA   Rohmer L., Sims E., Wu Z., Whittam T., Kaul R., Olson M.V., Miller S.I.;
RT   ;
RL   Submitted (15-JAN-2009) to the INSDC.
RL   Genome Center, Department of Medicine, University of Washington, Box
RL   352145, Seattle, WA 98195, USA
XX
DR   MD5; 1ee78464ed17a6306f03371d173e5d40.
DR   BioSample; SAMN02604255.
DR   EnsemblGenomes-Gn; EBG00001066674.
DR   EnsemblGenomes-Gn; EBG00001066675.
DR   EnsemblGenomes-Gn; EBG00001066676.
DR   EnsemblGenomes-Gn; EBG00001066677.
DR   EnsemblGenomes-Gn; EBG00001066678.
DR   EnsemblGenomes-Gn; EBG00001066679.
DR   EnsemblGenomes-Gn; EBG00001066680.
DR   EnsemblGenomes-Gn; EBG00001066681.
DR   EnsemblGenomes-Gn; EBG00001066682.
DR   EnsemblGenomes-Gn; EBG00001066683.
DR   EnsemblGenomes-Gn; EBG00001066684.
DR   EnsemblGenomes-Gn; EBG00001066685.
DR   EnsemblGenomes-Gn; EBG00001066686.
DR   EnsemblGenomes-Gn; EBG00001066687.
DR   EnsemblGenomes-Gn; EBG00001066688.
DR   EnsemblGenomes-Gn; EBG00001066689.
DR   EnsemblGenomes-Gn; EBG00001066690.
DR   EnsemblGenomes-Gn; EBG00001066691.
DR   EnsemblGenomes-Gn; EBG00001066692.
DR   EnsemblGenomes-Gn; EBG00001066693.
DR   EnsemblGenomes-Gn; EBG00001066694.
DR   EnsemblGenomes-Gn; EBG00001066695.
DR   EnsemblGenomes-Gn; EBG00001066696.
DR   EnsemblGenomes-Gn; EBG00001066697.
DR   EnsemblGenomes-Gn; EBG00001066698.
DR   EnsemblGenomes-Gn; EBG00001066699.
DR   EnsemblGenomes-Gn; EBG00001066700.
DR   EnsemblGenomes-Gn; EBG00001066701.
DR   EnsemblGenomes-Gn; EBG00001066702.
DR   EnsemblGenomes-Gn; EBG00001066703.
DR   EnsemblGenomes-Gn; EBG00001066704.
DR   EnsemblGenomes-Gn; EBG00001066705.
DR   EnsemblGenomes-Gn; EBG00001066706.
DR   EnsemblGenomes-Gn; EBG00001066707.
DR   EnsemblGenomes-Gn; EBG00001066708.
DR   EnsemblGenomes-Gn; EBG00001066709.
DR   EnsemblGenomes-Gn; EBG00001066710.
DR   EnsemblGenomes-Gn; EBG00001066711.
DR   EnsemblGenomes-Gn; EBG00001066712.
DR   EnsemblGenomes-Gn; EBG00001066713.
DR   EnsemblGenomes-Gn; EBG00001066714.
DR   EnsemblGenomes-Gn; EBG00001066715.
DR   EnsemblGenomes-Gn; EBG00001066716.
DR   EnsemblGenomes-Gn; EBG00001066717.
DR   EnsemblGenomes-Gn; EBG00001066718.
DR   EnsemblGenomes-Gn; EBG00001066719.
DR   EnsemblGenomes-Gn; EBG00001066720.
DR   EnsemblGenomes-Gn; EBG00001066721.
DR   EnsemblGenomes-Gn; EBG00001066722.
DR   EnsemblGenomes-Gn; EBG00001066723.
DR   EnsemblGenomes-Gn; EBG00001066724.
DR   EnsemblGenomes-Gn; EBG00001066725.
DR   EnsemblGenomes-Gn; EBG00001066726.
DR   EnsemblGenomes-Gn; EBG00001066727.
DR   EnsemblGenomes-Gn; EBG00001066728.
DR   EnsemblGenomes-Gn; EBG00001066729.
DR   EnsemblGenomes-Gn; EBG00001066730.
DR   EnsemblGenomes-Gn; EBG00001066731.
DR   EnsemblGenomes-Gn; EBG00001066732.
DR   EnsemblGenomes-Gn; EBG00001066733.
DR   EnsemblGenomes-Gn; EBG00001066734.
DR   EnsemblGenomes-Gn; EBG00001066735.
DR   EnsemblGenomes-Gn; EBG00001066736.
DR   EnsemblGenomes-Gn; EBG00001066737.
DR   EnsemblGenomes-Gn; EBG00001066738.
DR   EnsemblGenomes-Gn; EBG00001066739.
DR   EnsemblGenomes-Gn; EBG00001066740.
DR   EnsemblGenomes-Gn; EBG00001066741.
DR   EnsemblGenomes-Gn; EBG00001066742.
DR   EnsemblGenomes-Gn; EBG00001066743.
DR   EnsemblGenomes-Gn; EBG00001066744.
DR   EnsemblGenomes-Gn; EBG00001066745.
DR   EnsemblGenomes-Gn; EBG00001066746.
DR   EnsemblGenomes-Gn; EBG00001066747.
DR   EnsemblGenomes-Gn; EBG00001066748.
DR   EnsemblGenomes-Gn; EBG00001066749.
DR   EnsemblGenomes-Gn; EBG00001066750.
DR   EnsemblGenomes-Gn; EBG00001066751.
DR   EnsemblGenomes-Gn; EBG00001066752.
DR   EnsemblGenomes-Gn; EBG00001066753.
DR   EnsemblGenomes-Gn; EBG00001066754.
DR   EnsemblGenomes-Gn; EBG00001066755.
DR   EnsemblGenomes-Gn; EBG00001066757.
DR   EnsemblGenomes-Gn; EBG00001066759.
DR   EnsemblGenomes-Gn; EBG00001066761.
DR   EnsemblGenomes-Gn; EBG00001066763.
DR   EnsemblGenomes-Gn; EBG00001066766.
DR   EnsemblGenomes-Gn; EBG00001066767.
DR   EnsemblGenomes-Gn; EBG00001066769.
DR   EnsemblGenomes-Gn; EBG00001066771.
DR   EnsemblGenomes-Gn; EBG00001066773.
DR   EnsemblGenomes-Gn; EBG00001066776.
DR   EnsemblGenomes-Gn; EBG00001066778.
DR   EnsemblGenomes-Gn; EBG00001066780.
DR   EnsemblGenomes-Gn; EBG00001066782.
DR   EnsemblGenomes-Gn; EBG00001066784.
DR   EnsemblGenomes-Gn; EBG00001066786.
DR   EnsemblGenomes-Gn; EBG00001066788.
DR   EnsemblGenomes-Gn; EBG00001066790.
DR   EnsemblGenomes-Gn; EBG00001066792.
DR   EnsemblGenomes-Gn; EBG00001066794.
DR   EnsemblGenomes-Gn; EBG00001066796.
DR   EnsemblGenomes-Gn; EBG00001066798.
DR   EnsemblGenomes-Gn; EBG00001066800.
DR   EnsemblGenomes-Gn; EBG00001066802.
DR   EnsemblGenomes-Gn; EBG00001066804.
DR   EnsemblGenomes-Gn; EBG00001066806.
DR   EnsemblGenomes-Gn; EBG00001066808.
DR   EnsemblGenomes-Gn; EBG00001066810.
DR   EnsemblGenomes-Gn; EBG00001066813.
DR   EnsemblGenomes-Gn; EBG00001066815.
DR   EnsemblGenomes-Gn; EBG00001066816.
DR   EnsemblGenomes-Gn; EBG00001066818.
DR   EnsemblGenomes-Gn; EBG00001066821.
DR   EnsemblGenomes-Gn; EBG00001066823.
DR   EnsemblGenomes-Gn; EBG00001066825.
DR   EnsemblGenomes-Gn; EBG00001066827.
DR   EnsemblGenomes-Gn; EBG00001066829.
DR   EnsemblGenomes-Gn; EBG00001066831.
DR   EnsemblGenomes-Gn; EBG00001066833.
DR   EnsemblGenomes-Gn; EBG00001066835.
DR   EnsemblGenomes-Gn; EBG00001066839.
DR   EnsemblGenomes-Gn; EBG00001066841.
DR   EnsemblGenomes-Gn; EBG00001066844.
DR   EnsemblGenomes-Gn; EBG00001066846.
DR   EnsemblGenomes-Gn; EBG00001066848.
DR   EnsemblGenomes-Gn; EBG00001066850.
DR   EnsemblGenomes-Gn; EBG00001066853.
DR   EnsemblGenomes-Gn; EBG00001066855.
DR   EnsemblGenomes-Gn; EBG00001066857.
DR   EnsemblGenomes-Gn; EBG00001066859.
DR   EnsemblGenomes-Gn; EBG00001066861.
DR   EnsemblGenomes-Gn; EBG00001066863.
DR   EnsemblGenomes-Gn; EBG00001066865.
DR   EnsemblGenomes-Gn; EBG00001066867.
DR   EnsemblGenomes-Gn; EBG00001066869.
DR   EnsemblGenomes-Gn; EBG00001066871.
DR   EnsemblGenomes-Gn; EBG00001066872.
DR   EnsemblGenomes-Gn; EBG00001066874.
DR   EnsemblGenomes-Gn; EBG00001066875.
DR   EnsemblGenomes-Gn; EBG00001066876.
DR   EnsemblGenomes-Gn; EBG00001066878.
DR   EnsemblGenomes-Gn; EBG00001066879.
DR   EnsemblGenomes-Gn; EBG00001066880.
DR   EnsemblGenomes-Gn; EBG00001066882.
DR   EnsemblGenomes-Gn; EBG00001066884.
DR   EnsemblGenomes-Gn; EBG00001066886.
DR   EnsemblGenomes-Gn; EBG00001066889.
DR   EnsemblGenomes-Gn; EBG00001066892.
DR   EnsemblGenomes-Gn; EBG00001066894.
DR   EnsemblGenomes-Gn; EBG00001066896.
DR   EnsemblGenomes-Gn; EBG00001066898.
DR   EnsemblGenomes-Gn; EBG00001066900.
DR   EnsemblGenomes-Gn; EBG00001066903.
DR   EnsemblGenomes-Gn; EBG00001066905.
DR   EnsemblGenomes-Gn; EBG00001066907.
DR   EnsemblGenomes-Gn; EBG00001066909.
DR   EnsemblGenomes-Gn; EBG00001066911.
DR   EnsemblGenomes-Gn; EBG00001066913.
DR   EnsemblGenomes-Gn; EBG00001066916.
DR   EnsemblGenomes-Gn; EBG00001066918.
DR   EnsemblGenomes-Gn; EBG00001066920.
DR   EnsemblGenomes-Gn; EBG00001066922.
DR   EnsemblGenomes-Gn; EBG00001066924.
DR   EnsemblGenomes-Gn; EBG00001066926.
DR   EnsemblGenomes-Gn; EBG00001066928.
DR   EnsemblGenomes-Gn; EBG00001066930.
DR   EnsemblGenomes-Gn; EBG00001066932.
DR   EnsemblGenomes-Gn; EBG00001066934.
DR   EnsemblGenomes-Gn; EBG00001066936.
DR   EnsemblGenomes-Gn; EBG00001066938.
DR   EnsemblGenomes-Gn; EBG00001066940.
DR   EnsemblGenomes-Gn; EBG00001066942.
DR   EnsemblGenomes-Gn; EBG00001066943.
DR   EnsemblGenomes-Gn; EBG00001066944.
DR   EnsemblGenomes-Gn; EBG00001066945.
DR   EnsemblGenomes-Gn; EBG00001066946.
DR   EnsemblGenomes-Gn; EBG00001066947.
DR   EnsemblGenomes-Gn; EBG00001066948.
DR   EnsemblGenomes-Gn; EBG00001066949.
DR   EnsemblGenomes-Gn; EBG00001066950.
DR   EnsemblGenomes-Gn; EBG00001066951.
DR   EnsemblGenomes-Gn; EBG00001066952.
DR   EnsemblGenomes-Gn; EBG00001066953.
DR   EnsemblGenomes-Gn; EBG00001066954.
DR   EnsemblGenomes-Gn; EBG00001066955.
DR   EnsemblGenomes-Gn; EBG00001066956.
DR   EnsemblGenomes-Gn; EBG00001066957.
DR   EnsemblGenomes-Gn; EBG00001066958.
DR   EnsemblGenomes-Gn; EBG00001066959.
DR   EnsemblGenomes-Gn; EBG00001066960.
DR   EnsemblGenomes-Gn; EBG00001066961.
DR   EnsemblGenomes-Gn; EBG00001066962.
DR   EnsemblGenomes-Gn; EBG00001066963.
DR   EnsemblGenomes-Gn; EBG00001066964.
DR   EnsemblGenomes-Gn; EBG00001066965.
DR   EnsemblGenomes-Gn; EBG00001066966.
DR   EnsemblGenomes-Gn; EBG00001066967.
DR   EnsemblGenomes-Gn; EBG00001066968.
DR   EnsemblGenomes-Gn; EBG00001066969.
DR   EnsemblGenomes-Gn; EBG00001066970.
DR   EnsemblGenomes-Gn; EBG00001066971.
DR   EnsemblGenomes-Gn; EBG00001066972.
DR   EnsemblGenomes-Gn; EBG00001066973.
DR   EnsemblGenomes-Gn; EBG00001066974.
DR   EnsemblGenomes-Gn; EBG00001066975.
DR   EnsemblGenomes-Gn; EBG00001066976.
DR   EnsemblGenomes-Gn; EBG00001066977.
DR   EnsemblGenomes-Gn; EBG00001066978.
DR   EnsemblGenomes-Gn; EBG00001066979.
DR   EnsemblGenomes-Gn; EBG00001066980.
DR   EnsemblGenomes-Gn; EBG00001066981.
DR   EnsemblGenomes-Gn; EBG00001066982.
DR   EnsemblGenomes-Gn; EBG00001066983.
DR   EnsemblGenomes-Gn; EBG00001066984.
DR   EnsemblGenomes-Gn; EBG00001066985.
DR   EnsemblGenomes-Gn; EBG00001066986.
DR   EnsemblGenomes-Gn; EBG00001066987.
DR   EnsemblGenomes-Gn; EBG00001066988.
DR   EnsemblGenomes-Gn; EBG00001066989.
DR   EnsemblGenomes-Gn; EBG00001066990.
DR   EnsemblGenomes-Gn; EBG00001066991.
DR   EnsemblGenomes-Gn; EBG00001066992.
DR   EnsemblGenomes-Gn; EBG00001066993.
DR   EnsemblGenomes-Gn; EBG00001066994.
DR   EnsemblGenomes-Gn; EBG00001066995.
DR   EnsemblGenomes-Gn; EBG00001066996.
DR   EnsemblGenomes-Gn; EBG00001066997.
DR   EnsemblGenomes-Gn; EBG00001066998.
DR   EnsemblGenomes-Gn; EBG00001066999.
DR   EnsemblGenomes-Gn; EBG00001067000.
DR   EnsemblGenomes-Gn; EBG00001067001.
DR   EnsemblGenomes-Gn; EBG00001067002.
DR   EnsemblGenomes-Gn; EBG00001067003.
DR   EnsemblGenomes-Gn; EBG00001067004.
DR   EnsemblGenomes-Gn; EBG00001067005.
DR   EnsemblGenomes-Gn; EBG00001067006.
DR   EnsemblGenomes-Gn; EBG00001067007.
DR   EnsemblGenomes-Gn; EBG00001067008.
DR   EnsemblGenomes-Gn; EBG00001067009.
DR   EnsemblGenomes-Gn; EBG00001067010.
DR   EnsemblGenomes-Gn; EBG00001067011.
DR   EnsemblGenomes-Gn; EBG00001067012.
DR   EnsemblGenomes-Gn; EBG00001067013.
DR   EnsemblGenomes-Gn; EBG00001067014.
DR   EnsemblGenomes-Gn; EBG00001067015.
DR   EnsemblGenomes-Gn; EBG00001067016.
DR   EnsemblGenomes-Gn; EBG00001067017.
DR   EnsemblGenomes-Gn; EBG00001067018.
DR   EnsemblGenomes-Gn; EBG00001067019.
DR   EnsemblGenomes-Gn; EBG00001067020.
DR   EnsemblGenomes-Gn; EBG00001067021.
DR   EnsemblGenomes-Gn; EBG00001067022.
DR   EnsemblGenomes-Gn; EBG00001067023.
DR   EnsemblGenomes-Gn; EBG00001067024.
DR   EnsemblGenomes-Gn; EBG00001067025.
DR   EnsemblGenomes-Gn; EBG00001067026.
DR   EnsemblGenomes-Gn; EBG00001067027.
DR   EnsemblGenomes-Gn; EBG00001067028.
DR   EnsemblGenomes-Gn; EBG00001067029.
DR   EnsemblGenomes-Gn; EBG00001067030.
DR   EnsemblGenomes-Gn; EBG00001067031.
DR   EnsemblGenomes-Gn; EBG00001067032.
DR   EnsemblGenomes-Gn; EBG00001067033.
DR   EnsemblGenomes-Gn; EBG00001067034.
DR   EnsemblGenomes-Gn; EBG00001067035.
DR   EnsemblGenomes-Gn; EBG00001067036.
DR   EnsemblGenomes-Gn; EBG00001067037.
DR   EnsemblGenomes-Gn; EBG00001067038.
DR   EnsemblGenomes-Gn; EBG00001067039.
DR   EnsemblGenomes-Gn; EBG00001067040.
DR   EnsemblGenomes-Gn; EBG00001067041.
DR   EnsemblGenomes-Gn; EBG00001067042.
DR   EnsemblGenomes-Gn; EBG00001067043.
DR   EnsemblGenomes-Gn; EBG00001067044.
DR   EnsemblGenomes-Gn; ECSP_0200.
DR   EnsemblGenomes-Gn; ECSP_0201.
DR   EnsemblGenomes-Gn; ECSP_0202.
DR   EnsemblGenomes-Gn; ECSP_0203.
DR   EnsemblGenomes-Gn; ECSP_0204.
DR   EnsemblGenomes-Gn; ECSP_0205.
DR   EnsemblGenomes-Gn; ECSP_0215.
DR   EnsemblGenomes-Gn; ECSP_0278.
DR   EnsemblGenomes-Gn; ECSP_0610.
DR   EnsemblGenomes-Gn; ECSP_0714.
DR   EnsemblGenomes-Gn; ECSP_0715.
DR   EnsemblGenomes-Gn; ECSP_0716.
DR   EnsemblGenomes-Gn; ECSP_0717.
DR   EnsemblGenomes-Gn; ECSP_0718.
DR   EnsemblGenomes-Gn; ECSP_0719.
DR   EnsemblGenomes-Gn; ECSP_0720.
DR   EnsemblGenomes-Gn; ECSP_0796.
DR   EnsemblGenomes-Gn; ECSP_0797.
DR   EnsemblGenomes-Gn; ECSP_0798.
DR   EnsemblGenomes-Gn; ECSP_0799.
DR   EnsemblGenomes-Gn; ECSP_0800.
DR   EnsemblGenomes-Gn; ECSP_0801.
DR   EnsemblGenomes-Gn; ECSP_0988.
DR   EnsemblGenomes-Gn; ECSP_1104.
DR   EnsemblGenomes-Gn; ECSP_1105.
DR   EnsemblGenomes-Gn; ECSP_1139.
DR   EnsemblGenomes-Gn; ECSP_1333.
DR   EnsemblGenomes-Gn; ECSP_1622.
DR   EnsemblGenomes-Gn; ECSP_1623.
DR   EnsemblGenomes-Gn; ECSP_1672.
DR   EnsemblGenomes-Gn; ECSP_1673.
DR   EnsemblGenomes-Gn; ECSP_1743.
DR   EnsemblGenomes-Gn; ECSP_2058.
DR   EnsemblGenomes-Gn; ECSP_2059.
DR   EnsemblGenomes-Gn; ECSP_2118.
DR   EnsemblGenomes-Gn; ECSP_2119.
DR   EnsemblGenomes-Gn; ECSP_2120.
DR   EnsemblGenomes-Gn; ECSP_2232.
DR   EnsemblGenomes-Gn; ECSP_2233.
DR   EnsemblGenomes-Gn; ECSP_2513.
DR   EnsemblGenomes-Gn; ECSP_2514.
DR   EnsemblGenomes-Gn; ECSP_2515.
DR   EnsemblGenomes-Gn; ECSP_2617.
DR   EnsemblGenomes-Gn; ECSP_2618.
DR   EnsemblGenomes-Gn; ECSP_2619.
DR   EnsemblGenomes-Gn; ECSP_2638.
DR   EnsemblGenomes-Gn; ECSP_2640.
DR   EnsemblGenomes-Gn; ECSP_2648.
DR   EnsemblGenomes-Gn; ECSP_2650.
DR   EnsemblGenomes-Gn; ECSP_2654.
DR   EnsemblGenomes-Gn; ECSP_2724.
DR   EnsemblGenomes-Gn; ECSP_2725.
DR   EnsemblGenomes-Gn; ECSP_2726.
DR   EnsemblGenomes-Gn; ECSP_2960.
DR   EnsemblGenomes-Gn; ECSP_2961.
DR   EnsemblGenomes-Gn; ECSP_2962.
DR   EnsemblGenomes-Gn; ECSP_3070.
DR   EnsemblGenomes-Gn; ECSP_3254.
DR   EnsemblGenomes-Gn; ECSP_3255.
DR   EnsemblGenomes-Gn; ECSP_3256.
DR   EnsemblGenomes-Gn; ECSP_3298.
DR   EnsemblGenomes-Gn; ECSP_3344.
DR   EnsemblGenomes-Gn; ECSP_3345.
DR   EnsemblGenomes-Gn; ECSP_3351.
DR   EnsemblGenomes-Gn; ECSP_3352.
DR   EnsemblGenomes-Gn; ECSP_3353.
DR   EnsemblGenomes-Gn; ECSP_3354.
DR   EnsemblGenomes-Gn; ECSP_3535.
DR   EnsemblGenomes-Gn; ECSP_3536.
DR   EnsemblGenomes-Gn; ECSP_3537.
DR   EnsemblGenomes-Gn; ECSP_3538.
DR   EnsemblGenomes-Gn; ECSP_3602.
DR   EnsemblGenomes-Gn; ECSP_3638.
DR   EnsemblGenomes-Gn; ECSP_3639.
DR   EnsemblGenomes-Gn; ECSP_3640.
DR   EnsemblGenomes-Gn; ECSP_3641.
DR   EnsemblGenomes-Gn; ECSP_3642.
DR   EnsemblGenomes-Gn; ECSP_3766.
DR   EnsemblGenomes-Gn; ECSP_3767.
DR   EnsemblGenomes-Gn; ECSP_3768.
DR   EnsemblGenomes-Gn; ECSP_3834.
DR   EnsemblGenomes-Gn; ECSP_3939.
DR   EnsemblGenomes-Gn; ECSP_4043.
DR   EnsemblGenomes-Gn; ECSP_4146.
DR   EnsemblGenomes-Gn; ECSP_4149.
DR   EnsemblGenomes-Gn; ECSP_4243.
DR   EnsemblGenomes-Gn; ECSP_4244.
DR   EnsemblGenomes-Gn; ECSP_4245.
DR   EnsemblGenomes-Gn; ECSP_4246.
DR   EnsemblGenomes-Gn; ECSP_4247.
DR   EnsemblGenomes-Gn; ECSP_4248.
DR   EnsemblGenomes-Gn; ECSP_4249.
DR   EnsemblGenomes-Gn; ECSP_4536.
DR   EnsemblGenomes-Gn; ECSP_4807.
DR   EnsemblGenomes-Gn; ECSP_4808.
DR   EnsemblGenomes-Gn; ECSP_4809.
DR   EnsemblGenomes-Gn; ECSP_4810.
DR   EnsemblGenomes-Gn; ECSP_4811.
DR   EnsemblGenomes-Gn; ECSP_4812.
DR   EnsemblGenomes-Gn; ECSP_4845.
DR   EnsemblGenomes-Gn; ECSP_4846.
DR   EnsemblGenomes-Gn; ECSP_4847.
DR   EnsemblGenomes-Gn; ECSP_4848.
DR   EnsemblGenomes-Gn; ECSP_4849.
DR   EnsemblGenomes-Gn; ECSP_4850.
DR   EnsemblGenomes-Gn; ECSP_4904.
DR   EnsemblGenomes-Gn; ECSP_4905.
DR   EnsemblGenomes-Gn; ECSP_4906.
DR   EnsemblGenomes-Gn; ECSP_4907.
DR   EnsemblGenomes-Gn; ECSP_4908.
DR   EnsemblGenomes-Gn; ECSP_5039.
DR   EnsemblGenomes-Gn; ECSP_5040.
DR   EnsemblGenomes-Gn; ECSP_5041.
DR   EnsemblGenomes-Gn; ECSP_5042.
DR   EnsemblGenomes-Gn; ECSP_5046.
DR   EnsemblGenomes-Gn; ECSP_5047.
DR   EnsemblGenomes-Gn; ECSP_5048.
DR   EnsemblGenomes-Gn; ECSP_5049.
DR   EnsemblGenomes-Gn; ECSP_5077.
DR   EnsemblGenomes-Gn; ECSP_5078.
DR   EnsemblGenomes-Gn; ECSP_5079.
DR   EnsemblGenomes-Gn; ECSP_5080.
DR   EnsemblGenomes-Gn; ECSP_5234.
DR   EnsemblGenomes-Gn; ECSP_5263.
DR   EnsemblGenomes-Gn; ECSP_5264.
DR   EnsemblGenomes-Gn; ECSP_5265.
DR   EnsemblGenomes-Gn; ECSP_5366.
DR   EnsemblGenomes-Gn; ECSP_5452.
DR   EnsemblGenomes-Tr; EBT00001668733.
DR   EnsemblGenomes-Tr; EBT00001668734.
DR   EnsemblGenomes-Tr; EBT00001668735.
DR   EnsemblGenomes-Tr; EBT00001668736.
DR   EnsemblGenomes-Tr; EBT00001668737.
DR   EnsemblGenomes-Tr; EBT00001668738.
DR   EnsemblGenomes-Tr; EBT00001668739.
DR   EnsemblGenomes-Tr; EBT00001668740.
DR   EnsemblGenomes-Tr; EBT00001668741.
DR   EnsemblGenomes-Tr; EBT00001668742.
DR   EnsemblGenomes-Tr; EBT00001668743.
DR   EnsemblGenomes-Tr; EBT00001668744.
DR   EnsemblGenomes-Tr; EBT00001668745.
DR   EnsemblGenomes-Tr; EBT00001668746.
DR   EnsemblGenomes-Tr; EBT00001668747.
DR   EnsemblGenomes-Tr; EBT00001668748.
DR   EnsemblGenomes-Tr; EBT00001668749.
DR   EnsemblGenomes-Tr; EBT00001668750.
DR   EnsemblGenomes-Tr; EBT00001668751.
DR   EnsemblGenomes-Tr; EBT00001668752.
DR   EnsemblGenomes-Tr; EBT00001668753.
DR   EnsemblGenomes-Tr; EBT00001668754.
DR   EnsemblGenomes-Tr; EBT00001668755.
DR   EnsemblGenomes-Tr; EBT00001668756.
DR   EnsemblGenomes-Tr; EBT00001668757.
DR   EnsemblGenomes-Tr; EBT00001668758.
DR   EnsemblGenomes-Tr; EBT00001668759.
DR   EnsemblGenomes-Tr; EBT00001668760.
DR   EnsemblGenomes-Tr; EBT00001668761.
DR   EnsemblGenomes-Tr; EBT00001668762.
DR   EnsemblGenomes-Tr; EBT00001668763.
DR   EnsemblGenomes-Tr; EBT00001668764.
DR   EnsemblGenomes-Tr; EBT00001668765.
DR   EnsemblGenomes-Tr; EBT00001668766.
DR   EnsemblGenomes-Tr; EBT00001668767.
DR   EnsemblGenomes-Tr; EBT00001668768.
DR   EnsemblGenomes-Tr; EBT00001668769.
DR   EnsemblGenomes-Tr; EBT00001668770.
DR   EnsemblGenomes-Tr; EBT00001668771.
DR   EnsemblGenomes-Tr; EBT00001668772.
DR   EnsemblGenomes-Tr; EBT00001668773.
DR   EnsemblGenomes-Tr; EBT00001668774.
DR   EnsemblGenomes-Tr; EBT00001668775.
DR   EnsemblGenomes-Tr; EBT00001668776.
DR   EnsemblGenomes-Tr; EBT00001668777.
DR   EnsemblGenomes-Tr; EBT00001668778.
DR   EnsemblGenomes-Tr; EBT00001668779.
DR   EnsemblGenomes-Tr; EBT00001668780.
DR   EnsemblGenomes-Tr; EBT00001668781.
DR   EnsemblGenomes-Tr; EBT00001668782.
DR   EnsemblGenomes-Tr; EBT00001668783.
DR   EnsemblGenomes-Tr; EBT00001668784.
DR   EnsemblGenomes-Tr; EBT00001668785.
DR   EnsemblGenomes-Tr; EBT00001668786.
DR   EnsemblGenomes-Tr; EBT00001668787.
DR   EnsemblGenomes-Tr; EBT00001668788.
DR   EnsemblGenomes-Tr; EBT00001668789.
DR   EnsemblGenomes-Tr; EBT00001668790.
DR   EnsemblGenomes-Tr; EBT00001668791.
DR   EnsemblGenomes-Tr; EBT00001668792.
DR   EnsemblGenomes-Tr; EBT00001668793.
DR   EnsemblGenomes-Tr; EBT00001668794.
DR   EnsemblGenomes-Tr; EBT00001668795.
DR   EnsemblGenomes-Tr; EBT00001668796.
DR   EnsemblGenomes-Tr; EBT00001668797.
DR   EnsemblGenomes-Tr; EBT00001668798.
DR   EnsemblGenomes-Tr; EBT00001668799.
DR   EnsemblGenomes-Tr; EBT00001668800.
DR   EnsemblGenomes-Tr; EBT00001668801.
DR   EnsemblGenomes-Tr; EBT00001668802.
DR   EnsemblGenomes-Tr; EBT00001668803.
DR   EnsemblGenomes-Tr; EBT00001668804.
DR   EnsemblGenomes-Tr; EBT00001668805.
DR   EnsemblGenomes-Tr; EBT00001668806.
DR   EnsemblGenomes-Tr; EBT00001668807.
DR   EnsemblGenomes-Tr; EBT00001668808.
DR   EnsemblGenomes-Tr; EBT00001668809.
DR   EnsemblGenomes-Tr; EBT00001668810.
DR   EnsemblGenomes-Tr; EBT00001668811.
DR   EnsemblGenomes-Tr; EBT00001668812.
DR   EnsemblGenomes-Tr; EBT00001668813.
DR   EnsemblGenomes-Tr; EBT00001668814.
DR   EnsemblGenomes-Tr; EBT00001668815.
DR   EnsemblGenomes-Tr; EBT00001668816.
DR   EnsemblGenomes-Tr; EBT00001668817.
DR   EnsemblGenomes-Tr; EBT00001668818.
DR   EnsemblGenomes-Tr; EBT00001668819.
DR   EnsemblGenomes-Tr; EBT00001668820.
DR   EnsemblGenomes-Tr; EBT00001668821.
DR   EnsemblGenomes-Tr; EBT00001668822.
DR   EnsemblGenomes-Tr; EBT00001668823.
DR   EnsemblGenomes-Tr; EBT00001668824.
DR   EnsemblGenomes-Tr; EBT00001668825.
DR   EnsemblGenomes-Tr; EBT00001668826.
DR   EnsemblGenomes-Tr; EBT00001668827.
DR   EnsemblGenomes-Tr; EBT00001668828.
DR   EnsemblGenomes-Tr; EBT00001668829.
DR   EnsemblGenomes-Tr; EBT00001668830.
DR   EnsemblGenomes-Tr; EBT00001668831.
DR   EnsemblGenomes-Tr; EBT00001668832.
DR   EnsemblGenomes-Tr; EBT00001668833.
DR   EnsemblGenomes-Tr; EBT00001668834.
DR   EnsemblGenomes-Tr; EBT00001668835.
DR   EnsemblGenomes-Tr; EBT00001668836.
DR   EnsemblGenomes-Tr; EBT00001668837.
DR   EnsemblGenomes-Tr; EBT00001668838.
DR   EnsemblGenomes-Tr; EBT00001668839.
DR   EnsemblGenomes-Tr; EBT00001668840.
DR   EnsemblGenomes-Tr; EBT00001668841.
DR   EnsemblGenomes-Tr; EBT00001668842.
DR   EnsemblGenomes-Tr; EBT00001668843.
DR   EnsemblGenomes-Tr; EBT00001668844.
DR   EnsemblGenomes-Tr; EBT00001668845.
DR   EnsemblGenomes-Tr; EBT00001668846.
DR   EnsemblGenomes-Tr; EBT00001668847.
DR   EnsemblGenomes-Tr; EBT00001668848.
DR   EnsemblGenomes-Tr; EBT00001668849.
DR   EnsemblGenomes-Tr; EBT00001668850.
DR   EnsemblGenomes-Tr; EBT00001668851.
DR   EnsemblGenomes-Tr; EBT00001668852.
DR   EnsemblGenomes-Tr; EBT00001668853.
DR   EnsemblGenomes-Tr; EBT00001668854.
DR   EnsemblGenomes-Tr; EBT00001668855.
DR   EnsemblGenomes-Tr; EBT00001668856.
DR   EnsemblGenomes-Tr; EBT00001668857.
DR   EnsemblGenomes-Tr; EBT00001668858.
DR   EnsemblGenomes-Tr; EBT00001668859.
DR   EnsemblGenomes-Tr; EBT00001668860.
DR   EnsemblGenomes-Tr; EBT00001668861.
DR   EnsemblGenomes-Tr; EBT00001668862.
DR   EnsemblGenomes-Tr; EBT00001668863.
DR   EnsemblGenomes-Tr; EBT00001668864.
DR   EnsemblGenomes-Tr; EBT00001668865.
DR   EnsemblGenomes-Tr; EBT00001668866.
DR   EnsemblGenomes-Tr; EBT00001668867.
DR   EnsemblGenomes-Tr; EBT00001668868.
DR   EnsemblGenomes-Tr; EBT00001668869.
DR   EnsemblGenomes-Tr; EBT00001668870.
DR   EnsemblGenomes-Tr; EBT00001668871.
DR   EnsemblGenomes-Tr; EBT00001668872.
DR   EnsemblGenomes-Tr; EBT00001668873.
DR   EnsemblGenomes-Tr; EBT00001668874.
DR   EnsemblGenomes-Tr; EBT00001668875.
DR   EnsemblGenomes-Tr; EBT00001668876.
DR   EnsemblGenomes-Tr; EBT00001668877.
DR   EnsemblGenomes-Tr; EBT00001668878.
DR   EnsemblGenomes-Tr; EBT00001668879.
DR   EnsemblGenomes-Tr; EBT00001668880.
DR   EnsemblGenomes-Tr; EBT00001668881.
DR   EnsemblGenomes-Tr; EBT00001668882.
DR   EnsemblGenomes-Tr; EBT00001668883.
DR   EnsemblGenomes-Tr; EBT00001668884.
DR   EnsemblGenomes-Tr; EBT00001668885.
DR   EnsemblGenomes-Tr; EBT00001668886.
DR   EnsemblGenomes-Tr; EBT00001668887.
DR   EnsemblGenomes-Tr; EBT00001668888.
DR   EnsemblGenomes-Tr; EBT00001668889.
DR   EnsemblGenomes-Tr; EBT00001668890.
DR   EnsemblGenomes-Tr; EBT00001668891.
DR   EnsemblGenomes-Tr; EBT00001668892.
DR   EnsemblGenomes-Tr; EBT00001668893.
DR   EnsemblGenomes-Tr; EBT00001668894.
DR   EnsemblGenomes-Tr; EBT00001668895.
DR   EnsemblGenomes-Tr; EBT00001668896.
DR   EnsemblGenomes-Tr; EBT00001668897.
DR   EnsemblGenomes-Tr; EBT00001668898.
DR   EnsemblGenomes-Tr; EBT00001668899.
DR   EnsemblGenomes-Tr; EBT00001668900.
DR   EnsemblGenomes-Tr; EBT00001668901.
DR   EnsemblGenomes-Tr; EBT00001668902.
DR   EnsemblGenomes-Tr; EBT00001668903.
DR   EnsemblGenomes-Tr; EBT00001668904.
DR   EnsemblGenomes-Tr; EBT00001668905.
DR   EnsemblGenomes-Tr; EBT00001668906.
DR   EnsemblGenomes-Tr; EBT00001668907.
DR   EnsemblGenomes-Tr; EBT00001668908.
DR   EnsemblGenomes-Tr; EBT00001668909.
DR   EnsemblGenomes-Tr; EBT00001668910.
DR   EnsemblGenomes-Tr; EBT00001668911.
DR   EnsemblGenomes-Tr; EBT00001668912.
DR   EnsemblGenomes-Tr; EBT00001668913.
DR   EnsemblGenomes-Tr; EBT00001668914.
DR   EnsemblGenomes-Tr; EBT00001668915.
DR   EnsemblGenomes-Tr; EBT00001668916.
DR   EnsemblGenomes-Tr; EBT00001668917.
DR   EnsemblGenomes-Tr; EBT00001668918.
DR   EnsemblGenomes-Tr; EBT00001668919.
DR   EnsemblGenomes-Tr; EBT00001668920.
DR   EnsemblGenomes-Tr; EBT00001668921.
DR   EnsemblGenomes-Tr; EBT00001668922.
DR   EnsemblGenomes-Tr; EBT00001668923.
DR   EnsemblGenomes-Tr; EBT00001668924.
DR   EnsemblGenomes-Tr; EBT00001668925.
DR   EnsemblGenomes-Tr; EBT00001668926.
DR   EnsemblGenomes-Tr; EBT00001668927.
DR   EnsemblGenomes-Tr; EBT00001668928.
DR   EnsemblGenomes-Tr; EBT00001668929.
DR   EnsemblGenomes-Tr; EBT00001668930.
DR   EnsemblGenomes-Tr; EBT00001668931.
DR   EnsemblGenomes-Tr; EBT00001668932.
DR   EnsemblGenomes-Tr; EBT00001668933.
DR   EnsemblGenomes-Tr; EBT00001668934.
DR   EnsemblGenomes-Tr; EBT00001668935.
DR   EnsemblGenomes-Tr; EBT00001668936.
DR   EnsemblGenomes-Tr; EBT00001668937.
DR   EnsemblGenomes-Tr; EBT00001668938.
DR   EnsemblGenomes-Tr; EBT00001668939.
DR   EnsemblGenomes-Tr; EBT00001668940.
DR   EnsemblGenomes-Tr; EBT00001668941.
DR   EnsemblGenomes-Tr; EBT00001668942.
DR   EnsemblGenomes-Tr; EBT00001668943.
DR   EnsemblGenomes-Tr; EBT00001668944.
DR   EnsemblGenomes-Tr; EBT00001668945.
DR   EnsemblGenomes-Tr; EBT00001668946.
DR   EnsemblGenomes-Tr; EBT00001668947.
DR   EnsemblGenomes-Tr; EBT00001668948.
DR   EnsemblGenomes-Tr; EBT00001668949.
DR   EnsemblGenomes-Tr; EBT00001668950.
DR   EnsemblGenomes-Tr; EBT00001668951.
DR   EnsemblGenomes-Tr; EBT00001668952.
DR   EnsemblGenomes-Tr; EBT00001668953.
DR   EnsemblGenomes-Tr; EBT00001668954.
DR   EnsemblGenomes-Tr; EBT00001668955.
DR   EnsemblGenomes-Tr; EBT00001668956.
DR   EnsemblGenomes-Tr; EBT00001668957.
DR   EnsemblGenomes-Tr; EBT00001668958.
DR   EnsemblGenomes-Tr; EBT00001668959.
DR   EnsemblGenomes-Tr; EBT00001668960.
DR   EnsemblGenomes-Tr; EBT00001668961.
DR   EnsemblGenomes-Tr; EBT00001668962.
DR   EnsemblGenomes-Tr; EBT00001668963.
DR   EnsemblGenomes-Tr; EBT00001668964.
DR   EnsemblGenomes-Tr; EBT00001668965.
DR   EnsemblGenomes-Tr; EBT00001668966.
DR   EnsemblGenomes-Tr; EBT00001668967.
DR   EnsemblGenomes-Tr; EBT00001668968.
DR   EnsemblGenomes-Tr; EBT00001668969.
DR   EnsemblGenomes-Tr; EBT00001668970.
DR   EnsemblGenomes-Tr; EBT00001668971.
DR   EnsemblGenomes-Tr; EBT00001668972.
DR   EnsemblGenomes-Tr; EBT00001668973.
DR   EnsemblGenomes-Tr; EBT00001668974.
DR   EnsemblGenomes-Tr; EBT00001668975.
DR   EnsemblGenomes-Tr; EBT00001668976.
DR   EnsemblGenomes-Tr; EBT00001668977.
DR   EnsemblGenomes-Tr; EBT00001668978.
DR   EnsemblGenomes-Tr; EBT00001668979.
DR   EnsemblGenomes-Tr; EBT00001668980.
DR   EnsemblGenomes-Tr; EBT00001668981.
DR   EnsemblGenomes-Tr; EBT00001668982.
DR   EnsemblGenomes-Tr; EBT00001668983.
DR   EnsemblGenomes-Tr; EBT00001668984.
DR   EnsemblGenomes-Tr; EBT00001668985.
DR   EnsemblGenomes-Tr; EBT00001668986.
DR   EnsemblGenomes-Tr; EBT00001668987.
DR   EnsemblGenomes-Tr; EBT00001668988.
DR   EnsemblGenomes-Tr; EBT00001668989.
DR   EnsemblGenomes-Tr; EBT00001668990.
DR   EnsemblGenomes-Tr; EBT00001668991.
DR   EnsemblGenomes-Tr; EBT00001668992.
DR   EnsemblGenomes-Tr; EBT00001668993.
DR   EnsemblGenomes-Tr; EBT00001668994.
DR   EnsemblGenomes-Tr; EBT00001668995.
DR   EnsemblGenomes-Tr; EBT00001668996.
DR   EnsemblGenomes-Tr; EBT00001668997.
DR   EnsemblGenomes-Tr; EBT00001668998.
DR   EnsemblGenomes-Tr; EBT00001668999.
DR   EnsemblGenomes-Tr; EBT00001669000.
DR   EnsemblGenomes-Tr; EBT00001669001.
DR   EnsemblGenomes-Tr; EBT00001669002.
DR   EnsemblGenomes-Tr; EBT00001669003.
DR   EnsemblGenomes-Tr; EBT00001669004.
DR   EnsemblGenomes-Tr; EBT00001669005.
DR   EnsemblGenomes-Tr; EBT00001669006.
DR   EnsemblGenomes-Tr; EBT00001669007.
DR   EnsemblGenomes-Tr; ECSP_0200-1.
DR   EnsemblGenomes-Tr; ECSP_0201-1.
DR   EnsemblGenomes-Tr; ECSP_0202-1.
DR   EnsemblGenomes-Tr; ECSP_0203-1.
DR   EnsemblGenomes-Tr; ECSP_0204-1.
DR   EnsemblGenomes-Tr; ECSP_0205-1.
DR   EnsemblGenomes-Tr; ECSP_0215-1.
DR   EnsemblGenomes-Tr; ECSP_0278-1.
DR   EnsemblGenomes-Tr; ECSP_0610-1.
DR   EnsemblGenomes-Tr; ECSP_0714-1.
DR   EnsemblGenomes-Tr; ECSP_0715-1.
DR   EnsemblGenomes-Tr; ECSP_0716-1.
DR   EnsemblGenomes-Tr; ECSP_0717-1.
DR   EnsemblGenomes-Tr; ECSP_0718-1.
DR   EnsemblGenomes-Tr; ECSP_0719-1.
DR   EnsemblGenomes-Tr; ECSP_0720-1.
DR   EnsemblGenomes-Tr; ECSP_0796-1.
DR   EnsemblGenomes-Tr; ECSP_0797-1.
DR   EnsemblGenomes-Tr; ECSP_0798-1.
DR   EnsemblGenomes-Tr; ECSP_0799-1.
DR   EnsemblGenomes-Tr; ECSP_0800-1.
DR   EnsemblGenomes-Tr; ECSP_0801-1.
DR   EnsemblGenomes-Tr; ECSP_0988-1.
DR   EnsemblGenomes-Tr; ECSP_1104-1.
DR   EnsemblGenomes-Tr; ECSP_1105-1.
DR   EnsemblGenomes-Tr; ECSP_1139-1.
DR   EnsemblGenomes-Tr; ECSP_1333-1.
DR   EnsemblGenomes-Tr; ECSP_1622-1.
DR   EnsemblGenomes-Tr; ECSP_1623-1.
DR   EnsemblGenomes-Tr; ECSP_1672-1.
DR   EnsemblGenomes-Tr; ECSP_1673-1.
DR   EnsemblGenomes-Tr; ECSP_1743-1.
DR   EnsemblGenomes-Tr; ECSP_2058-1.
DR   EnsemblGenomes-Tr; ECSP_2059-1.
DR   EnsemblGenomes-Tr; ECSP_2118-1.
DR   EnsemblGenomes-Tr; ECSP_2119-1.
DR   EnsemblGenomes-Tr; ECSP_2120-1.
DR   EnsemblGenomes-Tr; ECSP_2232-1.
DR   EnsemblGenomes-Tr; ECSP_2233-1.
DR   EnsemblGenomes-Tr; ECSP_2513-1.
DR   EnsemblGenomes-Tr; ECSP_2514-1.
DR   EnsemblGenomes-Tr; ECSP_2515-1.
DR   EnsemblGenomes-Tr; ECSP_2617-1.
DR   EnsemblGenomes-Tr; ECSP_2618-1.
DR   EnsemblGenomes-Tr; ECSP_2619-1.
DR   EnsemblGenomes-Tr; ECSP_2638-1.
DR   EnsemblGenomes-Tr; ECSP_2640-1.
DR   EnsemblGenomes-Tr; ECSP_2648-1.
DR   EnsemblGenomes-Tr; ECSP_2650-1.
DR   EnsemblGenomes-Tr; ECSP_2654-1.
DR   EnsemblGenomes-Tr; ECSP_2724-1.
DR   EnsemblGenomes-Tr; ECSP_2725-1.
DR   EnsemblGenomes-Tr; ECSP_2726-1.
DR   EnsemblGenomes-Tr; ECSP_2960-1.
DR   EnsemblGenomes-Tr; ECSP_2961-1.
DR   EnsemblGenomes-Tr; ECSP_2962-1.
DR   EnsemblGenomes-Tr; ECSP_3070-1.
DR   EnsemblGenomes-Tr; ECSP_3254-1.
DR   EnsemblGenomes-Tr; ECSP_3255-1.
DR   EnsemblGenomes-Tr; ECSP_3256-1.
DR   EnsemblGenomes-Tr; ECSP_3298-1.
DR   EnsemblGenomes-Tr; ECSP_3344-1.
DR   EnsemblGenomes-Tr; ECSP_3345-1.
DR   EnsemblGenomes-Tr; ECSP_3351-1.
DR   EnsemblGenomes-Tr; ECSP_3352-1.
DR   EnsemblGenomes-Tr; ECSP_3353-1.
DR   EnsemblGenomes-Tr; ECSP_3354-1.
DR   EnsemblGenomes-Tr; ECSP_3535-1.
DR   EnsemblGenomes-Tr; ECSP_3536-1.
DR   EnsemblGenomes-Tr; ECSP_3537-1.
DR   EnsemblGenomes-Tr; ECSP_3538-1.
DR   EnsemblGenomes-Tr; ECSP_3602-1.
DR   EnsemblGenomes-Tr; ECSP_3638-1.
DR   EnsemblGenomes-Tr; ECSP_3639-1.
DR   EnsemblGenomes-Tr; ECSP_3640-1.
DR   EnsemblGenomes-Tr; ECSP_3641-1.
DR   EnsemblGenomes-Tr; ECSP_3642-1.
DR   EnsemblGenomes-Tr; ECSP_3766-1.
DR   EnsemblGenomes-Tr; ECSP_3767-1.
DR   EnsemblGenomes-Tr; ECSP_3768-1.
DR   EnsemblGenomes-Tr; ECSP_3834-1.
DR   EnsemblGenomes-Tr; ECSP_3939-1.
DR   EnsemblGenomes-Tr; ECSP_4043-1.
DR   EnsemblGenomes-Tr; ECSP_4146-1.
DR   EnsemblGenomes-Tr; ECSP_4149-1.
DR   EnsemblGenomes-Tr; ECSP_4243-1.
DR   EnsemblGenomes-Tr; ECSP_4244-1.
DR   EnsemblGenomes-Tr; ECSP_4245-1.
DR   EnsemblGenomes-Tr; ECSP_4246-1.
DR   EnsemblGenomes-Tr; ECSP_4247-1.
DR   EnsemblGenomes-Tr; ECSP_4248-1.
DR   EnsemblGenomes-Tr; ECSP_4249-1.
DR   EnsemblGenomes-Tr; ECSP_4536-1.
DR   EnsemblGenomes-Tr; ECSP_4807-1.
DR   EnsemblGenomes-Tr; ECSP_4808-1.
DR   EnsemblGenomes-Tr; ECSP_4809-1.
DR   EnsemblGenomes-Tr; ECSP_4810-1.
DR   EnsemblGenomes-Tr; ECSP_4811-1.
DR   EnsemblGenomes-Tr; ECSP_4812-1.
DR   EnsemblGenomes-Tr; ECSP_4845-1.
DR   EnsemblGenomes-Tr; ECSP_4846-1.
DR   EnsemblGenomes-Tr; ECSP_4847-1.
DR   EnsemblGenomes-Tr; ECSP_4848-1.
DR   EnsemblGenomes-Tr; ECSP_4849-1.
DR   EnsemblGenomes-Tr; ECSP_4850-1.
DR   EnsemblGenomes-Tr; ECSP_4904-1.
DR   EnsemblGenomes-Tr; ECSP_4905-1.
DR   EnsemblGenomes-Tr; ECSP_4906-1.
DR   EnsemblGenomes-Tr; ECSP_4907-1.
DR   EnsemblGenomes-Tr; ECSP_4908-1.
DR   EnsemblGenomes-Tr; ECSP_5039-1.
DR   EnsemblGenomes-Tr; ECSP_5040-1.
DR   EnsemblGenomes-Tr; ECSP_5041-1.
DR   EnsemblGenomes-Tr; ECSP_5042-1.
DR   EnsemblGenomes-Tr; ECSP_5046-1.
DR   EnsemblGenomes-Tr; ECSP_5047-1.
DR   EnsemblGenomes-Tr; ECSP_5048-1.
DR   EnsemblGenomes-Tr; ECSP_5049-1.
DR   EnsemblGenomes-Tr; ECSP_5077-1.
DR   EnsemblGenomes-Tr; ECSP_5078-1.
DR   EnsemblGenomes-Tr; ECSP_5079-1.
DR   EnsemblGenomes-Tr; ECSP_5080-1.
DR   EnsemblGenomes-Tr; ECSP_5234-1.
DR   EnsemblGenomes-Tr; ECSP_5263-1.
DR   EnsemblGenomes-Tr; ECSP_5264-1.
DR   EnsemblGenomes-Tr; ECSP_5265-1.
DR   EnsemblGenomes-Tr; ECSP_5366-1.
DR   EnsemblGenomes-Tr; ECSP_5452-1.
DR   EuropePMC; PMC2738036; 19564389.
DR   EuropePMC; PMC2884548; 20433696.
DR   EuropePMC; PMC3133052; 21317333.
DR   EuropePMC; PMC3163573; 21824423.
DR   EuropePMC; PMC3273018; 22179243.
DR   EuropePMC; PMC3434749; 22522897.
DR   EuropePMC; PMC3641635; 23493634.
DR   EuropePMC; PMC3681947; 23785398.
DR   EuropePMC; PMC3754688; 23770900.
DR   EuropePMC; PMC3900561; 24466152.
DR   EuropePMC; PMC4399054; 25667270.
DR   EuropePMC; PMC4609730; 26292302.
DR   EuropePMC; PMC4938407; 27391011.
DR   EuropePMC; PMC5734025; 29054868.
DR   EuropePMC; PMC6408774; 30849935.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00115; IS061.
DR   RFAM; RF00116; C0465.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00119; C0299.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00122; GadY.
DR   RFAM; RF00124; IS102.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00262; sar.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00372; sroH.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01387; isrC.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01804; Lambda_thermo.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02083; OrzO-P.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02111; IS009.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP001368.
DR   SILVA-SSU; CP001368.
XX
CC   Source DNA is available from Samuel I. Miller, University of
CC   Washington, E-mail: millersi@u.washington.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5528136
FT                   /organism="Escherichia coli O157:H7 str. TW14359"
FT                   /strain="TW14359"
FT                   /serotype="O157:H7"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:544404"
FT   gene            complement(133..351)
FT                   /locus_tag="ECSP_0001"
FT   CDS_pept        complement(133..351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69898"
FT                   /protein_id="ACT69898.1"
FT                   /translation="MLPRYLWSKKKPALSGAGFFLCFLYASARTVTCGNGNGDGGGDGG
FT                   GNGGANAFHGCCVLCNFYLSVRYAYIG"
FT   gene            360..2816
FT                   /locus_tag="ECSP_0002"
FT   CDS_pept        360..2816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0002"
FT                   /product="aspartokinase/homoserine dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69899"
FT                   /protein_id="ACT69899.1"
FT                   /translation="MLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHL
FT                   VAMIEKTISGQDALPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLH
FT                   GISLLGQCPDSINAALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTV
FT                   DIAESTRRIAASRIPADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCE
FT                   IWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIK
FT                   NTGNPQAPGTLIGASRDEDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRA
FT                   RISVVLITQSSSEYSISFCVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISV
FT                   VGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLF
FT                   NTDQVIEVFVIGVGGVGGALLEQLKRQQSWLKNKHIDLRVCGVANSKALLTNVHGLNLE
FT                   NWQEELAQAKEPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVTPN
FT                   KKANTSSMDYYHLLRHAAEKSRRKFLYDTNVGAGLPVIENLQNLLNAGDELMKFSGILS
FT                   GSLSYIFGKLDEGMSFSEATTLAREMGYTEPDPRDDLSGMDVARKLLILARETGRELEL
FT                   ADIEIEPVLPAEFNAEGDVAAFMANLSQLDDLFAARVAKARDEGKVLRYVGNIDEDGVC
FT                   RVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLRTL
FT                   SWKLGV"
FT   gene            2818..3750
FT                   /locus_tag="ECSP_0003"
FT   CDS_pept        2818..3750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0003"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69900"
FT                   /protein_id="ACT69900.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVESAETFS
FT                   LNNLGRFADKLPSEPRENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA
FT                   AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLEN"
FT   gene            3751..5037
FT                   /gene="thrC"
FT                   /locus_tag="ECSP_0004"
FT   CDS_pept        3751..5037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="ECSP_0004"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69901"
FT                   /protein_id="ACT69901.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDE
FT                   MLKLDFVTRSAKILSAFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHIAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQEARNQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPR
FT                   FLHDGQWSPKATQATLSNAMDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTM
FT                   RELKELGYTSEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKE
FT                   LAERADLPLLSHNLPADFAALRKLMMNHQ"
FT   gene            5251..5547
FT                   /gene="yaaX"
FT                   /locus_tag="ECSP_0005"
FT   CDS_pept        5251..5547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="ECSP_0005"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69902"
FT                   /protein_id="ACT69902.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMATQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHPHGPPPPPRHHKKAHHDHHGGHGPGKHHR"
FT   gene            complement(5700..6476)
FT                   /gene="yaaA"
FT                   /locus_tag="ECSP_0006"
FT   CDS_pept        complement(5700..6476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="ECSP_0006"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69903"
FT                   /protein_id="ACT69903.1"
FT                   /translation="MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQ
FT                   ISTLMRISDKLAGINAARFHDWQPDFTPENARQAILAFKGDVYTGLQAETFSEDDFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENTRGKDLYQFWGDIITNKLNEALAAQG
FT                   DNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTGFNSEGYFFDEASSSNGELVFKRYEQR"
FT   gene            complement(6546..7976)
FT                   /gene="yaaJ"
FT                   /locus_tag="ECSP_0007"
FT   CDS_pept        complement(6546..7976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="ECSP_0007"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69904"
FT                   /protein_id="ACT69904.1"
FT                   /translation="MPDFFSFINSVLWGSVMIYLLFGAGCWFTFRTGFVQFRYIRQFGK
FT                   SLKNSIHPQPGGLTSFQSLCTSLAARVGSGNLAGVALAITAGGPGAVFWMWVAAFIGMA
FT                   TSFAECSLAQLYKERDVNGQFRGGPAWYMARGLGMRWMGVLFAVFLLIAYGIIFSGVQA
FT                   NAVARALSFSFDFPPLVTGIILAVFALLAIIRGLHGVARLMQGFVPLMAIIWVLTSLVI
FT                   CVINIGQLPHVIWSIFESAFGWQEAAGGAAGYTLSQAITNGFQRSMFSNEAGMGSTPNA
FT                   AAAAASWPPHPAAQGIVQMIGIFIDTLVICTASAMLILLAGNGTTYMPLEGIQLIQKAM
FT                   RVLMGSWGAEFVTLVVILFAFSSIVANYIYAENNLFFLRLNNPKAIWCLRICTFATVIG
FT                   GTLLSLPLMWQLADIIMACMAITNLTAILLLSPVVYTIASDYLRQRKLGVRPVFDPLRY
FT                   PDIGRQLSRDAWDDVSQE"
FT   gene            8255..9208
FT                   /gene="talB"
FT                   /locus_tag="ECSP_0008"
FT   CDS_pept        8255..9208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="ECSP_0008"
FT                   /product="transaldolase B"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69905"
FT                   /protein_id="ACT69905.1"
FT                   /translation="MTDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSNDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWYKANTDKKEYAPAEDPGVVSVSEIYQYYKEHGYETVV
FT                   MGASFRNIGEILELAGCDRLTIAPALLKELAESEGAIERKLSYTGEVKARPARITESEF
FT                   LWQHNQDPMAVDKLAEGIRKFAIDQEKLEKMIGDLL"
FT   gene            9323..9910
FT                   /gene="mog"
FT                   /locus_tag="ECSP_0009"
FT   CDS_pept        9323..9910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="ECSP_0009"
FT                   /product="putative molybdochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69906"
FT                   /protein_id="ACT69906.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETR
FT                   LIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVP
FT                   YCIQLLEGPYVETAPEVVAAFRPKSARRDVSE"
FT   gene            complement(9945..10511)
FT                   /gene="yaaH"
FT                   /locus_tag="ECSP_0010"
FT   CDS_pept        complement(9945..10511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="ECSP_0010"
FT                   /product="conserved inner membrane protein associated with
FT                   acetate transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69907"
FT                   /protein_id="ACT69907.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLG
FT                   LWGVFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGAS
FT                   AIYLAMGEVLNEQFGRTVLPIGESH"
FT   gene            complement(10660..11373)
FT                   /gene="yaaW"
FT                   /locus_tag="ECSP_0011"
FT   CDS_pept        complement(10660..11373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaW"
FT                   /locus_tag="ECSP_0011"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69908"
FT                   /protein_id="ACT69908.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLMR
FT                   NELFKSMEGHPEQHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKKMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSSYRVTIPAV
FT                   LQIACLRRMVSATQV"
FT   gene            complement(11399..11803)
FT                   /gene="yaaI"
FT                   /locus_tag="ECSP_0012"
FT   CDS_pept        complement(11399..11803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="ECSP_0012"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69909"
FT                   /protein_id="ACT69909.1"
FT                   /translation="MKSVFTISASLAISLMLCCTAQANDHKLLGVIAMPRNETNALALK
FT                   LPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
FT   gene            complement(11938..12087)
FT                   /locus_tag="ECSP_0013"
FT   CDS_pept        complement(11938..12087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69910"
FT                   /protein_id="ACT69910.1"
FT                   /translation="MQTHSLRLTTKWGRNPRHQGGDAKIFCAFAQKFRDMAGQDVKLTA
FT                   ILFI"
FT   gene            12180..14096
FT                   /gene="dnaK"
FT                   /locus_tag="ECSP_0014"
FT   CDS_pept        12180..14096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ECSP_0014"
FT                   /product="chaperone Hsp70, co-chaperone with DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69911"
FT                   /protein_id="ACT69911.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVE
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVR
FT                   DAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   gene            14185..15315
FT                   /gene="dnaJ"
FT                   /locus_tag="ECSP_0015"
FT   CDS_pept        14185..15315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ECSP_0015"
FT                   /product="chaperone Hsp40, co-chaperone with DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69912"
FT                   /protein_id="ACT69912.1"
FT                   /translation="MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAET
FT                   KFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGG
FT                   GRGRQRAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPT
FT                   CHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDT
FT                   GDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIE
FT                   VPTLDGRVKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQL
FT                   LQELQESFGGPTGEHNSPRSKSFFDGVKKFFDDLTR"
FT   gene            complement(15419..15628)
FT                   /gene="mokC"
FT                   /locus_tag="ECSP_0016"
FT   CDS_pept        complement(15419..15628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="ECSP_0016"
FT                   /product="regulatory peptide"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69913"
FT                   /protein_id="ACT69913.1"
FT                   /translation="MLNTCRVPLTDRKVKEKRAMKQHKVMIVALIVICITAVVAALVTR
FT                   KDLCEVHIRTGQTEVAVFTAYESE"
FT   gene            16157..17323
FT                   /gene="nhaA"
FT                   /locus_tag="ECSP_0017"
FT   CDS_pept        16157..17323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="ECSP_0017"
FT                   /product="sodium-proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69914"
FT                   /protein_id="ACT69914.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAILAMMMANSGATSGWYHDFLETP
FT                   VQLRVGSLEINKNMLLWINDALMAVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPALLYLAFNYADPITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIID
FT                   DLGAIIIIALFYTNDLSMASLGVAAVAIAVLAVLNLCGVRRTGVYILVGVVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTL
FT                   DGLTSILPLGIIAGLLIGKPLGISLFCWLALRLKLAHLPEGTTYQQIMAVGILCGIGFT
FT                   MSIFIASLAFGSVDPELINWAKLGILVGSISSAVIGYSWLRVRLRPSV"
FT   gene            17383..18288
FT                   /gene="nhaR"
FT                   /locus_tag="ECSP_0018"
FT   CDS_pept        17383..18288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="ECSP_0018"
FT                   /product="DNA-binding transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69915"
FT                   /protein_id="ACT69915.1"
FT                   /translation="MSMSHINYNHLYYFWHVYKEGSVVGAAEALYLTPQTITGQIRALE
FT                   ERLQGKLFKRKGRGLEPSELGELVYRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADV
FT                   LSKRLVSSVLNAAVVEGEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLF
FT                   SVRIGECGVSFWCTNPPPEKPFPACLEERRLLIPGRRSMLGRKLLNWFNSQGLNVEILG
FT                   EFDDAALMKAFGAMHNAIFVAPTLYAYDFYADKTVVEIGRVENVMEEYHAIFAERMIQH
FT                   PAVQRICNTDYSALFSPAVR"
FT   gene            complement(18329..19286)
FT                   /pseudo
FT                   /locus_tag="ECSP_0019"
FT                   /note="gene disrupted by a frameshift; conserved
FT                   hypothetical protein"
FT   gene            complement(19302..21749)
FT                   /pseudo
FT                   /locus_tag="ECSP_0020"
FT                   /note="gene disrupted by stop codon; fimbrial usher protein
FT                   precursor"
FT   gene            complement(21762..22445)
FT                   /locus_tag="ECSP_0021"
FT   CDS_pept        complement(21762..22445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0021"
FT                   /product="putative chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69916"
FT                   /protein_id="ACT69916.1"
FT                   /translation="MRIITALLMSFFILPVHAGVVIYGTRIIYPEKNREVLVQLMNQSK
FT                   NASLIQAWIDDGNTTIAPEKIQVTFILTPPVSRVAGGSGQQLKIRKMPNNLPHNKESLF
FT                   YLNVLDIPPNNPQNAGKNKIKLALQNRIKLLWRPSGIAPVDKKSLSQLNIKKKNNAISI
FT                   NNETANWITVTTIKAQNVKVNNESILLPPFSHNDITLKNNHASEYELTVVDDYGNNIHS
FT                   KIAAR"
FT   gene            complement(22495..23028)
FT                   /locus_tag="ECSP_0022"
FT   CDS_pept        complement(22495..23028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0022"
FT                   /product="putative type-1 fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69917"
FT                   /protein_id="ACT69917.1"
FT                   /translation="MKKYIIPFVATTLMFSATTFAKDVDQGTLTIRGEVVDTTCYFVNG
FT                   DSTTDIVVEDVVTSAMNQLINNEIYTLKTGSTSHDLEIQCDGNTAPSIEVLASEFDANN
FT                   FTLNKGTAENIGFAIFLDDGTLTRMRPGLKTPLKDNGSGQYFLNLNAQYARTSGNPVTK
FT                   GSVESTVTIKISAD"
FT   gene            complement(23330..24751)
FT                   /gene="espX1"
FT                   /locus_tag="ECSP_0023"
FT   CDS_pept        complement(23330..24751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espX1"
FT                   /locus_tag="ECSP_0023"
FT                   /product="non-LEE-encoded type III secreted effector"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69918"
FT                   /protein_id="ACT69918.1"
FT                   /translation="MTDGISTSPHCLYKSNIVDDVIINKTRQNELVKVFCEYKTEFLIL
FT                   FDDFFRSQDLPKPSPVLHHFFQYTHLRDAHFYRCKLIEHTVQFSFFKHKGITLLRLDVF
FT                   DDRTSECLSEEIKIYQECHEKFIKFLKANFNQEIYPELYTPEIFYEACRNLQSFYDHQE
FT                   TSQNAKYSAIVKKKSYFNKEIRNLIKKNIYPELYNEQCNKIPASSTDDNQKITWQNFKT
FT                   SNAAYSQLCEKLSLLKSSPSRLIEKSAYCSNENMITDKFDVVFSYCGDNVKEFILLLPY
FT                   NKSLEMHELNEQNIQYLTALNINIHKLLLSNITIEKSNLSYGYYFGCVLSNISCFESDL
FT                   SNTIFSNGEINNLFIKKSNIFGTSFTNTMIKNLRCEDIMPGRWTTQLVNKHLGYRYTGV
FT                   FKTLASIDDKPSRFEILIPLVQTLVRDNVKLNNDVYKELKKFMHDYDKTSPEMRKYLQS
FT                   INESMFLMKKISHQD"
FT   gene            complement(25221..25484)
FT                   /gene="rpsT"
FT                   /locus_tag="ECSP_0024"
FT   CDS_pept        complement(25221..25484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="ECSP_0024"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69919"
FT                   /protein_id="ACT69919.1"
FT                   /translation="MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   gene            25587..25811
FT                   /gene="yaaY"
FT                   /locus_tag="ECSP_0025"
FT   CDS_pept        25587..25811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaY"
FT                   /locus_tag="ECSP_0025"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69920"
FT                   /protein_id="ACT69920.1"
FT                   /translation="MCRHSLRSDGAGFYQLAGCEYSFSAIKIAAGSQFLPVICAMTMTM
FT                   KSHFFLISVLNRRLTLTAVQGILGRFSLF"
FT   gene            25819..26760
FT                   /gene="ribF"
FT                   /locus_tag="ECSP_0026"
FT   CDS_pept        25819..26760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ECSP_0026"
FT                   /product="bifunctional riboflavin kinase/FAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69921"
FT                   /protein_id="ACT69921.1"
FT                   /translation="MKLIRGIHNLSQAPQEGCVLTIGNFDGVHRGHRALLQGLQEEGRK
FT                   RNLPVMVMLFEPQPLELFATDKAPARLTRLREKLRYLAECGVDYVLCVRFDRRFAALTA
FT                   QNFISDLLVKHLRVKFLAVGDDFRFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVR
FT                   ISSTAVRQALADDNLALAESLLGHPFAISGRVVHGDELGRTIGFPTANVPLRRQVSPVK
FT                   GVYAVEVLGLGEKPLPGVANIGTRPTVAGIRQQLEVHLLDVAMDLYGRHIQVVLRKKIR
FT                   NEQRFASLDELKAQIARDELTAREFFGLTKPA"
FT   gene            26803..29619
FT                   /gene="ileS"
FT                   /locus_tag="ECSP_0027"
FT   CDS_pept        26803..29619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="ECSP_0027"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69922"
FT                   /protein_id="ACT69922.1"
FT                   /translation="MSDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAAK
FT                   KGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGYDSPYVPGWDCHGLPIEL
FT                   KVEQEYGKPDEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEA
FT                   NIIRALGKIIGNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFQAVDQDAL
FT                   KAKFGVSNVNGPISLVIWTTTPWTLPANRAISIAPDFDYALVQIDGQAVILAKDLVESV
FT                   MQRIGVTDYTILGTVKGAELELLRFAHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGP
FT                   DDYVIGQKYGLETANPVGPDGTYLPGTYPTLDGVNVFKANDIVVALLQEKGALLHVEKM
FT                   QHSYPCCWRHKTPIIFRATPQWFVSMDQKGLRAQSLKEIKGVQWIPDWGQARIESMVAN
FT                   RPDWCISRQRTWGVPMSLFVHKDTEELHPRTLELMEEVAKRVEVDGIQAWWDLDAKEIL
FT                   GDEADQYVKVPDTLDVWFDSGSTHSSVVDVRPEFAGHAADMYLEGSDQHRGWFMSSLMI
FT                   STAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLGADILRLWVASTDYT
FT                   GEMAVSDEILKRAADSYRRIRNTARFLLANLNGFDPAKDMVKPEEMVVLDRWAVGCAKA
FT                   AQEDILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAKADSVARRSCQTALY
FT                   HIAEALVRWMAPILSFTADEVWGYLPGEREKYVFTGEWYEGLFGLADSEAMNDAFWDEL
FT                   LKVRGEVNKVIEQARADKKVGGSLEAAVTLYTEPELAAKLTALGDELRFVLLTSGATVA
FT                   DYNDAPADAQQSEVLKGLKVALSKAEGEKCPRCWHYTQDVGKVAEHAEICGRCVSNVAG
FT                   DGEKRKFA"
FT   gene            29619..30113
FT                   /gene="lspA"
FT                   /locus_tag="ECSP_0028"
FT   CDS_pept        29619..30113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="ECSP_0028"
FT                   /product="prolipoprotein signal peptidase (signal peptidase
FT                   II)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69923"
FT                   /protein_id="ACT69923.1"
FT                   /translation="MSQSICSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVPLFPS
FT                   LNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGISVTLVVMMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK
FT                   Q"
FT   gene            30201..30650
FT                   /gene="fkpB"
FT                   /locus_tag="ECSP_0029"
FT   CDS_pept        30201..30650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="ECSP_0029"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69924"
FT                   /protein_id="ACT69924.1"
FT                   /translation="MSESVQSNSAVLVHFTLKLDDGTTAESTRNNGKPALFRLGDASLS
FT                   EGLEQHLLGLKVGDKTTFSLEPDAAFGVPSPDLIQYFSRREFMDAGEPEIGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGQTVHFDIEVLEIDPALEA"
FT   gene            30652..31602
FT                   /gene="ispH"
FT                   /locus_tag="ECSP_0030"
FT   CDS_pept        30652..31602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="ECSP_0030"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   reductase, 4Fe-4S protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69925"
FT                   /protein_id="ACT69925.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGS
FT                   KNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR
FT                   LQQLGGGEAIPLEGREENIVFEVPKELRVDIREVD"
FT   gene            31668..32582
FT                   /gene="rihC"
FT                   /locus_tag="ECSP_0031"
FT   CDS_pept        31668..32582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rihC"
FT                   /locus_tag="ECSP_0031"
FT                   /product="ribonucleoside hydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69926"
FT                   /protein_id="ACT69926.1"
FT                   /translation="MRLPIFLDTDPGIDDAVAIAAAIFAPELDLQLMTTVAGNVSVEKT
FT                   TRNALQLLHFWNAEIPLAQGAAVPLVRAPRDAASVHGESGMAGYDFVEHNRKPLGIPAF
FT                   LAIRDALMRAPEPVTLVAIGPLTNIALLLSQCPECKPYIRRLVIMGGSAGRGNCTPNAE
FT                   FNIAADPEAAACVFRSGIEIVMCGLDVTNQAILTPDYLSTLPQLNRTGKMLHALFSHYR
FT                   SGSMQSGLRMHDLCAIAWLVRPDLFTLKPCFVAVETQGEFTSGTTVVDIDGCLGKPANV
FT                   QVALDLNVKGFQQWVAEVLALVP"
FT   gene            32749..33570
FT                   /gene="dapB"
FT                   /locus_tag="ECSP_0032"
FT   CDS_pept        32749..33570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="ECSP_0032"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69927"
FT                   /protein_id="ACT69927.1"
FT                   /translation="MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLL
FT                   GSDAGELAGAGKTGVTVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTT
FT                   GFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERLEITHKASSRMTFANGAVRSALWLSGKENGLFDMRDVLDLNNL"
FT   gene            33849..33986
FT                   /locus_tag="ECSP_0033"
FT   CDS_pept        33849..33986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69928"
FT                   /protein_id="ACT69928.1"
FT                   /translation="MHEPQNNIKNPAIKLTFSAHISRMPPFARNSSVSRFALIYVIIVN
FT                   "
FT   gene            34026..35174
FT                   /gene="carA"
FT                   /locus_tag="ECSP_0034"
FT   CDS_pept        34026..35174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ECSP_0034"
FT                   /product="carbamoyl phosphate synthetase small subunit,
FT                   glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69929"
FT                   /protein_id="ACT69929.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVT
FT                   TAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQ
FT                   TSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKTAK"
FT   gene            35192..38413
FT                   /gene="carB"
FT                   /locus_tag="ECSP_0035"
FT   CDS_pept        35192..38413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="ECSP_0035"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69930"
FT                   /protein_id="ACT69930.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNAEFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLAEQGVTKEVIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKHGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQIK"
FT   gene            complement(38421..38639)
FT                   /locus_tag="ECSP_0036"
FT   CDS_pept        complement(38421..38639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0036"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69931"
FT                   /protein_id="ACT69931.1"
FT                   /translation="MTRFEAIKQGHIKIVDISIVCNFTVDKCELNPAYVIKNIDSPKDL
FT                   LNGQKKRSSSENRISYSIKLADEKYPP"
FT   gene            38674..39069
FT                   /gene="caiF"
FT                   /locus_tag="ECSP_0037"
FT   CDS_pept        38674..39069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiF"
FT                   /locus_tag="ECSP_0037"
FT                   /product="transcriptional regulator of cai operon"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69932"
FT                   /protein_id="ACT69932.1"
FT                   /translation="MCEGYVEKPLYLLIAEWMMAENRWVIAREISIHFDIEHSKAVNTL
FT                   TYILSEVTEISCEVKMIPNKLEGRGCQCQRLVKVVDIDEQIYARLRNNSREKLVGVRKT
FT                   PRIPAVPLTELNREQKWQMMLSKSMRR"
FT   gene            complement(39188..39778)
FT                   /gene="caiE"
FT                   /locus_tag="ECSP_0038"
FT   CDS_pept        complement(39188..39778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="ECSP_0038"
FT                   /product="predicted acyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69933"
FT                   /protein_id="ACT69933.1"
FT                   /translation="MSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLIVQAGANIQDGCIMHGYTDTDTIVGENGHIGHGAILHGCVIGRDALVGMNSVIM
FT                   DGAVIGEESIVAAMSFVKAGFHGEKRQLLMGTPARAVRSVSDDELHWKRLNTKEYQDLV
FT                   GRCHASLHETQPLRQMEENRPRLQGTTDVTPKR"
FT   gene            complement(39784..40569)
FT                   /gene="caiD"
FT                   /locus_tag="ECSP_0039"
FT   CDS_pept        complement(39784..40569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="ECSP_0039"
FT                   /product="crotonobetainyl CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69934"
FT                   /protein_id="ACT69934.1"
FT                   /translation="MSESLHLTRNGSILEITLDRPKANAIDAKTSFEMGEVFLNFRDDP
FT                   QLRVAIITGAGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFNLDKPVIAAVNGY
FT                   AFGGGFELALAADFIVCADNASFALPEAKLGIVPDSGGVLRLPKILPPAIVNEMVMTGR
FT                   RMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAALKEIYRTTSEMPVEES
FT                   YSYIRSGVLKHYPSVLHSEDAIEGPLAFAEKRDPVWKGR"
FT   gene            complement(40678..42231)
FT                   /gene="caiC"
FT                   /locus_tag="ECSP_0040"
FT   CDS_pept        complement(40678..42231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="ECSP_0040"
FT                   /product="predicted crotonobetaine CoA ligase:carnitine CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69935"
FT                   /protein_id="ACT69935.1"
FT                   /translation="MDIIGGQHLRQMWDDLADVYGHKTALICESSGGVVNRYSYLELNQ
FT                   EINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLREESAWI
FT                   LQNSQACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSSFTQLKNQQPAT
FT                   LCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQCALRDDDVYLTVMP
FT                   AFHIDCQCTAAMAAFSAGATFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQPP
FT                   SANDRQHRLREVMFYLNLSEQEKDTFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWP
FT                   SIGRAGFCYDAEIRDDHNRPLPAGEIGEICIKGVPGKTIFKEYFLNPKATAKVLEADGW
FT                   LHTGDTGYRDEEGFFYFIDRRCNMIKRGGENVSCVELENIIATHPKIQDIVVVGIKDSI
FT                   RDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSYLEIRKDLPRNCSGKIIRKNLK
FT                   "
FT   gene            complement(42305..43522)
FT                   /gene="caiB"
FT                   /locus_tag="ECSP_0041"
FT   CDS_pept        complement(42305..43522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="ECSP_0041"
FT                   /product="crotonobetainyl CoA:carnitine CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69936"
FT                   /protein_id="ACT69936.1"
FT                   /translation="MDHLPMPKFGPLAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIEN
FT                   VAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARR
FT                   GITDEVLWQHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQPMPA
FT                   FPYTADYFSGLTATTAALAALHKARETGKGESIDIAMYEVMLRMGQYFMMDYFNGGEMC
FT                   PRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGTPEIPEGTQLI
FT                   HRIECPYGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESI
FT                   TQWQTMDGRTCKGPNIMPKFKNNPGQIWRGMPSHGMDTAAILKNIGYSENDIQELVSKG
FT                   LAKVED"
FT   gene            complement(43651..44793)
FT                   /gene="caiA"
FT                   /locus_tag="ECSP_0042"
FT   CDS_pept        complement(43651..44793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="ECSP_0042"
FT                   /product="crotonobetaine reductase subunit II, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69937"
FT                   /protein_id="ACT69937.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLDAGFVTLAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRRNGKIYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKPGIKVTKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLYEAAWKADNGTITSGDAAMCKYFCANAAFEVVDSAMQVLGGVG
FT                   IAGNHRISRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   gene            complement(44824..46338)
FT                   /gene="caiT"
FT                   /locus_tag="ECSP_0043"
FT   CDS_pept        complement(44824..46338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="ECSP_0043"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69938"
FT                   /protein_id="ACT69938.1"
FT                   /translation="MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGNEPPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKELGLAYSLFLWGPLPWATYSFLSVAFAYFFFV
FT                   RKMEVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMYLPRMLFYTDPIAKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVMGLTASTWILWTVLGSNTLLLIDKNIINIPNLIEQYGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREVRDGEEPPLLVRIGWSILVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD"
FT   gene            46812..47582
FT                   /gene="fixA"
FT                   /locus_tag="ECSP_0044"
FT   CDS_pept        46812..47582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="ECSP_0044"
FT                   /product="predicted electron transfer flavoprotein subunit,
FT                   ETFP adenine nucleotide-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69939"
FT                   /protein_id="ACT69939.1"
FT                   /translation="MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAA
FT                   CQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASAL
FT                   AAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVEREL
FT                   EDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAEAAWSEQ
FT                   QVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
FT   gene            47597..48538
FT                   /gene="fixB"
FT                   /locus_tag="ECSP_0045"
FT   CDS_pept        47597..48538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="ECSP_0045"
FT                   /product="predicted electron transfer flavoprotein, NAD"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69940"
FT                   /protein_id="ACT69940.1"
FT                   /translation="MNTFSQVWVFSDTPSRLPELMNGAQALANQINAFVLNDADGAQAI
FT                   QLGANHVWKLNGKPDDRMIEDYASVMADTIRQHGADGLVLLPNTRRGKLLAAKLGYRLK
FT                   AAVSNDASTVSVQDGKATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPDASRTG
FT                   ETHTVEWQAPAVAITRTATQARQSNSVDLDKARLVVSVGRGIGSKENIALAEQLCKAIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANASQTIFAIN
FT                   KDKNAPIFQYADYGIVGDAVKILPALTAALAR"
FT   gene            48589..49875
FT                   /gene="fixC"
FT                   /locus_tag="ECSP_0046"
FT   CDS_pept        48589..49875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="ECSP_0046"
FT                   /product="predicted oxidoreductase with FAD/NAD(P)-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69941"
FT                   /protein_id="ACT69941.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLEHIIPGFAESAPVERLITHEKLAFMTEKSAMTMDYCNGDETSPSQRSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNLVQRDGKVVGVEADGDVIEAKTVILADGVN
FT                   SILAEKLGMAKRVKPTNVAVGVKELIELPKSVIEDRFQLQGNQGAACLFAGSPTDGLMG
FT                   GGFLYTNENTLSLGLVCGLHHLHDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYSAHVV
FT                   PEAGINMLPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAIAAGEAAAKTVLSAMKSDDF
FT                   SKQKLAEYRQHLESGPLRDMRMYQKLPAFLDNPRMFSGYPELAVGVARDLFTIDGSAPE
FT                   LMRKKILRHGKKVGFINLIKDGMKGVTVL"
FT   gene            49872..50159
FT                   /gene="fixX"
FT                   /locus_tag="ECSP_0047"
FT   CDS_pept        49872..50159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="ECSP_0047"
FT                   /product="predicted 4Fe-4S ferredoxin-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69942"
FT                   /protein_id="ACT69942.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG"
FT   gene            50217..51548
FT                   /gene="yaaU"
FT                   /locus_tag="ECSP_0048"
FT   CDS_pept        50217..51548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="ECSP_0048"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69943"
FT                   /protein_id="ACT69943.1"
FT                   /translation="MQPSRNFDDLKFSSIHRRILLWGSGGPFLDGYILVMIGVALEQLT
FT                   PALKLDADWIGLLGAGTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMFVS
FT                   SPVELLVMRVLIGIVIGADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATCADLVGY
FT                   WLYDVEGGWRWMLGSAAIPCLLILIGRFELPESPRWLLRKGRVKECEEMMIKLFGEPVA
FT                   FDEEQPQQTRFRDLFNRRHFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGLGVGKNA
FT                   ALGNVVISLFFMLGCIPPMLWLNTAGRRPLLIGSFAMMTLALAVLGLIPDMGIWLVVMA
FT                   FAVYAFFSGGPGNLQWLYPNELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFINNYGI
FT                   SNTMLMGAGISLFGLLISVAFAPETRGMSLAQTSNMTIRGQRMG"
FT   gene            51656..52186
FT                   /gene="kefF"
FT                   /locus_tag="ECSP_0049"
FT   CDS_pept        51656..52186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="ECSP_0049"
FT                   /product="flavoprotein subunit for the KefC potassium
FT                   efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69944"
FT                   /protein_id="ACT69944.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMFEQARTLEGVEIRSLYQLYPDFNID
FT                   IAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGESHFEIGAHPGFDVLSQPLQATAIYCGLNWLPPFAMHCTFICDDETLEGQARHY
FT                   KQRLLEWQEAHHG"
FT   gene            52179..54041
FT                   /gene="kefC"
FT                   /locus_tag="ECSP_0050"
FT   CDS_pept        52179..54041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="ECSP_0050"
FT                   /product="potassium:proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69945"
FT                   /protein_id="ACT69945.1"
FT                   /translation="MDSHTLVQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFIIGLELDPQRLWKLRAAVFGGGALQMVICGGLLGLF
FT                   CMLLGLRWQVAELIGMTLALSSTAIAMQAMNERNLMVTQMGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASSASTTMGAFALSALKVAGALVLVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLIENPLRIVILLLGFLIIKIAMLWLIARPLQVPNKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMANVLEPEWAKSLTLAVALSMAATPILLVILNRLEQSSTEEAREADEIDEEQ
FT                   PRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYICLRQAGVEKPERE
FT                   TFEGALKTGRLALESLGLGPYEARERADVFRRFNIQMVEEMAMVENDTKARAAVYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTEEGKHTGNMADEPETKPSS"
FT   gene            54233..54712
FT                   /gene="folA"
FT                   /locus_tag="ECSP_0051"
FT   CDS_pept        54233..54712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="ECSP_0051"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69946"
FT                   /protein_id="ACT69946.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRH
FT                   TRESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   gene            54798..55031
FT                   /locus_tag="ECSP_0052"
FT   CDS_pept        54798..55031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0052"
FT                   /product="putative antitoxin of gyrase inhibiting
FT                   toxin-antitoxin system"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69947"
FT                   /protein_id="ACT69947.1"
FT                   /translation="MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHA
FT                   ATRWREENAEAIAALNQLADETGCFSDEYRSF"
FT   gene            55034..55348
FT                   /locus_tag="ECSP_0053"
FT   CDS_pept        55034..55348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0053"
FT                   /product="putative toxin of gyrase inhibiting
FT                   toxin-antitoxin system"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69948"
FT                   /protein_id="ACT69948.1"
FT                   /translation="MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFSR
FT                   IRPPERLNPILLLVDGKEYVLMTHETATVPVNALGTKFCDASAHRTLIKGALDFMLDGI
FT                   "
FT   gene            complement(55345..56193)
FT                   /gene="apaH"
FT                   /locus_tag="ECSP_0054"
FT   CDS_pept        complement(55345..56193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="ECSP_0054"
FT                   /product="diadenosine tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69949"
FT                   /protein_id="ACT69949.1"
FT                   /translation="MATYLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLQIDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELRGLGRLRFITNAFTRMRFCFPNGQLDMYSKESPEEAPAPLKPWFAIPGPVAEEYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGSLTCLRWEDKQYFVQPSNRHKDLGEGEAVA
FT                   S"
FT   gene            complement(56200..56577)
FT                   /gene="apaG"
FT                   /locus_tag="ECSP_0055"
FT   CDS_pept        complement(56200..56577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="ECSP_0055"
FT                   /product="protein associated with Co2+ and Mg2+ efflux"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69950"
FT                   /protein_id="ACT69950.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDE
FT                   NGVPFSIDIPVFRLAVPTLIH"
FT   gene            complement(56580..57401)
FT                   /gene="ksgA"
FT                   /locus_tag="ECSP_0056"
FT   CDS_pept        complement(56580..57401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="ECSP_0056"
FT                   /product="S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
FT                   dimethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69951"
FT                   /protein_id="ACT69951.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTFNFGELAEKM
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCNVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPHPVKDVRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVEVLTGMGIDPAMRAENISVAQYCQMANYLAENAPFQES"
FT   gene            complement(57398..58387)
FT                   /gene="pdxA"
FT                   /locus_tag="ECSP_0057"
FT   CDS_pept        complement(57398..58387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="ECSP_0057"
FT                   /product="4-hydroxy-L-threonine phosphate dehydrogenase,
FT                   NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69952"
FT                   /protein_id="ACT69952.1"
FT                   /translation="MVKTQRVVITPGEPAGIGPDLVVQLAQREWPVELVVCADATLLTD
FT                   RAAMLGLPLTLRPYSPNSPAQPQTTGTLTLLPVALRESVTAGQLAIENGHYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRDIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGEADVGSFITALNLAIKMIVNTQ"
FT   gene            complement(58387..59673)
FT                   /gene="surA"
FT                   /locus_tag="ECSP_0058"
FT   CDS_pept        complement(58387..59673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="ECSP_0058"
FT                   /product="peptidyl-prolyl cis-trans isomerase (PPIase)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69953"
FT                   /protein_id="ACT69953.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIA
FT                   KQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQ
FT                   VGNQNDASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSAD
FT                   QQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNIS
FT                   VTEVHARHILLKPSPIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAASWMQEQRASAYVKILSN"
FT   gene            complement(59726..62080)
FT                   /gene="imp"
FT                   /locus_tag="ECSP_0059"
FT   CDS_pept        complement(59726..62080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="ECSP_0059"
FT                   /product="exported protein required for envelope
FT                   biosynthesis and integrity"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69954"
FT                   /protein_id="ACT69954.1"
FT                   /translation="MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQG
FT                   DTNDLPVTINANHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVSIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQ
FT                   AGAGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYF
FT                   NDFDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYY
FT                   QNDVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHY
FT                   QQTNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYV
FT                   PYRDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFN
FT                   ISVGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNV
FT                   ATSNSSIEYRRDEDRLVQLNYRYASPEYIQATLPKYYSTAEQYKNGISQVGAVASWPIA
FT                   DRWSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIG
FT                   FNIELRGLSSNYGLGTQEMLRSNILPYQNTL"
FT   gene            62335..63150
FT                   /gene="djlA"
FT                   /locus_tag="ECSP_0060"
FT   CDS_pept        62335..63150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="ECSP_0060"
FT                   /product="DnaJ-like membrane chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69955"
FT                   /protein_id="ACT69955.1"
FT                   /translation="MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGI
FT                   SRAQFDQFLRMMQGGAQFGGGYQQQSGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK"
FT   gene            63445..64182
FT                   /gene="espY1"
FT                   /locus_tag="ECSP_0061"
FT   CDS_pept        63445..64182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY1"
FT                   /locus_tag="ECSP_0061"
FT                   /product="non-LEE-encoded type III secreted effector"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69956"
FT                   /protein_id="ACT69956.1"
FT                   /translation="MKVSVPGMPATLLNMSNNDIYKMVSGDKMDMKMNIFQRLWETLRH
FT                   LFWSDKQTEAYKLLFNFVNKKAGNINASKYFTGAVNENEKEKFIHSLELFNELKTCAKN
FT                   PDEMVAKGNMSWVAQTFGDIELSVTFFIENKEICTQTLQLHKGPGNLGVDLREAYLPGV
FT                   DMRDCYLGLKTMKGHNKVLYLEPGWNANLDGATLDGATVDGATHLYDEVIIINKITPKK
FT                   IDTEEVATKQSTAEQITDNAIIE"
FT   gene            complement(64600..65259)
FT                   /gene="rluA"
FT                   /locus_tag="ECSP_0062"
FT   CDS_pept        complement(64600..65259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="ECSP_0062"
FT                   /product="Ribosomal large subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69957"
FT                   /protein_id="ACT69957.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDDHIMVVNKPSGLLSVPGRLEEHKDS
FT                   VMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFRERVPKKQYVTRVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEARAMAPRLLLHAEMLTITHPAYGNSMTFKAPADF"
FT   gene            complement(65271..68177)
FT                   /gene="hepA"
FT                   /locus_tag="ECSP_0063"
FT   CDS_pept        complement(65271..68177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="ECSP_0063"
FT                   /product="RNA polymerase-associated helicase protein
FT                   (ATPase and RNA polymerase recycling factor)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69958"
FT                   /protein_id="ACT69958.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAVDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHDGWQMQVEEVKEENGLLTYIGTRLDTEESGVALREVFLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKYSSEQFRMPYSGLRGQRTSLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYAEAQHDAYNPFDTEQLVICSLDFARRSKQRLEHLCEAEWDLLVVDE
FT                   AHHLVWSEDAPSREYQAIEQLAEHVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFA
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNMLGEMIGEQDIEPLLQAANSDSEDAQSA
FT                   RQELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPERIYQEFEGDNATWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   HMVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRTIYDSVYNDLINYLASPDQTEGFDDLIKNCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQALAESIEEQDDDTNLIAFAMNLFDIIGINQDDRGDNMIVLTPSDHMLVPDFPG
FT                   LSEDGITITFDREVALAREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELIYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLNAVNRH
FT                   TGSKLVNAVQQDVHAILQLGEAQIEKSARALIDAARNEADEKLSAELSRLEALRAVNPN
FT                   IRDDELTAIESNRQQVMESLDQAGWRLDALRLIVVTHQ"
FT   gene            complement(68341..70692)
FT                   /gene="polB"
FT                   /locus_tag="ECSP_0064"
FT   CDS_pept        complement(68341..70692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="ECSP_0064"
FT                   /product="DNA polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69959"
FT                   /protein_id="ACT69959.1"
FT                   /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPLQVTLAPQESVAFI
FT                   PADQVPRAQHILRGEQGFRLTPLALKDFHRQPVYGLYCRAHRQLMNYEKRLREGGVTVY
FT                   EADVRPPERYLMERFITSPVWVEGDMHNGAIVNARLKPHPDYRPPLKWVSIDIETTRHG
FT                   ELYCIGLEGCGQRIVYMLGPENGDASALDFELEYVASRPQLLEKLNAWFANYDPDVIIG
FT                   WNVVQFDLRMLQKHAERYRIPLRLGRDNSELEWREHGFKNGVFFAQAKGRLIIDGIEAL
FT                   KSAFWNFSSFSLETVAQELLGEGKSIDNPWDRMDEIDRRFAEDKPALATYNLKDCELVT
FT                   QIFHKTEIMPFLLERATVNGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPHAS
FT                   PGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAW
FT                   FSREKHCLPEIVTNIWHGRDEAKRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLVS
FT                   SITMRGHQIMRQTKALIEAQGYDVIYGDTDSTFVWLKGAHSEEEATKIGRALVQHVNVW
FT                   WAETLQKQQLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGLIQEGDKQRMVFKGLE
FT                   TVRTDWTPLAQQFQQELYLRIFRNEPYQEYFRETIDKLMAGELDARLVYRKRLRRPLSE
FT                   YQRNVPPHVRAARLADEENQKRGRPLQYQNRGTIKYVWTTNGPEPLDYQRSPLDYEHYL
FT                   TRQLQPVAEGILPFIEDNFATLMTGQLGLF"
FT   gene            complement(70767..71462)
FT                   /gene="araD"
FT                   /locus_tag="ECSP_0065"
FT   CDS_pept        complement(70767..71462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="ECSP_0065"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69960"
FT                   /protein_id="ACT69960.1"
FT                   /translation="MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSG
FT                   VDYSIMTADDMVVVSIETGEVVEGAKKPSSDTPTHRLLYQAFPSIGGIVHTHSRHATIW
FT                   AQAGQSIPATGTTHADYFYGTIPCTRKMTDAEINGEYEWETGNVIVETFEKQGIDAAQM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQTLLDKHYLRK
FT                   HGAKAYYGQ"
FT   gene            complement(71662..73164)
FT                   /gene="araA"
FT                   /locus_tag="ECSP_0066"
FT   CDS_pept        complement(71662..73164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="ECSP_0066"
FT                   /product="L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69961"
FT                   /protein_id="ACT69961.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVKALNTEAKLP
FT                   CKLVLKPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSW
FT                   MRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIS
FT                   DGDVNALVDEYESCYTMTPATQIHGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFE
FT                   KGNDLVLGSHMLEVCPSIAAEEKPILDVQHLGIGGKDDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALN
FT                   LNDMRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR"
FT   gene            complement(73175..74875)
FT                   /gene="araB"
FT                   /locus_tag="ECSP_0067"
FT   CDS_pept        complement(73175..74875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="ECSP_0067"
FT                   /product="L-ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69962"
FT                   /protein_id="ACT69962.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCTTGEEIATSVEWYPRWQKGQFCDA
FT                   PNNQFRHHPRDYIESMEAALKTVLAELSVEQRAAVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFAENPNAMFVLWKDHTAVEEAEEITRLCHAPGNVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDSAVAQSAASWIELCDWVPALLSGTTRPQDIRRGRCSAGHKSLWHESWGGLPPASF
FT                   FDELDPILNRHLPSPLFTDTWTADIPVGTLCPEWAQRLGLPESVVISGGAFDCHMGAVG
FT                   AGAQPNALVKVIGTSTCDILIADKQSVGERAVKGICGQVDGSVVPGFIGLEAGQSAFGD
FT                   IYAWFGRVLGWPLEQLAAQHPELKEQIDASQKQLLPALTEAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPLLFGGLIAATAFGARAIMECFTDQGIAVNNVMAL
FT                   GGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPSAQQKMASA
FT                   VEKTLQPRSEQAQRFEQLYRRYQQWAMSAEQHYLPTSAPAQAAQAVPTL"
FT   gene            75214..76092
FT                   /gene="araC"
FT                   /locus_tag="ECSP_0068"
FT   CDS_pept        75214..76092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="ECSP_0068"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69963"
FT                   /protein_id="ACT69963.1"
FT                   /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW
FT                   HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
FT                   MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
FT                   EKVNDVAVKLS"
FT   gene            76178..76942
FT                   /gene="yabI"
FT                   /locus_tag="ECSP_0069"
FT   CDS_pept        76178..76942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="ECSP_0069"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69964"
FT                   /protein_id="ACT69964.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLVRHPLMPVYIDILRKVVGV"
FT   gene            complement(77029..77727)
FT                   /gene="thiQ"
FT                   /locus_tag="ECSP_0070"
FT   CDS_pept        complement(77029..77727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="ECSP_0070"
FT                   /product="ATP-binding component of thiamin ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69965"
FT                   /protein_id="ACT69965.1"
FT                   /translation="MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLTPASGALTIDGVDHTTTPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNA
FT                   VQQEKMHAIARQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPA
FT                   LRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTNELLSGKA
FT                   SASALLGITG"
FT   gene            complement(77711..79321)
FT                   /gene="thiP"
FT                   /locus_tag="ECSP_0071"
FT   CDS_pept        complement(77711..79321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="ECSP_0071"
FT                   /product="membrane component of thiamin ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69966"
FT                   /protein_id="ACT69966.1"
FT                   /translation="MATRRQPLIPGWLIPGVSAATLVVAVALAAFLALWWNAPQGDWSA
FT                   VWQDSYLWHVVRFSFWQAFLSALLSVVPAIFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLCQSLGLEWTFSPYGLQGILLAHVFFNLPMASRLLLQALE
FT                   NIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVTALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDPARAAMLALIQMVCCLGLVLLSQRLSKAIAPGTTLLQGWRDP
FT                   DDRLHSRICDTMLIVLALLLLLPPLLAVIVDGVNRQLPEVLAQPVLWQALWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRARQKMLAGQALEMSGMLILAMPGIVLATGFFLLLNNTIG
FT                   LPQSADGIVIFTNALMAIPYALKVLENPMRDITARYSMLCQSLGIEGWSRLKVVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDDFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFLLFSVIEKIPGRNVKTD"
FT   gene            complement(79297..80280)
FT                   /gene="tbpA"
FT                   /locus_tag="ECSP_0072"
FT   CDS_pept        complement(79297..80280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="ECSP_0072"
FT                   /product="periplasmic-binding component of thiamin ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69967"
FT                   /protein_id="ACT69967.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDIFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
FT   gene            80652..81221
FT                   /gene="espY2"
FT                   /locus_tag="ECSP_0073"
FT   CDS_pept        80652..81221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY2"
FT                   /locus_tag="ECSP_0073"
FT                   /product="non-LEE-encoded type III secreted effector"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69968"
FT                   /protein_id="ACT69968.1"
FT                   /translation="MKVRNPEQISIPASNTTKDPGLTNSQIIRMANLVKKTENMNIFEE
FT                   LWETLRNLFQSDKHSQTAARQILKDAFYFQNSDDYSKYFTGAVDGKARDKLTHWLIKFN
FT                   ELKEYAKDPENMAAKASLSPEGTLCVSFFIGDEAIFTLELQLKKSTRTGGIDLSNAYFN
FT                   GVVICGIDCLEVDLSNAETNNSRWYD"
FT   gene            complement(81450..83108)
FT                   /gene="sgrR"
FT                   /locus_tag="ECSP_0074"
FT   CDS_pept        complement(81450..83108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgrR"
FT                   /locus_tag="ECSP_0074"
FT                   /product="DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69969"
FT                   /protein_id="ACT69969.1"
FT                   /translation="MPSARLQQQFIRLWQCCEGKSQDTTLNELAALLSCSRRHMRTLLN
FT                   TMQDRGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKATVR
FT                   QMLVSHLGRSFRQGRHILRVLYYRPLRNLLPGSALRRSETHIARQIFSSLTRINEENGE
FT                   LEADIAHHWQQISPLHWRFFLRPGVHFHHGRELEMDDVIASLKRINTLPLYSHIADIVS
FT                   PTPWTLDIHLTQPDRWLPLLLGQVPAMILPREWETLSNFASHPIGTGPYAVIRNSTNQL
FT                   KIQAFDDFFGYRALIDEVNVWVLPEIADEPAGGLMLKGPQGEEKEIESRLEEGCYYLLF
FT                   DSRTHRGANQQVRDWVSYVLSPTNLVYFAEEQYQQLWFPAYGLLPRWHHARTITSEKPA
FT                   GLESLTLTFYQDHSEHRVIAGIMQQILASHQVTLEIKEISYDQWHEGEIESDIWLNSAN
FT                   FTLPLDFSLFAHLCEVPLLQHCIPIDWQVDAARWRNGEMNLANWCQQLVASKAMVPLIH
FT                   HWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDPE"
FT   gene            complement(83436..84041)
FT                   /gene="leuD"
FT                   /locus_tag="ECSP_0075"
FT   CDS_pept        complement(83436..84041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="ECSP_0075"
FT                   /product="3-isopropylmalate isomerase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69970"
FT                   /protein_id="ACT69970.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFSQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIAAYEAKQPAFMR"
FT   gene            complement(84052..85452)
FT                   /gene="leuC"
FT                   /locus_tag="ECSP_0076"
FT   CDS_pept        complement(84052..85452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="ECSP_0076"
FT                   /product="3-isopropylmalate isomerase subunit, dehydratase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69971"
FT                   /protein_id="ACT69971.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQA
FT                   EEISPQVTWGTNPGQVISVNDNIPDPASFADPVERASAEKALAYMGLKPGILLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRNIK"
FT   gene            complement(85455..86546)
FT                   /gene="leuB"
FT                   /locus_tag="ECSP_0077"
FT   CDS_pept        complement(85455..86546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="ECSP_0077"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69972"
FT                   /protein_id="ACT69972.1"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMTQALKVLDAVRNRFAMRITTSHYDV
FT                   GGAAIDNHGQPLPPATVEGCEQADAVLFGSVGGPKWEHLPPDQQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAFD
FT                   TEVYHRFEIERIARIAFESARKRRHKVTSIDKANVLQSSILWREIVNEIATEYPDIELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDADDAASAIERAINRALEEGIRTGDLA
FT                   RGAAAVSTDEMGDIIARYVAEGV"
FT   gene            complement(86546..88117)
FT                   /gene="leuA"
FT                   /locus_tag="ECSP_0078"
FT   CDS_pept        complement(86546..88117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="ECSP_0078"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69973"
FT                   /protein_id="ACT69973.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARQVKNSRVCALARCVEKDIDVAAESLKVAEAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIADLARVVEAAINAGA
FT                   TTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGLAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCSLEEVIMAIKVRKDILNVHTAINHQEIWRTSQLVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MDEMGYKESEYNLDNLYDAFLKLADKKGQVFDYDLEALAFIGKQQEEPEHFRLDYFSVQ
FT                   SGSNDIATAAVKLACGEEVKAEAANGNGPVDAVYQAINRITDYNVELVKYSLTAKGHGK
FT                   DALGQVDIVANYNGRRFHGVGLATDIVESSAKAMVHVLNNIWRATEVEKELQRKAQHNE
FT                   NNKETV"
FT   gene            complement(88210..88296)
FT                   /gene="leuL"
FT                   /locus_tag="ECSP_0079"
FT   CDS_pept        complement(88210..88296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuL"
FT                   /locus_tag="ECSP_0079"
FT                   /product="leu operon leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69974"
FT                   /protein_id="ACT69974.1"
FT                   /translation="MTHIVRFIGLLLLNASSLRGRRVSGIQH"
FT   gene            88954..89898
FT                   /gene="leuO"
FT                   /locus_tag="ECSP_0080"
FT   CDS_pept        88954..89898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="ECSP_0080"
FT                   /product="DNA-binding transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69975"
FT                   /protein_id="ACT69975.1"
FT                   /translation="MPEVQTDHPETAEFSKPQLRMVDLNLLTVFDAVMQEQNITRAAHV
FT                   LGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPGSG
FT                   FEPASSERVFHLCVCSPLDSILTSQIYNHIEQIAPNIHVMFKSSLNQNTEHQLRYQETE
FT                   FVISYEDFHRPEFTSVPLFKDEMVLVASKNHPTIKGPLLKHDVYNEQHAAVSLDRFASF
FT                   SQPWYDTVDKQASIAYQGMAMMSVLSVVSQTHLVAIAPRWLAEEFAESLELQVLPLPLK
FT                   LNSRTCYLSWHEAAGRDKGHQWMEEQLVSICKR"
FT   gene            90216..91940
FT                   /gene="ilvI"
FT                   /locus_tag="ECSP_0081"
FT   CDS_pept        90216..91940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="ECSP_0081"
FT                   /product="acetolactate synthase III, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69976"
FT                   /protein_id="ACT69976.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIGH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPANKLPYVWPESVSMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAITAGC
FT                   HQQLKETVEALNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESA
FT                   HQPLDEIRDWWQQIEQWRARQCLKYDTHSEKIKPQAVIETLWRLTKGGAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVVNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQ
FT                   ISHPQELESKLSEALEQVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
FT   gene            91943..92434
FT                   /gene="ilvH"
FT                   /locus_tag="ECSP_0082"
FT   CDS_pept        91943..92434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="ECSP_0082"
FT                   /product="acetolactate synthase III, thiamin-dependent,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69977"
FT                   /protein_id="ACT69977.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLYKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
FT   gene            92614..93618
FT                   /gene="fruR"
FT                   /locus_tag="ECSP_0083"
FT   CDS_pept        92614..93618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="ECSP_0083"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69978"
FT                   /protein_id="ACT69978.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDNELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS"
FT   gene            94220..94678
FT                   /gene="mraZ"
FT                   /locus_tag="ECSP_0084"
FT   CDS_pept        94220..94678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="ECSP_0084"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69979"
FT                   /protein_id="ACT69979.1"
FT                   /translation="MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWHQQVKEDIDAEQLATGDLSERLQDLSL"
FT   gene            94680..95621
FT                   /gene="mraW"
FT                   /locus_tag="ECSP_0085"
FT   CDS_pept        94680..95621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="ECSP_0085"
FT                   /product="S-adenosyl-dependent methyltransferase activity
FT                   on membrane-located substrates"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69980"
FT                   /protein_id="ACT69980.1"
FT                   /translation="MMENYKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAKTIDDPRFSIIHGPFSALGEYVAERDLIGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTYGEERFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLNVLAPGGRLSIISFHSLEDRIVKRFMRENSRGPQVPAGLPMTEEQLKKLGGRQL
FT                   RALGKLMPGEEEVAENPRARSSVLRIAERTNA"
FT   gene            95618..95983
FT                   /gene="ftsL"
FT                   /locus_tag="ECSP_0086"
FT   CDS_pept        95618..95983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ECSP_0086"
FT                   /product="membrane bound cell division protein at septum
FT                   containing leucine zipper motif"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69981"
FT                   /protein_id="ACT69981.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   gene            95999..97765
FT                   /gene="ftsI"
FT                   /locus_tag="ECSP_0087"
FT   CDS_pept        95999..97765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ECSP_0087"
FT                   /product="transpeptidase involved in septal peptidoglycan
FT                   synthesis (penicillin-binding protein 3)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69982"
FT                   /protein_id="ACT69982.1"
FT                   /translation="MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWL
FT                   QVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERV
FT                   FPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEF
FT                   VINQGEGTGGRS"
FT   gene            97752..99239
FT                   /gene="murE"
FT                   /locus_tag="ECSP_0088"
FT   CDS_pept        97752..99239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="ECSP_0088"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-di
FT                   aminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69983"
FT                   /protein_id="ACT69983.1"
FT                   /translation="MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKGEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHE
FT                   PSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHELAGLVDQDATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYE
FT                   AAKWLLYSEHHCGQAIINADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNY
FT                   HDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADVAVVTDDNPRTEEPRAIINDILAGMLDAGHAKVMEDRAEAVTCAVMQAKEN
FT                   DVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLLGVIA"
FT   gene            99236..100594
FT                   /gene="murF"
FT                   /locus_tag="ECSP_0089"
FT   CDS_pept        99236..100594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ECSP_0089"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanin
FT                   e ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69984"
FT                   /protein_id="ACT69984.1"
FT                   /translation="MISVTLSQLTDILNGELQGADITLDAVTTDTRKLTPGCLFVALKG
FT                   ERFDAHDFADQAKAGGAGALLVSRPLDIDLPQLIVKDTRLAFGELAAWVRQQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNLNNDIGVPMTLLRLTPEYDYAVIELGANH
FT                   QGEIVWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIMNADNN
FT                   DWLNWQSVIGSRKVWRFSPNAANSDFTATNIHVTSHGTEFTLQTPTGSVDVLLPLPGRH
FT                   NIANALAAAALSMSVGATLDAIKAGLANLKAVPGRLFPIQLAENQLLLDDSYNANVGSM
FT                   TAAVQVLAEMPGYRVLVVGDMAELGAESEACHVQVGEAAKAAGIDRVLSVGKQSHAIST
FT                   ASGVGEHFAEKTALITRLKSLIAEQQVITILVKGSRSAAMEEVVRALQENGTC"
FT   gene            100588..101670
FT                   /gene="mraY"
FT                   /locus_tag="ECSP_0090"
FT   CDS_pept        100588..101670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="ECSP_0090"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69985"
FT                   /protein_id="ACT69985.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   AHLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LVGYGVIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQLVVP
FT                   FFKDVMPQLGLFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNM
FT                   NFASYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            101673..102989
FT                   /gene="murD"
FT                   /locus_tag="ECSP_0091"
FT   CDS_pept        101673..102989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="ECSP_0091"
FT                   /product="UDP-N-acetylmuramoyl-L-alanine:D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69986"
FT                   /protein_id="ACT69986.1"
FT                   /translation="MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLD
FT                   KLPEAVERHTGSLNDEWLMAADLIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDDECELYVLELSSFQ
FT                   LETTSSLQAVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADDALTMPIR
FT                   GADERCVSFGVNMGDYHLNHQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AAGLPRASSLKALTTFTGLPHRFEVVLEHNGVRWINDSKATNVGSTEAALNGLHVDGTL
FT                   HLLLGGDGKSADFSPLARYLNGDNVRLYCFGRDGVQLAALRPEVAEQTETMEQAMRLLA
FT                   PRVQPGDMVLLSPACASLDQFKNFEQRGNEFARLAKELG"
FT   gene            102989..104233
FT                   /gene="ftsW"
FT                   /locus_tag="ECSP_0092"
FT   CDS_pept        102989..104233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ECSP_0092"
FT                   /product="cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69987"
FT                   /protein_id="ACT69987.1"
FT                   /translation="MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTDSLIMYD
FT                   RTLLWLTFGLAAIGFIMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPM
FT                   EFWQRYSATMLLGSIILLMIVLVVGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANY
FT                   LVRKGDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDY
FT                   ETRLEKAQAFVRGSR"
FT   gene            104230..105297
FT                   /gene="murG"
FT                   /locus_tag="ECSP_0093"
FT   CDS_pept        104230..105297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ECSP_0093"
FT                   /product="UDP-N-acetylglucosamine:N-acetylmuramyl-(pentapep
FT                   tide) pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69988"
FT                   /protein_id="ACT69988.1"
FT                   /translation="MSAQGKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRM
FT                   EADLVPKHGIEIDFIRISGLRGKGIKALIAAPLRIFNAWRQARAIMKAYKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATKVMQAFPGAFPNAEVVGNPVR
FT                   TDVLALPLPQQRLAGREGPVRVLVVGGSQGARILNQTMPQVAAKLGDSVTIWHQSGKGS
FT                   QQSVEQAYAEAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPF
FT                   QHKDRQQYWNALPLEKAGAAKIIEQPQLSVDAVANTLAGWSRETLLTMAERARAASIPD
FT                   ATERVANEVSRAARA"
FT   gene            105351..106826
FT                   /gene="murC"
FT                   /locus_tag="ECSP_0094"
FT   CDS_pept        105351..106826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="ECSP_0094"
FT                   /product="UDP-N-acetylmuramate:L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69989"
FT                   /protein_id="ACT69989.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLMNLGATIYFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHGRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYQGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQDKEP
FT                   MRVTLNAPGRHNALNAAAAVAVATEEGIDDEAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKSGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRFTRTRDLYDDFANVLT
FT                   QVDTLLMLEVYPAGEAPIPGADSRSLCRTIRGRGKIDPILVPDPAQVAEMLAPVLTGND
FT                   LILVQGAGNIGKIARSLAEIKLKPQTPEEEQHD"
FT   gene            106819..107739
FT                   /gene="ddlB"
FT                   /locus_tag="ECSP_0095"
FT   CDS_pept        106819..107739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="ECSP_0095"
FT                   /product="D-alanine:D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69990"
FT                   /protein_id="ACT69990.1"
FT                   /translation="MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEV
FT                   DVTQLKSMGFQKVFIALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLW
FT                   QGAGLPVAPWVALTRVEFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENAL
FT                   QDALRLAFQHDEEVLIEKWLSGPEFTVAILGEEILPSVRIQPSGTFYDYEAKYLSDETQ
FT                   YFCPAGLEASQEANLQALVLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILELAD"
FT   gene            107741..108571
FT                   /gene="ftsQ"
FT                   /locus_tag="ECSP_0096"
FT   CDS_pept        107741..108571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ECSP_0096"
FT                   /product="membrane anchored protein involved in growth of
FT                   wall at septum"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69991"
FT                   /protein_id="ACT69991.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPDRTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ"
FT   gene            108568..109830
FT                   /gene="ftsA"
FT                   /locus_tag="ECSP_0097"
FT   CDS_pept        108568..109830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ECSP_0097"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69992"
FT                   /protein_id="ACT69992.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   gene            109891..111042
FT                   /gene="ftsZ"
FT                   /locus_tag="ECSP_0098"
FT   CDS_pept        109891..111042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="ECSP_0098"
FT                   /product="GTP-binding tubulin-like cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69993"
FT                   /protein_id="ACT69993.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQ
FT                   QHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD"
FT   gene            111143..112060
FT                   /gene="lpxC"
FT                   /locus_tag="ECSP_0099"
FT   CDS_pept        111143..112060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="ECSP_0099"
FT                   /product="UDP-3-O-acyl N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69994"
FT                   /protein_id="ACT69994.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFKPYNGFSLDFTIDFNH
FT                   PAIDSSNQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEYVTFQDDAELPLAFKAPSAVLA"
FT   gene            112291..112803
FT                   /gene="secM"
FT                   /locus_tag="ECSP_0100"
FT   CDS_pept        112291..112803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secM"
FT                   /locus_tag="ECSP_0100"
FT                   /product="regulator of secA translation"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69995"
FT                   /protein_id="ACT69995.1"
FT                   /translation="MSGILTRWRQFGKRYFWPHLLLGMVAASLGLPALSNAAEPNAPAK
FT                   ATTRNHEPSAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSFAMAPQTLPV
FT                   AEESLPLQAQHLALLDTLSALLTQEGTPSEKGYRIDYAHFTPQAKFSTPVWISQAQGIR
FT                   AGPQRLS"
FT   gene            112865..115570
FT                   /gene="secA"
FT                   /locus_tag="ECSP_0101"
FT   CDS_pept        112865..115570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="ECSP_0101"
FT                   /product="preprotein translocase subunit, ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69996"
FT                   /protein_id="ACT69996.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKG
FT                   KTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVL
FT                   IEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTIS
FT                   IEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGG
FT                   SWQAEVAALENPTAEQIEKIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQLSHQDDDSAAAAALA
FT                   AQTGERKVGRNDPCPCGSGKKYKQCHGRLQ"
FT   gene            115630..116028
FT                   /gene="mutT"
FT                   /locus_tag="ECSP_0102"
FT   CDS_pept        115630..116028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="ECSP_0102"
FT                   /product="nucleoside triphosphate pyrophosphohydrolase,
FT                   marked preference for dGTP"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69997"
FT                   /protein_id="ACT69997.1"
FT                   /translation="MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGET
FT                   PEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVESWEGEPWGKEGQPGKW
FT                   MSLVGLNADDFPPANEPVIAKLKRVYVG"
FT   gene            complement(116119..116316)
FT                   /gene="yacG"
FT                   /locus_tag="ECSP_0103"
FT   CDS_pept        complement(116119..116316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="ECSP_0103"
FT                   /product="zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69998"
FT                   /protein_id="ACT69998.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSESDDWSEEPKQ"
FT   gene            complement(116326..117069)
FT                   /gene="yacF"
FT                   /locus_tag="ECSP_0104"
FT   CDS_pept        complement(116326..117069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="ECSP_0104"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACT69999"
FT                   /protein_id="ACT69999.1"
FT                   /translation="MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFR
FT                   NVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLIS
FT                   APRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDCQVETWIASLNP
FT                   LTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRF
FT                   AIRFMPLDTENGQVPERLDFELACC"
FT   gene            complement(117069..117689)
FT                   /gene="coaE"
FT                   /locus_tag="ECSP_0105"
FT   CDS_pept        complement(117069..117689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="ECSP_0105"
FT                   /product="putative DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70000"
FT                   /protein_id="ACT70000.1"
FT                   /translation="MRYIVALTGGIGSGKSTVANAFADLGINVIDADIIARQVVEPGAP
FT                   ALHAIADHFGANMIAADGTLQRRALRERIFANPEEKNWLNALLHPLIQQETQHQIQQAT
FT                   SPYVLWVVPLLVENSLYKKANRVLVVDVSPETQLKRTMQRDDVTREHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHAHYLQLASQFVSQEKP"
FT   gene            117914..118957
FT                   /gene="guaC"
FT                   /locus_tag="ECSP_0106"
FT   CDS_pept        117914..118957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="ECSP_0106"
FT                   /product="GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70001"
FT                   /protein_id="ACT70001.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWS
FT                   GVPIIAANMDTVGTFSMASALASFDILTAVHKHYSVEEWQAFINNSSADVLKHVMVSTG
FT                   TSDADFEKTKQILDLNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIISDGGC
FT                   TTPGDVAKAFGGGADFVMLGGMLAGHEESGGRIVEENGEKFMLFYGMSSESAMKRHVGG
FT                   VAEYRAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNNL"
FT   gene            complement(118992..120194)
FT                   /gene="hcpC"
FT                   /locus_tag="ECSP_0107"
FT   CDS_pept        complement(118992..120194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcpC"
FT                   /locus_tag="ECSP_0107"
FT                   /product="assembly protein in type IV pilin biogenesis,
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70002"
FT                   /protein_id="ACT70002.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQRAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWGWLLVL
FT                   FGIMLTIANKLLMRRPTWLIARQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNAGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNIAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   gene            complement(120184..121569)
FT                   /gene="hcpB"
FT                   /locus_tag="ECSP_0108"
FT   CDS_pept        complement(120184..121569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcpB"
FT                   /locus_tag="ECSP_0108"
FT                   /product="conserved protein with nucleoside triphosphate
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70003"
FT                   /protein_id="ACT70003.1"
FT                   /translation="MNIPQLTALCLRYQGVLLDASEEVVHVAVVDAPSHELLDALHFAT
FT                   TKRIEITCWTRQQMEGHASRTQQTLPVAVQEKHQPKAELLTRTLQSALEQRASDIHIEP
FT                   ADNAYRIRLRIDGVLHPLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTVELAGN
FT                   AVSFRIATLPCRGGEKVVLRLLQQVSQALDVNTLGMQPLQLAGFAHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQKLNTADINICSVEDPVEIPIAGLNQTQIHPRAGLTFQGVLRALL
FT                   RQDPDVIMIGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSS
FT                   ALTLVIAQRLVRKLCPHCRRQQGEPIHIPVNVWPSPLPHWQAPGCVHCYHGFYGRTALF
FT                   EVLPITPVIRQLISANTDVESLETHARQAGMRTLFENGCLAVEQGLTTFEELIRVLGMP
FT                   HGE"
FT   gene            complement(121579..122019)
FT                   /gene="hcpA"
FT                   /locus_tag="ECSP_0109"
FT   CDS_pept        complement(121579..122019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcpA"
FT                   /locus_tag="ECSP_0109"
FT                   /product="type IV major pilin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70004"
FT                   /protein_id="ACT70004.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWARNCNIQSDSALQQACEDVFRFDDAN"
FT   gene            complement(122222..123115)
FT                   /gene="nadC"
FT                   /locus_tag="ECSP_0110"
FT   CDS_pept        complement(122222..123115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="ECSP_0110"
FT                   /product="quinolinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70005"
FT                   /protein_id="ACT70005.1"
FT                   /translation="MPPRRYNPDTRRDELLERINLDIPGAVAQALREDLGGTVDANNDI
FT                   TAKLLPENSRSHATVITRENGVFCGKRWVEEVFIQLAGDDVTIIWHVDDGDVINANQPL
FT                   FELEGPSRVLLTGERTALNFVQTLSGVASKVRHYVELLEGTNTQLLDTRKTLPGLRSAL
FT                   KYAVLCGGGANHRLGLSDAFLIKENHIIASGSVRQAVEKASWLHPDAPVEVEVENLEEL
FT                   DEALKAGADIIMLDNFETEQMREAVKRTNGKALLEVSGNVTDKTLREFAETGVDFISVG
FT                   ALTKHVQALDLSMRFR"
FT   gene            123203..123754
FT                   /gene="ampD"
FT                   /locus_tag="ECSP_0111"
FT   CDS_pept        123203..123754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="ECSP_0111"
FT                   /product="N-acetyl-anhydromuranmyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70006"
FT                   /protein_id="ACT70006.1"
FT                   /translation="MLLEQGWLVGARRVPSPHYDCRPDDETPTLLVVHNISLPPGEFGG
FT                   PWIDALFTGTIDPQAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSQYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRALIDCYPDIANNMTGHCDIAPDRKT
FT                   DPGPAFDWARFRALVSKETT"
FT   gene            123751..124605
FT                   /gene="ampE"
FT                   /locus_tag="ECSP_0112"
FT   CDS_pept        123751..124605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="ECSP_0112"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70007"
FT                   /protein_id="ACT70007.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLG
FT                   MTIIAMGVTFLLLRALQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFRTSQYQVLTRLAQFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
FT   gene            complement(124648..126021)
FT                   /gene="aroP"
FT                   /locus_tag="ECSP_0113"
FT   CDS_pept        complement(124648..126021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="ECSP_0113"
FT                   /product="aromatic amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70008"
FT                   /protein_id="ACT70008.1"
FT                   /translation="MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINLTNVTVFGEMEFWFAIIKVIA
FT                   VVAMIIFGGWLLFSGNGGPQASVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVS
FT                   ALVTALCVLINYLAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPA
FT                   LLYPLGNWICLLFMAVVLVIMLMTPGMAISVYLIPVWLVVLGIGYLFKEKTAKAVKAH"
FT   gene            126562..127326
FT                   /gene="pdhR"
FT                   /locus_tag="ECSP_0114"
FT   CDS_pept        126562..127326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="ECSP_0114"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70009"
FT                   /protein_id="ACT70009.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQYDLLETR
FT                   HALEGIAAYYAALRSTDEDKERIRELHHAIELAQQSGDLDAESNAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYSRREMLPLVSSHRTRIFEAIMAGKPEEAREASH
FT                   RHLAFIEEILLDRSREESRRERSLRRLEQRKN"
FT   gene            127487..130150
FT                   /gene="aceE"
FT                   /locus_tag="ECSP_0115"
FT   CDS_pept        127487..130150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="ECSP_0115"
FT                   /product="pyruvate dehydrogenase, decarboxylase component
FT                   E1, thiamin-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70010"
FT                   /protein_id="ACT70010.1"
FT                   /translation="MSERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEAR
FT                   KGGVNVAAGTGISNYINTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQL
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEG
FT                   IFEGAGWNVIKVMWGSRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKIYAAFKKAQETKGKATVILAHTIKGYGMGD
FT                   AAEGKNIAHQVKKMNMDGVRHIRDRFNVPVSDADIEKLPYITFPEGSEEHTYLHAQRQK
FT                   LHGYLPSRQPNFTEKLELPSLQDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   CSWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPEGAEEGIRKGIYKLETIEGSKGKVQLLGSGSILRHVREAAEILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   IAKFNIDADKVNPRLA"
FT   gene            130165..132057
FT                   /gene="aceF"
FT                   /locus_tag="ECSP_0116"
FT   CDS_pept        130165..132057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="ECSP_0116"
FT                   /product="pyruvate dehydrogenase,
FT                   dihydrolipoyltransacetylase component E2"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70011"
FT                   /protein_id="ACT70011.1"
FT                   /translation="MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGIVKEIKVSVGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAVPEAAA
FT                   AKDVNVPDIGSDEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   TGDKVSTGSLIMVFEVAGEAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVT
FT                   EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVE
FT                   GAAPAAAPAKQEAAAPAPAAKAEAPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREF
FT                   GVNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGE
FT                   IEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKIT
FT                   PVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKK
FT                   GIIELSRELMTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVS
FT                   KSAMEPVWNGKEFVPRLMLPISLSFDHRVIDGADGARFITIINNTLSDIRRLVM"
FT   gene            132265..133689
FT                   /gene="lpd"
FT                   /locus_tag="ECSP_0117"
FT   CDS_pept        132265..133689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="ECSP_0117"
FT                   /product="lipoamide dehydrogenase, E3 component is part of
FT                   three enzyme complexes"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70012"
FT                   /protein_id="ACT70012.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVINQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRIW
FT                   DSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNPKAKKK"
FT   gene            complement(133760..135613)
FT                   /gene="yacH"
FT                   /locus_tag="ECSP_0118"
FT   CDS_pept        complement(133760..135613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="ECSP_0118"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70013"
FT                   /protein_id="ACT70013.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASAGLYIKSRTVEAPVETQSTQL
FT                   AVSDAAAVTLPATVSAPPVTPAVVKSAFSTAQIDQWVAPVALYPDALLSQVLMASTYPT
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKTVPVTQTVTAPVIPSNTVST
FT                   ANPVITEPATTVISIEPGNPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDNYHHHDGGHRDGNGWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAASQFQQRTHAAPVITRDTQRQAAAQRFNEAEHYGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAVHEKMQTNPQNQQRREAARERIQPASPEQRQAVREKMQTN
FT                   PQIQQRRDAARERIQSASPEQRQVFKEKVQQRPLNQQQRDNARQRVQSASPEQRQVFRE
FT                   KAQESRPQRLNDSNHTARLNNEQRSAVRERLSERGARRLER"
FT   gene            135968..138565
FT                   /gene="acnB"
FT                   /locus_tag="ECSP_0119"
FT   CDS_pept        135968..138565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="ECSP_0119"
FT                   /product="bifunctional aconitate hydratase 2"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70014"
FT                   /protein_id="ACT70014.1"
FT                   /translation="MLEEYRKHVAERAAEGIAPKPLDANQMAALVELLKNPPAGEEEFL
FT                   LDLLTNRVPPGVDEAAYVKAGFLAAVAKGEAKSPLLTPEKAIELLGTMQGGYNIHPLID
FT                   ALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLNRPALA
FT                   EKLTVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIEPDQPGVVGPIKQ
FT                   IEALQQKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPHVPNKRGGGLCLGGKIAPI
FT                   FFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRNHETGELLATFELKTDVLIDEVR
FT                   AGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESDRGFSLAQKMVGRACGVKGIR
FT                   PGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVNTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSG
FT                   RILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIIEYLNSNIVLLKWMIAEGY
FT                   GDRRTLERRIQGMEKWLANPELLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARPL
FT                   SAVQGEKIDEVFIGSCMTNIGHFRAAGKLLDAHKGQLPTRLWVAPPTRMDAAQLTEEGY
FT                   YSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAA
FT                   VAALIGKLPTPEEYQTYVAQVDKTAVDTYRYLNFNQLSQYTEKADGVIFQTAV"
FT   gene            138741..139103
FT                   /gene="yacL"
FT                   /locus_tag="ECSP_0120"
FT   CDS_pept        138741..139103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="ECSP_0120"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70015"
FT                   /protein_id="ACT70015.1"
FT                   /translation="MDYEFLRDITGVVKVRMSMGHEVVGHWFNEEVKENLALLDEVEQA
FT                   AHALKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVAAYRNFVQQK"
FT   gene            complement(139141..139935)
FT                   /gene="speD"
FT                   /locus_tag="ECSP_0121"
FT   CDS_pept        complement(139141..139935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="ECSP_0121"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70016"
FT                   /protein_id="ACT70016.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDKTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV"
FT   gene            complement(139951..140817)
FT                   /gene="speE"
FT                   /locus_tag="ECSP_0122"
FT   CDS_pept        complement(139951..140817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="ECSP_0122"
FT                   /product="spermidine synthase (putrescine
FT                   aminopropyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70017"
FT                   /protein_id="ACT70017.1"
FT                   /translation="MAEKKQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATDNDALRHLSTEIIQARFLASGLKCRYYNPAVHTAAFALPQYLQD
FT                   ALASQPS"
FT   gene            complement(140923..141270)
FT                   /gene="yacC"
FT                   /locus_tag="ECSP_0123"
FT   CDS_pept        complement(140923..141270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="ECSP_0123"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70018"
FT                   /protein_id="ACT70018.1"
FT                   /translation="MKTFFRTVLFGSLMAVCANSYALSESEAEDMADLTAVFVFLKNDC
FT                   GYQNLPNGQIRRALVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALA
FT                   RDSLSLLAYVK"
FT   gene            141436..142986
FT                   /gene="cueO"
FT                   /locus_tag="ECSP_0124"
FT   CDS_pept        141436..142986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="ECSP_0124"
FT                   /product="multicopper oxidase (laccase)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70019"
FT                   /protein_id="ACT70019.1"
FT                   /translation="MQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDAR
FT                   NRIQLTIGAGQSTFGEKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHG
FT                   LEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIE
FT                   DDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYP
FT                   QHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVNELPVLMGERF
FT                   EVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPAL
FT                   PSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHG
FT                   GKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSEN
FT                   GKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKERAYMAHCHLLEHEDTGMMLGFTV"
FT   gene            complement(143188..145578)
FT                   /gene="gcd"
FT                   /locus_tag="ECSP_0125"
FT   CDS_pept        complement(143188..145578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="ECSP_0125"
FT                   /product="glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70020"
FT                   /protein_id="ACT70020.1"
FT                   /translation="MAINNTGSRRLLVTLTALFAALCGLYLLIGGGWLVAIGGSWYYPI
FT                   AGLVMLGVAWMLWRSKRAALWLYAALLLGTMIWGVWEVGFDFWALTPRSDILVFFGIWL
FT                   ILPFVWRRLVIPASGAVAALVVALLISGSILTWAGFNDPQEINGTLSADATPAEAISPV
FT                   ADQDWPAYGRNQEGQRFSPLKQINADNVHNLKEAWVFRTGDVKQPNDPGEITNEVTPIK
FT                   VGDTLYLCTAHQRLFALDAASGKEKWHYDPELKTNESFQHVTCRGVSYHEAKAETASPE
FT                   VMADCPRRIILPVNDGRLIAINAENGKLCETFANKGVLNLQSNMPDTKPGLYEPTSPPI
FT                   ITDKTIVMAGSVTDNFSTRETSGVIRGFDVNTGELLWAFDPGAKDPNAIPSDEHTFTFN
FT                   SPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNATTGKLAWSYQ
FT                   TVHHDLWDMDLPAQPTLADITVNGQKVPVIYAPAKTGNIFVLDRRNGELVVPAPEKPVP
FT                   QGAAKGDYVTPTQPFSELSFRPTKDLSGADMWGATMFDQLVCRVMFHQMRYEGIFTPPS
FT                   EQGTLVFPGNLGMFEWGGISVDPNREVAIANPMALPFVSKLIPRGPGNPMEQPKDAKGT
FT                   GTESGIQPQYGVPYGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEVVWKKRIGTPQDS
FT                   MPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEKLWQGRLPAGG
FT                   QATPMTYEVNGKQYVVISAGGHGSFGTKMGDYIVAYALPDDVK"
FT   gene            145784..146320
FT                   /gene="hpt"
FT                   /locus_tag="ECSP_0126"
FT   CDS_pept        145784..146320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="ECSP_0126"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70021"
FT                   /protein_id="ACT70021.1"
FT                   /translation="MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSDMVLVGLLRGS
FT                   FMFMADLCREVQVSHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDS
FT                   GNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQR
FT                   YRHLPYIGKVILLDE"
FT   gene            complement(146361..147023)
FT                   /gene="can"
FT                   /locus_tag="ECSP_0127"
FT   CDS_pept        complement(146361..147023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="can"
FT                   /locus_tag="ECSP_0127"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70022"
FT                   /protein_id="ACT70022.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGV
FT                   QAAVENPELGLINNWLLHIRDIWFKHSSLLDEMPQERRLDTLCELNVMEQVYNLGHSTI
FT                   MQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK"
FT   gene            147132..148058
FT                   /gene="yadG"
FT                   /locus_tag="ECSP_0128"
FT   CDS_pept        147132..148058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="ECSP_0128"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70023"
FT                   /protein_id="ACT70023.1"
FT                   /translation="MTIALELQQLKKNYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVSVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVERKEAYIRSEKYLKQLDLWGKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNDKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKA
FT                   LLAKLKSETFILDLAPKSPLPKLDGYQYRLVDTATLEVEVLREQGINSVFTQLSEQGIQ
FT                   VLSMRNKANRLEELFVSLVNEKQGDRA"
FT   gene            148055..148825
FT                   /gene="yadH"
FT                   /locus_tag="ECSP_0129"
FT   CDS_pept        148055..148825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="ECSP_0129"
FT                   /product="predicted transporter subunit: membrane component
FT                   of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70024"
FT                   /protein_id="ACT70024.1"
FT                   /translation="MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGDMHGFSYMQFIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHV
FT                   IIAGYVGGGVARGLFVGILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVF
FT                   AKTFDDISLVPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIN
FT                   DVPLVTTFGVLVVFIVAFYLICWSLIQRGRGLRS"
FT   gene            148930..149370
FT                   /gene="yadI"
FT                   /locus_tag="ECSP_0130"
FT   CDS_pept        148930..149370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="ECSP_0130"
FT                   /product="predicted PTS Enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70025"
FT                   /protein_id="ACT70025.1"
FT                   /translation="MLGWVITCHDDRAQEILDVLEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGAPEVSSIWHQQQKNPPFVLKHNLYEY"
FT   gene            149434..150663
FT                   /gene="yadE"
FT                   /locus_tag="ECSP_0131"
FT   CDS_pept        149434..150663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="ECSP_0131"
FT                   /product="predicted polysaccharide deacetylase lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70026"
FT                   /protein_id="ACT70026.1"
FT                   /translation="MYKQAVILLLMLFTASVSAALPARYMQTIENAAVWAQIGDKMVTV
FT                   GNIRAGQIIAVEPTAASYYAFNFGFDKGFIDKGHLEPVQGRQKVEDGLGDLNKPLSNQN
FT                   LVTWKDTPVYNAPSVGSAPFGVLADNLRYPILHKLKDRLNQTWYQIRIGDRLAYISALD
FT                   AQPDNGLPVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMVQLEGY
FT                   VKNKINLPARAVVITFDDGLKSVSRYAYPVLKQYGMKATAFIVTSRIKRHPQKWEPKSL
FT                   QFMSVSELNEIRDVFDFQSHTHFLHRVDGYRRPILLSRSEHNILFDFARSRRALAQFNP
FT                   HVWYLSYPFGGFNDKAVKAANDAGFHLAVTTMKGKVKPGDNPLLLKRLYILRTDSLETM
FT                   SRLVSNQPQG"
FT   gene            complement(150667..151047)
FT                   /gene="panD"
FT                   /locus_tag="ECSP_0132"
FT   CDS_pept        complement(150667..151047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="ECSP_0132"
FT                   /product="aspartate 1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70027"
FT                   /protein_id="ACT70027.1"
FT                   /translation="MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPN
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   gene            151321..152217
FT                   /gene="yadD"
FT                   /locus_tag="ECSP_0133"
FT   CDS_pept        151321..152217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadD"
FT                   /locus_tag="ECSP_0133"
FT                   /product="predicted transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70028"
FT                   /protein_id="ACT70028.1"
FT                   /translation="MDAPSTTPHDAVFKQFLMHAETARDFLEIHLPVELRELCDLNTLH
FT                   LESGSFIEESLKGHSTDVLYSVQMQGNPGYLHVVIEHQSKPDKKMAFRMMRYSIAAMHR
FT                   HLEADHDKLPLVVPILFYQGEATPYPLSMCWFDMFYSPELARRVYNSPFPLVDITITPD
FT                   DEIMQHRRIAILELLQKHIRQRDLMLLLEQLVTLIDEGYTSESQLVAMQNYMLQRGHTE
FT                   QADLFYGVLRDRETGGKSMMTLAQWFEEKGIEKGIQQGRQEERQEFAQRFLSKGMSRED
FT                   VAEMTNLSLAEIDRLIN"
FT   gene            complement(152516..153367)
FT                   /gene="panC"
FT                   /locus_tag="ECSP_0134"
FT   CDS_pept        complement(152516..153367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="ECSP_0134"
FT                   /product="pantothenate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70029"
FT                   /protein_id="ACT70029.1"
FT                   /translation="MLIIETLPLLRQQIRRLRMEGKRVALVPTMGNLHDGHMKLVDEAK
FT                   ARADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPNGTE
FT                   THTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMV
FT                   ADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYKVLSSIADKLQAGERDL
FT                   DEIIAIAGQELNEKGFRADDIQIRDADTLLEVSETSKRAVILVAAWLGDARLIDNKMVE
FT                   LA"
FT   gene            complement(153379..154173)
FT                   /gene="panB"
FT                   /locus_tag="ECSP_0135"
FT   CDS_pept        complement(153379..154173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="ECSP_0135"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70030"
FT                   /protein_id="ACT70030.1"
FT                   /translation="MKPTTIASLQKCKQEKKRFATITAYDYSFAKLFAEEGLNVMLVGD
FT                   SLGMTVQGHESTLPVTVEDIAYHTTAVRRGAPNCLLLADLPFMAYATPEQAFENAATVM
FT                   RAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEASDRL
FT                   LSDALALEAAGAQLLVLECVPVELAKRITEALAIPVIGIGAGNVTDGQILVMHDAFGIT
FT                   GGHIPKFAKNFLAETGDIRAAVRQYMAEVESGVYPGEEHSFH"
FT   gene            complement(154308..155417)
FT                   /gene="yadC"
FT                   /locus_tag="ECSP_0136"
FT   CDS_pept        complement(154308..155417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="ECSP_0136"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70031"
FT                   /protein_id="ACT70031.1"
FT                   /translation="MQRKGNKLLIQLCSVILLFFTTSWYALANECYIERNAEGDYHMKI
FT                   SSTQLSLASQMVEVPTEIAEATWDVNIQLRGDAIGCKSLGDSKAVHFLNTADPSLISTY
FT                   TTTNGAALLKTTVPGIVYSVELLCLSCGAADELDLWLPAQSGADNFIPSTQTKWAYEYS
FT                   DQSWYLRFRLFITPEFKPKNGVSSGTTIAGKIASWYIGTNDQPWINFYIDNDSLKFFVD
FT                   EPTCATVALAQDQGNVSGNQVTLGNSYVSEVKNGLTREIPFSIRAEYCYASKITVKLKA
FT                   ANKPSDATLVGKTTGSASGVAVKVNSTYDNSKVLLKADGSNTVDYNFAAWSNNLLFLPF
FT                   TAQLVPDGSGNAVGVGTFSGNATFSFTYE"
FT   gene            complement(155429..156019)
FT                   /gene="yadK"
FT                   /locus_tag="ECSP_0137"
FT   CDS_pept        complement(155429..156019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="ECSP_0137"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70032"
FT                   /protein_id="ACT70032.1"
FT                   /translation="MLCRHHKIVHFLGLATALITPFAYSGQDVDLTAKIVPSTCQVEVS
FT                   NNGVVDLGTVTLDYFADNVTPTTDYAGGKTFNVNVVSCDNIQTTQSQMKLDFQPQAGSL
FT                   AQANNQIFSNEYEQQATGAKNVGIVIFSAQPNQQTFNVRGTDGSSTAIYSVAPGNAVPS
FT                   TWTFYSRMQRVNNALPPESGMVRSQVIVNVSYE"
FT   gene            complement(156040..156645)
FT                   /gene="yadL"
FT                   /locus_tag="ECSP_0138"
FT   CDS_pept        complement(156040..156645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadL"
FT                   /locus_tag="ECSP_0138"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70033"
FT                   /protein_id="ACT70033.1"
FT                   /translation="MKLKVIATLIATVAVGVSFNSNFASASTTSASLTVNSNLTMGTCS
FT                   AQIMDNSNKVINEVVFGNVYISELGAKSKVQQFKIRFSNCSGLPQNSAQIVLAPNGISC
FT                   AGSQSSSAGFSNKFTDASAATRTAVEVWTTDTPESNGSTQFHCAQKIPVPVTLPADTTT
FT                   QPYDYPLSARMTVAEGRLVTDVRPGNFRSPTTFTITYQ"
FT   gene            complement(156660..157220)
FT                   /gene="yadM"
FT                   /locus_tag="ECSP_0139"
FT   CDS_pept        complement(156660..157220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadM"
FT                   /locus_tag="ECSP_0139"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70034"
FT                   /protein_id="ACT70034.1"
FT                   /translation="MENSMKRILLTSALIGLGLPAVGSATDLNVDFTATVLATTCTITI
FT                   VEDGGPAVTGSNDEYSLTIPDVGLDKVATAAPEAQANFKLKASDCSNGYSKIFTTLTGT
FT                   TVSGKLIVNEATSGAAGVGMGIKRRDTADSTFFTPNNTDKFEWSADEKASGVPLTVALR
FT                   ETTAGAGRTGAFQAKATFNFTYE"
FT   gene            complement(157222..159822)
FT                   /gene="htrE"
FT                   /locus_tag="ECSP_0140"
FT   CDS_pept        complement(157222..159822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="ECSP_0140"
FT                   /product="putative fimbrial usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70035"
FT                   /protein_id="ACT70035.1"
FT                   /translation="MYQFTHQKSRIPKKTLLAACCALFYSSNGAAADTVEYDSSFLMGT
FT                   GASTIDVKRYAQGNPTPPGLYNVRVFVNGQATSSLEIPFVDIGENSAAACLTHKNLAQL
FT                   HIKQPEQPVTLLAREGEEEDCLDLAKSYEKADVCFDGSDQFLDLTIPQAYVLKSYGGYV
FT                   DPSLWESGINAATLAYTLNAYHTSSDNDNSDSVYGAFNSGINLGAWHFRARGNYNWTTD
FT                   NGSDFDFQDRYLQRDIPAIRSQIIMGDAYTTGETFDSVNVRGVRLYSDSRMLPSALASY
FT                   APTIRGVANSNAKVTVTQSGYKIYETTVPPGEFVIDDISPSGFGSELVVTIEEADGSKR
FT                   TFTQPFSSVVQMQRPGVGRWDFSAGKVIDDSLRSEPNMGQASYYYGLNNLFTGYTGIQF
FT                   TDNNYLAGLLGVGINTSIGAFAVDVTHSRAEIPDDKTYQGQSYRVTWNKLFQDTGTSFN
FT                   LTAYRYSTQDYLGLHDALVLIDDAKHLSADEDKNTMQTYSRMKNQFTVSINQPLNIAYE
FT                   DYGSLFISGSWTYYWAANNSRTEYNVGYSKSVSWGSFSVNLQRSWNEDGEKDDAMYVSV
FT                   SVPIENILGGKRKSSGFRNLNTQLNTDFDGSHQLNVNSSGNTENNLVNYSVNAGYSLDK
FT                   NAGDLASVGGYLNYESGLGGISASASATSDNSQQYSISTDGGFVLHSGGLTFTNNSFSS
FT                   NDTLVLINALGAKGARINNSNNEIDRWGYAVTSSVSPYRENRVGLNIETLENDVELKST
FT                   SATTVPRSGSVVLTRFETDEGRSAVLNITAANGKSIPFAAEVYQGEVMIGSMGQGGQAF
FT                   VRGINDSGELIVRWYENNQTIDCKLHYQFPAQPQTQGSTNTLLLNNLTCQVANH"
FT   gene            complement(159864..160589)
FT                   /locus_tag="ECSP_0141"
FT   CDS_pept        complement(159864..160589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0141"
FT                   /product="fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70036"
FT                   /protein_id="ACT70036.1"
FT                   /translation="MFPLVKKTVSALFVSTLLASAPAFADIIISGTRIIYNADKKDVNV
FT                   RLENKGNRPLLIQNWLDTGDDNADPSQIKVPFTATPPVSRVEPKRGQTVKVMYTGATAL
FT                   PKDRESVYWFNVLEVPPKPKDAEADKNLLQLAFRTRIKLFYRPSGLQGEPAEAPAKITW
FT                   KLNNAQLQANNPTPYYVSFNEVKLESGGKTYNVNSSMVTPFSQASFGVTSLPGSVSSGK
FT                   VVFKAINDFGGNIDGSATF"
FT   gene            complement(160676..161281)
FT                   /gene="yadN"
FT                   /locus_tag="ECSP_0142"
FT   CDS_pept        complement(160676..161281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="ECSP_0142"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70037"
FT                   /protein_id="ACT70037.1"
FT                   /translation="MHVMKKALLAAALVMASGSALAVDGGHIDFNGMVQSGTCKVGVVD
FT                   TGMHSVTTDGVVTLDTANVTDTFAEVSATAVGLLPKEFMISVECDPGAPKNAELTMGSA
FT                   SYANTSGTLNNNMNITVNGIAPAQNVNIAVHNMKNKAGAAEIKQVHMNNSSEVQELTLD
FT                   AEGKGQYVFNASYVKAPNSPAVTAGHVTTNALYTVAYK"
FT   gene            complement(161553..162035)
FT                   /gene="folK"
FT                   /locus_tag="ECSP_0143"
FT   CDS_pept        complement(161553..162035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="ECSP_0143"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihyropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70038"
FT                   /protein_id="ACT70038.1"
FT                   /translation="MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPP
FT                   LGPQDQPDYLNAAVALETTLAPEELLNHTQQIELQQGRVRKAERWGPRTLDLDIMLFGN
FT                   ETINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGETLREILTSLAVLQPAIWY"
FT   gene            complement(162032..163429)
FT                   /gene="pcnB"
FT                   /locus_tag="ECSP_0144"
FT   CDS_pept        complement(162032..163429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="ECSP_0144"
FT                   /product="poly(A) polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70039"
FT                   /protein_id="ACT70039.1"
FT                   /translation="MFTRVANFCRKVLSREESEAEQAVARPQVTVIPREQHAISRKDIS
FT                   ENALKVMYRLNKAGYEAWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGR
FT                   RFRLAHVMFGPEIIEVATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDF
FT                   TINSLYYSVADFTVRDYVGGMKDLKDGVIRLIGNPETRYREDPVRMLRAVRFAAKLGMR
FT                   ISPETAEPIPRLATLLNDIPPARLFEESLKLLQAGYGYETYKLLCEYHLFQPLFPTITR
FT                   YFTENGDSPMERIIEQVLKNTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKIAQESGLT
FT                   YHDAFALAMNDVLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRA
FT                   AYDLLALRAEVERNAELQRLVKWWGEFQVSAPPDQKGMLNELDEEPSPRRRTRRPRKRA
FT                   PRREGTA"
FT   gene            complement(163489..164415)
FT                   /gene="yadB"
FT                   /locus_tag="ECSP_0145"
FT   CDS_pept        complement(163489..164415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadB"
FT                   /locus_tag="ECSP_0145"
FT                   /product="glutamyl-Q tRNA(Asp) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70040"
FT                   /protein_id="ACT70040.1"
FT                   /translation="MLPPYFLFKEMTDTQYIGRFAPSPSGELHFGSLIAALGSYLQARA
FT                   RHGRWLVRIEDIDPPREVPGAAETILRQLEHYGLHWDGDVLWQSQRHHAYREALAWLHE
FT                   QGLSYYCTCTRARIQSIGGIYDGHCRVLHHGPDNAAVRIRQQHPVTQFTDQLRGIIHAD
FT                   EKLAREDFIIHRRDGLFAYNLAVVVDDHFQGVSEIVRGADLIEPTVRQISLYQLFGWKV
FT                   PDYIHLPLALNPQGAKLSKQNHAPALPKGDPRPVLIAALQFLGQQAEAHWQDFSVEQIL
FT                   QSAVKNWRLTAVPESAIVNSTFSNASC"
FT   gene            complement(164452..164907)
FT                   /gene="dksA"
FT                   /locus_tag="ECSP_0146"
FT   CDS_pept        complement(164452..164907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="ECSP_0146"
FT                   /product="dnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70041"
FT                   /protein_id="ACT70041.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   gene            complement(165085..165789)
FT                   /gene="sfsA"
FT                   /locus_tag="ECSP_0147"
FT   CDS_pept        complement(165085..165789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="ECSP_0147"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70042"
FT                   /protein_id="ACT70042.1"
FT                   /translation="MEFSPPLQRATLIQRYKRFLADVITPDGRELTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSDNTKRKYPHTWELTQSQSGAFICVNTLWANRLTKEAILNESISELSGY
FT                   SSLKSEVKYGAERSRIDFMLQADSRPDCYIEVKSVTLAENEQGYFPDAVTERGQKHLRE
FT                   LMSVAAEGQRAVIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAE
FT                   GMALKKSLPVTL"
FT   gene            complement(165804..166334)
FT                   /gene="ligT"
FT                   /locus_tag="ECSP_0148"
FT   CDS_pept        complement(165804..166334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="ECSP_0148"
FT                   /product="2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70043"
FT                   /protein_id="ACT70043.1"
FT                   /translation="MSDPQRLFFAIDLPAEIREQIIHWRATHFPLEAGRPVAADNLHLT
FT                   LAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQLAN
FT                   MLRSQAARSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFARGR
FT                   TRYTPLKRWVLTQ"
FT   gene            166408..168837
FT                   /gene="hrpB"
FT                   /locus_tag="ECSP_0149"
FT   CDS_pept        166408..168837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="ECSP_0149"
FT                   /product="predicted ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70044"
FT                   /protein_id="ACT70044.1"
FT                   /translation="MSSLPVAAVLPELLTALDYAPQVLLSAPTGAGKSTWLPLQLLAHP
FT                   GINGKIILLEPRRLAARNVAQRLAELLNEKPGDTVGYRMRAQNCVGPNTRLEVVTEGVL
FT                   TRMIQRDPELSGVGLVILDEFHERSLQADLALALLLDVQQGLRDDLKLLIMSATLDNDR
FT                   LQQMLPEAPVVISEGRSFPVERRYLPLPTHQRFDDAVAVATAEMLRQESGSLLLFLPGV
FT                   GEIQRVQEQLASRIGSDVLLCPLYGALSLNDQRKAILPAPQGMRKVVLATNIAETSLTI
FT                   EGIRLVVDCAQERVARFDPRTGLTRLITQRISQASMTQRAGRAGRLEPGICLHLIAKEQ
FT                   AERATAQSEPEILQSDLSGLLMELLQWGCSDPAQMSWLDQPPTVNLLAAKRLLQMLGAL
FT                   DGERLSAQGQKMAALGNDPRLAAMLVSAKSDDEAATAAKIAAILEEPPRMGNSDLGVAF
FT                   SRNQPAWQQRSQQLLKRLNVRGGEADSSLIAPLLAGAFADRIARRRGQDGRYQLANGMG
FT                   AMLDADDALSRHEWLIAPLLLQGSASPDARILLALPVDIDELVQRCPQLVQQSDTVEWD
FT                   DAQGTLKAWRRLQIGQLTVKVQPLAKPSEDELHQAMLNGIRDKGLSVLNWTAEAEQLRL
FT                   RLLCAGKWLPEYDWPAVDDESLLATLETWLLPHMAGVHSLRGLKSLDIYQALRGLLDWG
FT                   MQQRLDSELPAHYTVPTGSRIAIRYHEDNPPALAVRMQEMFGEATNPTIAQGRVPLVLE
FT                   LLSPAQRPLQITRDLGAFWKGAYREVQKEMKGRYPKHVWPDDPANTAPTRRTKKYS"
FT   gene            169033..171567
FT                   /gene="mrcB"
FT                   /locus_tag="ECSP_0150"
FT   CDS_pept        169033..171567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="ECSP_0150"
FT                   /product="bifunctional glycosyl transferase/transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70045"
FT                   /protein_id="ACT70045.1"
FT                   /translation="MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEP
FT                   MPRKGKGKGKGRKPRGKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPA
FT                   AVYGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPD
FT                   SKEGQVRARLTFDGDHLATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFP
FT                   DLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSE
FT                   RSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVE
FT                   ELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPL
FT                   GVQPRGGVISPQPAFMQLVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGI
FT                   PALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATY
FT                   LTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVP
FT                   TVNLGMALGLPAVTDTWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRA
FT                   PLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLH
FT                   LAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPT
FT                   PLNLVPPEDIADMGVDYDGNFVCSGGMRVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSS
FT                   QPQQQPQQQPAQQEQKDSDGVAGWIKDMFGSN"
FT   gene            171787..174030
FT                   /gene="fhuA"
FT                   /locus_tag="ECSP_0151"
FT   CDS_pept        171787..174030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="ECSP_0151"
FT                   /product="ferrichrome outer membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70046"
FT                   /protein_id="ACT70046.1"
FT                   /translation="MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVEPKEDTITVT
FT                   AAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALS
FT                   YTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAE
FT                   IMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDALDDDGV
FT                   YSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKT
FT                   SQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFA
FT                   TGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLDLYNPVNTDFDFNAKDPANSGPYRI
FT                   LNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNY
FT                   LFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNL
FT                   TKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYK
FT                   GNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDAL
FT                   VRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF"
FT   gene            174081..174878
FT                   /gene="fhuC"
FT                   /locus_tag="ECSP_0152"
FT   CDS_pept        174081..174878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="ECSP_0152"
FT                   /product="ATP-binding component of iron-hydroxamate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70047"
FT                   /protein_id="ACT70047.1"
FT                   /translation="MQEYTNHSDTTFALRNISFRVPGRTLLHPLSLTFPAGKVTGLIGH
FT                   NGSGKSTQLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRE
FT                   LVAIGRYPWHGALGRFGAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQERGLTVIAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAEIMRGETLEMIYGIPMGILPHPAGAAPVSFVY"
FT   gene            174878..175768
FT                   /gene="fhuD"
FT                   /locus_tag="ECSP_0153"
FT   CDS_pept        174878..175768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ECSP_0153"
FT                   /product="iron-hydroxamate transporter subunit;
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70048"
FT                   /protein_id="ACT70048.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPESVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIR
FT                   SMNPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
FT   gene            175765..177747
FT                   /gene="fhuB"
FT                   /locus_tag="ECSP_0154"
FT   CDS_pept        175765..177747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="ECSP_0154"
FT                   /product="membrane component of ABC superfamily
FT                   iron-hydroxamate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70049"
FT                   /protein_id="ACT70049.1"
FT                   /translation="MSKRIALFPALLLALLVIAATALTWMNFSQALPRSQWAQAAWSPD
FT                   IDVIEQMIFHYSLLPRLAISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGVATGAQLGIT
FT                   VTTLWAIPGAMASQFAALAGACVVGLIVFGVAWGKRLSPVTLILAGLVVSLYCGAINQL
FT                   LVIFHHDQLQSMFLWSTGTLTQTDWGGVERLWPQLLGGVMLTLLLLRPLTLMGLDDGVA
FT                   RNLGLALSLARLAALSLAIVISALLVNAVGIIGFIGLFAPLLAKMLGARRLLPRLMLAS
FT                   LIGALILWLSDQIILWLTRVWMEVSTGSVTALIGAPLLLWLLPRLRSISAPDMKVNDRV
FT                   AAERQHVLAFALAGGVLLLMAVVVALSFGRDAHGWTWASGALLEDLMPWRWPRIMAALF
FT                   AGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGNAFGWLLPAGSIGA
FT                   AVTLLIIMIAAGRGGFSPHRMLLAGMALSTAFTMLLMMLQASGDPRMAQVLTWISGSTY
FT                   NATDAQVWRTGIVMVILLAITPLCRRWLTILPLGGDTARAVGVALTPTRIALLLLAACL
FT                   TATATMTIGPLSFVGLMAPHIARMMGFRRTMPHIVISALVGGLLLVFADWCGRMVLFPF
FT                   QIPAGLLSTFIGAPYFIYLLRKQSR"
FT   gene            complement(177782..179062)
FT                   /gene="hemL"
FT                   /locus_tag="ECSP_0155"
FT   CDS_pept        complement(177782..179062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="ECSP_0155"
FT                   /product="glutamate-1-semialdehyde aminotransferase
FT                   (aminomutase)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70050"
FT                   /protein_id="ACT70050.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPDFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVEPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGVHETLDELTTRLAEGLLEAAE
FT                   EAGIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFE
FT                   AGFMSVAHSMEDINNTIDAARRVFAKL"
FT   gene            179287..180708
FT                   /gene="clcA"
FT                   /locus_tag="ECSP_0156"
FT   CDS_pept        179287..180708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clcA"
FT                   /locus_tag="ECSP_0156"
FT                   /product="chloride channel, voltage-gated"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70051"
FT                   /protein_id="ACT70051.1"
FT                   /translation="MKTDTPSLETPQAARLRRRQLIRQLLERDKTPLAILFMAAVVGTL
FT                   VGLAAVAFDKGVAWLQNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEA
FT                   GGSGIPEIEGALEDQRPVRWWRVLPVKFFGGLGTLGGGMVLGREGPTVQIGGNIGRMVL
FT                   DVFRLKGDEARHTLLATGAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGV
FT                   IMSTIMYRIFNHEVALIDVGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLH
FT                   RVHGGNITKWVLMGGAIGGLCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVAR
FT                   VITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLA
FT                   ASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEA
FT                   EQLARSKAASASENT"
FT   gene            180790..181134
FT                   /gene="yadR"
FT                   /locus_tag="ECSP_0157"
FT   CDS_pept        180790..181134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="ECSP_0157"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70052"
FT                   /protein_id="ACT70052.1"
FT                   /translation="MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
FT   gene            complement(181181..181804)
FT                   /gene="yadS"
FT                   /locus_tag="ECSP_0158"
FT   CDS_pept        complement(181181..181804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="ECSP_0158"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70053"
FT                   /protein_id="ACT70053.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRHLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
FT   gene            complement(181842..182642)
FT                   /gene="btuF"
FT                   /locus_tag="ECSP_0159"
FT   CDS_pept        complement(181842..182642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="ECSP_0159"
FT                   /product="periplasmic binding component of cobalamin
FT                   (vitamin B-12) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70054"
FT                   /protein_id="ACT70054.1"
FT                   /translation="MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKV
FT                   MWVDATNIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFG
FT                   INPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIP
FT                   KIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD"
FT   gene            complement(182635..183333)
FT                   /gene="pfs"
FT                   /locus_tag="ECSP_0160"
FT   CDS_pept        complement(182635..183333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="ECSP_0160"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70055"
FT                   /protein_id="ACT70055.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV
FT                   ESLVQKLAHG"
FT   gene            183417..184934
FT                   /gene="dgt"
FT                   /locus_tag="ECSP_0161"
FT   CDS_pept        183417..184934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="ECSP_0161"
FT                   /product="deoxyguanosine triphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70056"
FT                   /protein_id="ACT70056.1"
FT                   /translation="MAQIDFRKKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPAI
FT                   RRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTG
FT                   PFESIVEMSCLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAVLRLR
FT                   DGEEPLNELRRKIRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWWRGET
FT                   PETHHYLMKKPGYYLSEEAYIARLRKELNLALYSRFPLTWIMEAADDISYCVADLEDAV
FT                   EKRIFTVEQLYHHLHEAWGQHEKGSLFSLVVENAWEKSRSNSLSRSTEDQFFMYLRVNT
FT                   LNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLLKLYKNVAVKHVFSHPDVEQL
FT                   ELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRSPIESRLFHKLSTRHRLAYVEA
FT                   VSKLPSDSPEFPLWEYYYRCRLLQDYISGMTDLYAWDEYRRLMAVEQ"
FT   gene            185064..186488
FT                   /gene="degP"
FT                   /locus_tag="ECSP_0162"
FT   CDS_pept        185064..186488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="ECSP_0162"
FT                   /product="serine endoprotease (protease Do),
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70057"
FT                   /protein_id="ACT70057.1"
FT                   /translation="MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPML
FT                   EKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGG
FT                   GQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIA
FT                   LIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYE
FT                   NFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMV
FT                   EYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLN
FT                   GKLISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEG
FT                   AEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVL
FT                   ALNIQRGDSTIYLLMQ"
FT   gene            186643..187800
FT                   /gene="cdaR"
FT                   /locus_tag="ECSP_0163"
FT   CDS_pept        186643..187800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="ECSP_0163"
FT                   /product="DNA-binding transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70058"
FT                   /protein_id="ACT70058.1"
FT                   /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIG
FT                   ELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPENLRKY
FT                   GELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLGIDLNQP
FT                   RVVAIVEVDSGQLGVDSAMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPALNSFGRW
FT                   DVEDHRKRVEQLITRMKEYGQLRFRVSLGNYFTGPGSIARSYRTAKTTMVVGKQRMPES
FT                   RCYFYQDLMLPVLLDSLRGDWQANELARPLARLKAMDNNGLLRRTLAAWFRHNVQPLAT
FT                   SKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEER"
FT   gene            complement(187889..188275)
FT                   /gene="yaeH"
FT                   /locus_tag="ECSP_0164"
FT   CDS_pept        complement(187889..188275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="ECSP_0164"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70059"
FT                   /protein_id="ACT70059.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
FT   gene            complement(188590..189414)
FT                   /gene="dapD"
FT                   /locus_tag="ECSP_0165"
FT   CDS_pept        complement(188590..189414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="ECSP_0165"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70060"
FT                   /protein_id="ACT70060.1"
FT                   /translation="MQQLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGDI
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   gene            complement(189445..192117)
FT                   /gene="glnD"
FT                   /locus_tag="ECSP_0166"
FT   CDS_pept        complement(189445..192117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="ECSP_0166"
FT                   /product="uridylyltransferase/uridylyl-removing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70061"
FT                   /protein_id="ACT70061.1"
FT                   /translation="MNTLPEQYANTALPTLPGQPQNPCVWPRDELTVGGIKAHIDTFQR
FT                   WLGDAFDNGISAEQLIEARTEFIDQLLQRLWIEAGFSQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATNLI
FT                   ESRLLIGDVALFLELQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPIDDEFQLRGTLIDLRDETLFMRQPEAILRMFYTMVRNSAITGIYSTTLRQ
FT                   LRHARRHLQQPLCNIPQARKLFLSILRHPGAVRRGLLPMHRHSVLGAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFASEETRQRHPLCVNVWPRLPSTELIFIAALFHDIA
FT                   KGRGGDHSILGAQDVVHFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTENRLRYLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEEVLHQIWSRCRANYFVRHSPNQLAWHARHLLQHDLSK
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLSADRHEVIRFGLEQVLTQSSWQPPQPRRQPAKLRHFTVETEVTFLPTHTD
FT                   RKSFLELIALDQPGLLARVGKIFADLGISLHGARITTIGERVEDLFIIATADRRALNNE
FT                   LQQEVHQRLTEALNPNDKG"
FT   gene            complement(192179..192973)
FT                   /gene="map"
FT                   /locus_tag="ECSP_0167"
FT   CDS_pept        complement(192179..192973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="ECSP_0167"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70062"
FT                   /protein_id="ACT70062.1"
FT                   /translation="MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRIC
FT                   NDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDG
FT                   FHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE"
FT   gene            193341..194066
FT                   /gene="rpsB"
FT                   /locus_tag="ECSP_0168"
FT   CDS_pept        193341..194066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="ECSP_0168"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70063"
FT                   /protein_id="ACT70063.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
FT   gene            194324..195175
FT                   /gene="tsf"
FT                   /locus_tag="ECSP_0169"
FT   CDS_pept        194324..195175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="ECSP_0169"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70064"
FT                   /protein_id="ACT70064.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   gene            195322..196047
FT                   /gene="pyrH"
FT                   /locus_tag="ECSP_0170"
FT   CDS_pept        195322..196047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="ECSP_0170"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70065"
FT                   /protein_id="ACT70065.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   gene            196197..196754
FT                   /gene="frr"
FT                   /locus_tag="ECSP_0171"
FT   CDS_pept        196197..196754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="ECSP_0171"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70066"
FT                   /protein_id="ACT70066.1"
FT                   /translation="MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKL
FT                   TDAAIKKIEAALADKEAELMQF"
FT   gene            196846..198042
FT                   /gene="dxr"
FT                   /locus_tag="ECSP_0172"
FT   CDS_pept        196846..198042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="ECSP_0172"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70067"
FT                   /protein_id="ACT70067.1"
FT                   /translation="MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQ
FT                   CLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGA
FT                   AGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQP
FT                   IQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDS
FT                   ATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIA
FT                   HTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANE
FT                   ITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDASAREVARKEVMRLAS"
FT   gene            198228..198989
FT                   /gene="ispU"
FT                   /locus_tag="ECSP_0173"
FT   CDS_pept        198228..198989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispU"
FT                   /locus_tag="ECSP_0173"
FT                   /product="undecaprenyl pyrophosphate synthetase
FT                   (di-trans,poly-cis-decaprenylcistransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70068"
FT                   /protein_id="ACT70068.1"
FT                   /translation="MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKA
FT                   GAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHN
FT                   VRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQ
FT                   QGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWP
FT                   DFDEQDFEGALNAFANRERRFGGTEPGDETA"
FT   gene            199002..199859
FT                   /gene="cdsA"
FT                   /locus_tag="ECSP_0174"
FT   CDS_pept        199002..199859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="ECSP_0174"
FT                   /product="CDP-diglyceride synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70069"
FT                   /protein_id="ACT70069.1"
FT                   /translation="MLKYRLISAFVLIPVVIAALFLLPPVGFAIVTLVVCMLAAWEWGQ
FT                   LSGFTTRSQRVWLAVLCGLLLALMLFLLPEYHRNIHQPLVEISLWASLGWWIVALLLVL
FT                   FYPGSAAIWRNSKTLRLIFGVLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMILVWG
FT                   ADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLDVAPVTLLI
FT                   CSIVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLV
FT                   FRTL"
FT   gene            199871..201223
FT                   /gene="rseP"
FT                   /locus_tag="ECSP_0175"
FT   CDS_pept        199871..201223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="ECSP_0175"
FT                   /product="inner membrane zinc RIP metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70070"
FT                   /protein_id="ACT70070.1"
FT                   /translation="MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQI
FT                   EPVLENVQPNSAASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGS
FT                   PLSLTLIPESKPGNGKAIGFVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKIKGGPVSERVQDFCYRIGSILLVLLMGLALFNDFSRL"
FT   gene            201253..203685
FT                   /gene="yaeT"
FT                   /locus_tag="ECSP_0176"
FT   CDS_pept        201253..203685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="ECSP_0176"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70071"
FT                   /protein_id="ACT70071.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHS
FT                   AEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGI
FT                   NGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGW
FT                   TYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRW
FT                   GYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQD
FT                   GAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQ
FT                   YSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   gene            203806..204291
FT                   /gene="hlpA"
FT                   /locus_tag="ECSP_0177"
FT   CDS_pept        203806..204291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlpA"
FT                   /locus_tag="ECSP_0177"
FT                   /product="periplasmic chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70072"
FT                   /protein_id="ACT70072.1"
FT                   /translation="MKKWLLAAGLGLALATSAQAADKIAIVNMGSLFQQVAQKTGVSNT
FT                   LENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQD
FT                   RARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK"
FT   gene            204295..205320
FT                   /gene="lpxD"
FT                   /locus_tag="ECSP_0178"
FT   CDS_pept        204295..205320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="ECSP_0178"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70073"
FT                   /protein_id="ACT70073.1"
FT                   /translation="MPSIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNP
FT                   KYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSA
FT                   VIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHE
FT                   IQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQ
FT                   D"
FT   gene            205425..205880
FT                   /gene="fabZ"
FT                   /locus_tag="ECSP_0179"
FT   CDS_pept        205425..205880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="ECSP_0179"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70074"
FT                   /protein_id="ACT70074.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   gene            205884..206672
FT                   /gene="lpxA"
FT                   /locus_tag="ECSP_0180"
FT   CDS_pept        205884..206672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="ECSP_0180"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70075"
FT                   /protein_id="ACT70075.1"
FT                   /translation="MIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLK
FT                   SHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMAAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLI
FT                   YRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIR"
FT   gene            206672..207820
FT                   /gene="lpxB"
FT                   /locus_tag="ECSP_0181"
FT   CDS_pept        206672..207820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="ECSP_0181"
FT                   /product="tetraacyldisaccharide-1-P synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70076"
FT                   /protein_id="ACT70076.1"
FT                   /translation="MTEQRPLTIALVAGETSGDILGAGLIRALKERVPNARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTKRFGELKPDVFVGIDAPDFNI
FT                   ILEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRATDLVLAFLPFEKAFYDKYNVPCRF
FT                   IGHTMADAMPLDPDKNSARDVLGIPYDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQT
FT                   YPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQKLAAA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAAQAVLELAQ"
FT   gene            207817..208413
FT                   /gene="rnhB"
FT                   /locus_tag="ECSP_0182"
FT   CDS_pept        207817..208413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="ECSP_0182"
FT                   /product="ribonuclease HII, degrades RNA of DNA-RNA
FT                   hybrids"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70077"
FT                   /protein_id="ACT70077.1"
FT                   /translation="MIEFVYPHTQLVAGVDEVGRGPLVGAVVTAAVILDPARPIAGLND
FT                   SKKLSEKRRLALCEEIKEKALSWSLGRAEPHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPKLPMPAMAVVKGDSRVPEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAEHGATEHHRRSFGPVKRALGLAS"
FT   gene            208450..211932
FT                   /gene="dnaE"
FT                   /locus_tag="ECSP_0183"
FT   CDS_pept        208450..211932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="ECSP_0183"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70078"
FT                   /protein_id="ACT70078.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVQCDLLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSLLRGNSALVDECVAFYEEHFP
FT                   DRYFLELIRTGRPDEESYLHAAVELAEARGLPVVATNDVRFIDSSDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMSTEDYLVKRAKEGLEERLAFLFPDEEERVKRRPEYDERLETELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLIPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   AKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVITAAGLVVAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQHLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   gene            211945..212904
FT                   /gene="accA"
FT                   /locus_tag="ECSP_0184"
FT   CDS_pept        211945..212904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="ECSP_0184"
FT                   /product="acetyl-CoA carboxylase, carboxytransferase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70079"
FT                   /protein_id="ACT70079.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA"
FT   gene            213003..215144
FT                   /gene="ldcC"
FT                   /locus_tag="ECSP_0185"
FT   CDS_pept        213003..215144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="ECSP_0185"
FT                   /product="lysine decarboxylase 2, constitutive"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70080"
FT                   /protein_id="ACT70080.1"
FT                   /translation="MNIIAIMGPHGVFYKDEPIKELESALVAQGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSDINQLNEYLPLYAFINTHSTMDVSVQDMRMALCFFE
FT                   YALGQAEDIAIRMRQYTDEYLDNITPPFTKALFTYVKERKYTFCTPGHMGGTAYQKSPV
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYIVTNGTST
FT                   SNKIVGMYAAPSGSTLLIDRNCHKSLAHLLMMNDVVPVWLKPTRNALGILGGIPRREFT
FT                   RDSIEEKVAATTQAQWPVHAVITNSTYDGLLYNTDWIKQTLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGERVAGKVIFETQSTHKMLAALSQASLIHIKGEYDEEAFNEAFMMHTTT
FT                   SPSYPIVASVETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDGWFFDIWQPPQ
FT                   VDEAECWPVAPGEQWHGFNDADADHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGIVVEKTGPYNLLFLFSIGIDKTKAMGLLRGLTEFKRSYDLNLRIKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRKHDLPGLMLRAFDTLPEMIMTPHQAWQRQIKGEVETI
FT                   ALEQLVGRVSANMILPYPPGVPLLMPGEMLTKESRTVLDFLLMLCSVGQHYPGFETDIH
FT                   GAKQDEDGVYRVRVLKMAG"
FT   gene            215201..215590
FT                   /gene="yaeR"
FT                   /locus_tag="ECSP_0186"
FT   CDS_pept        215201..215590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="ECSP_0186"
FT                   /product="predicted lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70081"
FT                   /protein_id="ACT70081.1"
FT                   /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFTLQSEVYREARDSWK
FT                   GDLALNGQYVIELFSFPFPPERPSRPEACGLRHLAFSVDDIDAAVAHLESHNVKCEAIR
FT                   VDPYTQKRFTFFNDPDGLPLELYEQ"
FT   gene            215655..216950
FT                   /gene="tilS"
FT                   /locus_tag="ECSP_0187"
FT   CDS_pept        215655..216950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="ECSP_0187"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70082"
FT                   /protein_id="ACT70082.1"
FT                   /translation="MTLTLNRQLLTSRQILVAFSGGLDSTVLLHQLVQWRTENPGGALR
FT                   AIHVHHGLSANADAWVTHCENVCQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFART
FT                   LLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGEL
FT                   AQWALAHGLRWIEDESNQDDSYDRNFLRLRVVPLLQQRWPHFAETTARSAALCAEQESL
FT                   LDELLADDLAHCQSPQGTLQIVPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQE
FT                   VALAREDASPCLRLGAFEIRRYQSQLWWIKSVTGQSENIVPWQTWLQPLELPAGQGSVQ
FT                   LNAGGDIRPPRADEAVSVRFKAPGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFY
FT                   GETLIAAAGGFVTQEGVAEGENGISFVWQRNA"
FT   gene            complement(217003..217257)
FT                   /gene="rof"
FT                   /locus_tag="ECSP_0188"
FT   CDS_pept        complement(217003..217257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="ECSP_0188"
FT                   /product="modulator of Rho-dependent transcription
FT                   termination"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70083"
FT                   /protein_id="ACT70083.1"
FT                   /translation="MNDTYQPINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDLVS
FT                   RKNVEYLVVEAAGETRELRLDKITSFSHPEIGTVVVSES"
FT   gene            217616..218161
FT                   /gene="yaeQ"
FT                   /locus_tag="ECSP_0189"
FT   CDS_pept        217616..218161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="ECSP_0189"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70084"
FT                   /protein_id="ACT70084.1"
FT                   /translation="MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLL
FT                   AWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVAL
FT                   FTYNSRAAQIWWQQNQSKCAQFANLSVWYLDDEQLAKVSAFADRTMTLQATIQDGVIWL
FT                   SDDKNNLEVNLTAWQQPS"
FT   gene            218158..218568
FT                   /gene="yaeJ"
FT                   /locus_tag="ECSP_0190"
FT   CDS_pept        218158..218568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="ECSP_0190"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70085"
FT                   /protein_id="ACT70085.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRSGRE"
FT   gene            218582..219292
FT                   /gene="nlpE"
FT                   /locus_tag="ECSP_0191"
FT   CDS_pept        218582..219292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpE"
FT                   /locus_tag="ECSP_0191"
FT                   /product="lipoprotein involved with copper homeostasis and
FT                   adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70086"
FT                   /protein_id="ACT70086.1"
FT                   /translation="MVKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSW
FT                   RGVLPCADCEGIETSLFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLTDSK
FT                   GEKSYYRAKGDALEMLDREGNPIESQFNYTLEPAQSSLPMTPMTLRGMYFYMADAATFT
FT                   DCATGKRFMVANNAELERGYLAARGHSEKPVLLSVEGHFTLEANPDTGAPTKVLAPDTA
FT                   GKFYPNQDCSSLGQ"
FT   gene            complement(219492..220316)
FT                   /gene="yaeF"
FT                   /locus_tag="ECSP_0192"
FT   CDS_pept        complement(219492..220316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeF"
FT                   /locus_tag="ECSP_0192"
FT                   /product="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70087"
FT                   /protein_id="ACT70087.1"
FT                   /translation="MDKPKAYCRLLLPCFLLLSACTVDISQPDSSATAVDAEAKTWAVK
FT                   FQHQSSFTEQSIKEITVPDLKPGDLLFSSSLEVTSFGIRVFSTSSVSHVAIYLGENNVA
FT                   EATGAGVQIVSLKKAMKHSDKLFVLRVPDLTPQQATEITAFANKIKDSGYNYRGIVEFI
FT                   PFMVTRQMCSLNPFSEDFRQQCVSGLAKAQLSSVVEGDKKSWFCSEFVTDAFAKAGHPL
FT                   TLAQSGWISPADLMHMRIGDVSAFKPETQLQYVGHLKPGIYIKAGRFVGLTR"
FT   gene            complement(220369..222087)
FT                   /gene="proS"
FT                   /locus_tag="ECSP_0193"
FT   CDS_pept        complement(220369..222087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="ECSP_0193"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70088"
FT                   /protein_id="ACT70088.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GVRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGGSASHEFQVLAQSGEDDVV
FT                   FSDTSDYAANIELAEAIAPKEPRAAATQEMTLVDTPNAKTIAELVEQFNLPIKKTVKTL
FT                   LVKAVEGSSFPLVALLVRGDHELNEVKAEKLPQVASPLTFATEEEIRAVVKAGPGSLGP
FT                   VNMPIPVVIDRTVAAMSDFTAGANIDGKHYFGINWDRDVATPEVADIRNVVAGDPSPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NYDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVLLDDRKERPG
FT                   VMFADMELIGIPHTIVLGDRNLDNDDIEYKYRRNGEKQLIKTGDIVEYLVKQIKG"
FT   gene            complement(222198..222905)
FT                   /gene="yaeB"
FT                   /locus_tag="ECSP_0194"
FT   CDS_pept        complement(222198..222905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeB"
FT                   /locus_tag="ECSP_0194"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70089"
FT                   /protein_id="ACT70089.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQA
FT                   DAVRGLEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VELKEVVCHKDCVILKLGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAV
FT                   SFTAEVEKQLLTLEKRYPQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   TDAGFEVFALEPR"
FT   gene            complement(222902..223306)
FT                   /gene="rcsF"
FT                   /locus_tag="ECSP_0195"
FT   CDS_pept        complement(222902..223306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="ECSP_0195"
FT                   /product="predicted outer membrane protein, signal"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70090"
FT                   /protein_id="ACT70090.1"
FT                   /translation="MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPR
FT                   ATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQALCIGSALNITAK"
FT   gene            complement(223424..224239)
FT                   /gene="metQ"
FT                   /locus_tag="ECSP_0196"
FT   CDS_pept        complement(223424..224239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="ECSP_0196"
FT                   /product="D-methionine transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70091"
FT                   /protein_id="ACT70091.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTVLDVVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKNGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   gene            complement(224279..224932)
FT                   /gene="metI"
FT                   /locus_tag="ECSP_0197"
FT   CDS_pept        complement(224279..224932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="ECSP_0197"
FT                   /product="D-and L-methionine transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70092"
FT                   /protein_id="ACT70092.1"
FT                   /translation="MSEPMMWLLVRGVWETLAMTFVSGFFGFVVGLPVGVLLYVTRPGQ
FT                   IIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK"
FT   gene            complement(224925..225956)
FT                   /gene="metN"
FT                   /locus_tag="ECSP_0198"
FT   CDS_pept        complement(224925..225956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="ECSP_0198"
FT                   /product="D-and L-methionine transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70093"
FT                   /protein_id="ACT70093.1"
FT                   /translation="MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKDEIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVL
FT                   GYV"
FT   gene            226144..226719
FT                   /gene="gmhB"
FT                   /locus_tag="ECSP_0199"
FT   CDS_pept        226144..226719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="ECSP_0199"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70094"
FT                   /protein_id="ACT70094.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKM
FT                   GFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFR
FT                   QVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITP
FT                   EAENAADWVLNSLADLPQAIKKQQKPAQ"
FT   gene            227083..228624
FT                   /locus_tag="ECSP_0200"
FT   rRNA            227083..228624
FT                   /locus_tag="ECSP_0200"
FT                   /product="16S ribosomal RNA"
FT   gene            228693..228769
FT                   /locus_tag="ECSP_0201"
FT   tRNA            228693..228769
FT                   /locus_tag="ECSP_0201"
FT                   /product="tRNA-Ile"
FT                   /note="anticodon: GAT"
FT   gene            228812..228887
FT                   /locus_tag="ECSP_0202"
FT   tRNA            228812..228887
FT                   /locus_tag="ECSP_0202"
FT                   /product="tRNA-Ala"
FT                   /note="anticodon: TGC"
FT   gene            229071..231975
FT                   /locus_tag="ECSP_0203"
FT   rRNA            229071..231975
FT                   /locus_tag="ECSP_0203"
FT                   /product="23S ribosomal RNA"
FT   gene            232068..232187
FT                   /locus_tag="ECSP_0204"
FT   rRNA            232068..232187
FT                   /locus_tag="ECSP_0204"
FT                   /product="5S ribosomal RNA"
FT   gene            232240..232316
FT                   /locus_tag="ECSP_0205"
FT   tRNA            232240..232316
FT                   /locus_tag="ECSP_0205"
FT                   /product="tRNA-Asp"
FT                   /note="anticodon: GTC"
FT   gene            232479..233282
FT                   /gene="dkgB"
FT                   /locus_tag="ECSP_0206"
FT   CDS_pept        232479..233282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="ECSP_0206"
FT                   /product="2,5-diketo-D-gluconate reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70095"
FT                   /protein_id="ACT70095.1"
FT                   /translation="MAIPAFGLGTFRLKDDVVISSVKTALELGYRAIDTAQIYDNEAAV
FT                   GLAIAESGVPRHELYITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWPSPNDE
FT                   VSVEEFMQALLEAKKEGLTREIGISNFTIPLMEKAIAAVGAENIATNQIELSPYLQNRK
FT                   VVAWAKQHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSS
FT                   TKRENLESNLKAQNLQLDAEDKKAIAALDCNDRLVSPEGLAPEWD"
FT   gene            complement(233279..234193)
FT                   /gene="yafC"
FT                   /locus_tag="ECSP_0207"
FT   CDS_pept        complement(233279..234193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="ECSP_0207"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70096"
FT                   /protein_id="ACT70096.1"
FT                   /translation="MKATSEELAIFVSVVESGSFSRAAEQLGQANSAVSRAVKKLEMKL
FT                   GVSLLNRTTRQLSLTEEGERYFRRVQSILQEMAAAESEIMETRNTPRGLLRIDAATPVV
FT                   LHFLMPLIKPFRERYPEVTLSLVSSETIINLIERKVDVAIRAGTLTDSSLRARPLFNSY
FT                   RKIIASPDYISRYGKPETIDDLKQHVCLGFTEPASLNTWPVACSDGQLHEVKYGLSSNS
FT                   GETLKQLCLSGNGIACLSDYMIDREIARGELVELMADKVLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSEHVKTAPGGAVREA"
FT   gene            234434..235234
FT                   /gene="yafD"
FT                   /locus_tag="ECSP_0208"
FT   CDS_pept        234434..235234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="ECSP_0208"
FT                   /product="endonuclease-exonuclease-phosphatase family
FT                   member"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70097"
FT                   /protein_id="ACT70097.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIR
FT                   ILVWNIYKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
FT   gene            235312..236082
FT                   /gene="yafE"
FT                   /locus_tag="ECSP_0209"
FT   CDS_pept        235312..236082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="ECSP_0209"
FT                   /product="predicted SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70098"
FT                   /protein_id="ACT70098.1"
FT                   /translation="MTTQSHHDHVEKQFSSQASEYLTSTVHASGRDLQLLAVCLADYPD
FT                   ASVLDMGCGAGHASFVAAQNVSTVVAYDLSAQMLDVVAQAAEVRQLKNITTRQGYAESL
FT                   PFADNAFDIVISRYSAHHWHDVGAALREVNRILKPGGRLIVMDVMSPGHPVRDIWLQTV
FT                   EALCDTSHVRNYASGEWLRLINEANLIVDNLITDKLPLEFSSWVARMRTPEALVDAIRI
FT                   YQQSASTEVRTYFALQNDGSFTSDIIMVDAHKAA"
FT   gene            complement(236130..237488)
FT                   /gene="mltD"
FT                   /locus_tag="ECSP_0210"
FT   CDS_pept        complement(236130..237488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="ECSP_0210"
FT                   /product="membrane-bound lytic murein transglycosylase D"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70099"
FT                   /protein_id="ACT70099.1"
FT                   /translation="MKAKAILLASVLLVGCQSTGNVQQHAQSLSAAGQGEAAKFTSQAR
FT                   WMDDGTSIAPDGDLWAFIGDELKMGIPENDRIREQKQKYLRNKSYLHDVTLRAEPYMYW
FT                   IAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNYDAR
FT                   RDVVASTTAALNMMQRLNKMFDGDWLLTVAAYNSGEGRVMKAIKTNKARGKSTDFWSLP
FT                   LPQETKQYVPKMLALSDILKNSKRYGVRLPTTDESRALARVHLSSPVEMAKVADMAGIS
FT                   VSKLKTFNAGVKGSTLGASGPQYVMVPKKHADQLRESLASGEIAAVQSTLVADNTPLNS
FT                   RVYTVRSGDTLSSIASRLGVSTKDLQQWNKLRGSKLKPGQSLTIGAGSSAQRLANNSDS
FT                   ITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVKNNSMPDS"
FT   gene            complement(237560..238315)
FT                   /gene="gloB"
FT                   /locus_tag="ECSP_0211"
FT   CDS_pept        complement(237560..238315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="ECSP_0211"
FT                   /product="predicted hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70100"
FT                   /protein_id="ACT70100.1"
FT                   /translation="MNLNSIPAFDDNYIWVLNDEAGRCLIVDPGDAEPVLNAIAANNWQ
FT                   PEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQETQDKGTTQVVKDGETAFVLGHEFSV
FT                   IATPGHTLGHICYFSKPYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCC
FT                   AHEYTLSNMKFALSILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDI
FT                   DLINVINEETLLQQPEERFAWLRSKKDRF"
FT   gene            238349..239071
FT                   /gene="yafS"
FT                   /locus_tag="ECSP_0212"
FT   CDS_pept        238349..239071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafS"
FT                   /locus_tag="ECSP_0212"
FT                   /product="predicted S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70101"
FT                   /protein_id="ACT70101.1"
FT                   /translation="MKPARVPQTVVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFYL
FT                   LKIGNLSAEINCEACAVSHQVNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCT
FT                   DPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWL
FT                   SLLNFEVLHASRFHVLPWNKHGGKLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNK
FT                   PRIRQAVGATRQCRKPQA"
FT   gene            complement(239068..239535)
FT                   /gene="rnhA"
FT                   /locus_tag="ECSP_0213"
FT   CDS_pept        complement(239068..239535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="ECSP_0213"
FT                   /product="ribonuclease HI, degrades RNA of DNA-RNA hybrids"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70102"
FT                   /protein_id="ACT70102.1"
FT                   /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNN
FT                   RMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLW
FT                   QRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV"
FT   gene            239600..240331
FT                   /gene="dnaQ"
FT                   /locus_tag="ECSP_0214"
FT   CDS_pept        239600..240331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ECSP_0214"
FT                   /product="DNA polymerase III epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70103"
FT                   /protein_id="ACT70103.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDI
FT                   GFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRLVRQASKLRVVFATDEEL
FT                   AAHEARLDLVQKKGGSCLWRA"
FT   gene            240464..240540
FT                   /locus_tag="ECSP_0215"
FT   tRNA            240464..240540
FT                   /locus_tag="ECSP_0215"
FT                   /product="tRNA-Asp"
FT                   /note="anticodon: GTC"
FT   gene            240869..241669
FT                   /gene="yafT"
FT                   /locus_tag="ECSP_0216"
FT   CDS_pept        240869..241669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafT"
FT                   /locus_tag="ECSP_0216"
FT                   /product="predicted aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70104"
FT                   /protein_id="ACT70104.1"
FT                   /translation="MNSKKLCCICVLFSLLAGCASESSIDEKKKKAQVTQSNINKNTPQ
FT                   QLTDKDLFGNETTLAVSEEDIQAALDGDEFRVPLNSPVILVQSGNRAPETIMQEEMRKY
FT                   YTVSTFSGIPDRQKPLTCNKNKDKNENEDVARAENMNWMQALRFVAAKGHQKAIIVYQD
FT                   MLQTGKYDSALKSTVWSDYKNEKLTDAISLRYLVRFTLVDVATGEWATWSPVNYESRVI
FT                   FPPAGITKTSNKELSNDHVTEAQLFNLKQKTYVSMVKDLVSRFQ"
FT   gene            complement(241854..242150)
FT                   /locus_tag="ECSP_0217"
FT   CDS_pept        complement(241854..242150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0217"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70105"
FT                   /protein_id="ACT70105.1"
FT                   /translation="MIIINLRLTLLFILATFTYSVQSDEFDDQTTYTQYRYFSTAIPED
FT                   IRRFMFYVDYCFVDLAFDIETDSMTAKNDIINECTPLKERNKTLKEKYKKMKR"
FT   gene            complement(242147..242602)
FT                   /locus_tag="ECSP_0218"
FT   CDS_pept        complement(242147..242602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0218"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70106"
FT                   /protein_id="ACT70106.1"
FT                   /translation="MRMRKITIILLLTFSCTKGLAFDISMSKECSGVDELEFIDCVKNS
FT                   FIMSTITLKKAEANIKEKIQKWNSDEDEAIRKEAVISLKRLESSNREFIRYRFAQCSFT
FT                   LTWGARVGRLAFSRLYPCYTELNKIRAMQLNNAYISDFQNPDEISSK"
FT   gene            complement(242599..243195)
FT                   /locus_tag="ECSP_0219"
FT   CDS_pept        complement(242599..243195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0219"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70107"
FT                   /protein_id="ACT70107.1"
FT                   /translation="MLWTENDAENTSQWNGYPLQIGRFRKDKAMPALISGEKSTALVTP
FT                   PQWRNKAFNGLKDPERNYWAKEQITGSPEENIKAAITYLMMKLSNTKEESTIDQYDSTL
FT                   YSAIVQKGDLADNIRKERKTTIPNLTKNNPGKNLDKIHPGDILYYQKASMKVIITGWKP
FT                   ITIKNVAMNYNGGGDPKYAIKLQFVYTLLTKNRVL"
FT   gene            complement(243305..243496)
FT                   /locus_tag="ECSP_0220"
FT   CDS_pept        complement(243305..243496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0220"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70108"
FT                   /protein_id="ACT70108.1"
FT                   /translation="MANNILHSSTSDSESKNTSTDSTLFNEKFPFQLRQDFASRITEDE
FT                   SDFFKWKKNKRVGICEQS"
FT   gene            complement(243517..243996)
FT                   /locus_tag="ECSP_0221"
FT   CDS_pept        complement(243517..243996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0221"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70109"
FT                   /protein_id="ACT70109.1"
FT                   /translation="MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFM
FT                   HGLNRDQNVNHHHLTIKKPIDKASPLLGKAICDNELLTCDFSFYRTNKFGINELFYKIK
FT                   LTGAKISDIHVSISHIVVDNSVQPEESVSFSYESIIWEHCSAGTSAYSLWEDRLF"
FT   gene            complement(243962..245461)
FT                   /locus_tag="ECSP_0222"
FT   CDS_pept        complement(243962..245461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0222"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70110"
FT                   /protein_id="ACT70110.1"
FT                   /translation="MCIPTRKITRSAVGCSASLVCQTHCTEEAGMNSNVLTQTIVTGSD
FT                   PRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLARTRTQ
FT                   GLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNILRQQISFAESDLPL
FT                   IYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSNTENAAQTTVRTL
FT                   IYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACSV
FT                   AVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLLDTSPVQPLET
FT                   GMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLHAFADLVMQR
FT                   EKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYQDARAQKQNTDALEKQINERLEGVL
FT                   SRWLLLKNNTIPTIKKALNFNNIHEYKGVLNGEFNLFNTKW"
FT   gene            complement(245382..248816)
FT                   /locus_tag="ECSP_0223"
FT   CDS_pept        complement(245382..248816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0223"
FT                   /product="putative macrophage toxin"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70111"
FT                   /protein_id="ACT70111.1"
FT                   /translation="MLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAAWGIIA
FT                   LVWLTVRVMKRLQLLEKQQKQQREEAIDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLW
FT                   QLPWYMVIGPAGSGKTTLLREGFPSDIIYAPEGARGTEQRLYLTPHVGKQAVIFDIDGT
FT                   LCAPADADILHRRLWEHALGWLKEKRARQPLNGIILTLDLPDLLTADKRHREHLLQTLR
FT                   SRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVTFTRRAHENDDW
FT                   RTELNAFWQTWVDRMNLALPDLMVTQTHTRASLFSFSRQMQGSREPLVSLLEGLLDGEN
FT                   MNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYFTRSLFPQAL
FT                   LAEPNLATESRAWLMRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKA
FT                   FMDVPPPQGEDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTY
FT                   LQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQYMAKRW
FT                   SEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKL
FT                   PVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGLQSYF
FT                   VKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDNLNI
FT                   RNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPDYQL
FT                   LTRLGHEFAPENITLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLR
FT                   LDQNSSDPIFATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVDWRDSVVKPFN
FT                   EQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVII
FT                   REDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQLVDYSQGRN
FT                   YTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTV
FT                   RFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY"
FT   gene            complement(248953..250365)
FT                   /locus_tag="ECSP_0224"
FT   CDS_pept        complement(248953..250365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0224"
FT                   /product="ImpA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70112"
FT                   /protein_id="ACT70112.1"
FT                   /translation="MAMDLRDPNVWISHLLENLPEEKLASALKDDNPDWEYIDGEIVKL
FT                   GSLAHAQLDIPELQRRGLQLLASESKDFRLLAHLLRTLQHAGDPLLALHLLTLYVEHYW
FT                   TVAAPQNMAHKKRFASQIIKRFETGIEGFSQNAATTQRDTLLGELAKLAQCWQSHNVPE
FT                   LAQATDDLFALYQRTFNRAAPAPVPTPAASGSSPQTTVTSESGVTQPSAPAPQIAIDSH
FT                   DDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQSITSTPQAESDGRTPLAAVSADM
FT                   VADYQSRLASADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADTIRDEVIRF
FT                   LERLPQLTGLLFNDRTPFLSEQTKQWLAASPDGKVAPVAQIGEESQAARACFAGQGLEA
FT                   ALRYLDMLPEGDPRDQFHRQYLAAQLTEEAGLIQLAQQQYRMLLMIGSQMMVSDWEPSL
FT                   LTQLEQKFTAEQ"
FT   gene            complement(250370..251113)
FT                   /locus_tag="ECSP_0225"
FT   CDS_pept        complement(250370..251113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0225"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70113"
FT                   /protein_id="ACT70113.1"
FT                   /translation="MSRLRVFRQTGWFIAGLMTGLPATAAPAEASSMAGVAVAVATTTP
FT                   PDATATLQAMQSCRRESAALERLDCYDHLLAPLSPSGFDGALVKAGFVGEAWTRATEQE
FT                   KRREGNTTELLVTQVPGERPTVVITTPAIGHVPPRPVLMFSCVDNITRMQVALMHPLDV
FT                   HDIAVTLNADSRALRSHWFVRENGTLLESSRGLSGIDEIKQLFGAKTLTVDTGADNAAG
FT                   KLTFNIDGLARAIAPLRDACHWAGE"
FT   gene            complement(251110..253887)
FT                   /gene="clpV"
FT                   /locus_tag="ECSP_0226"
FT   CDS_pept        complement(251110..253887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpV"
FT                   /locus_tag="ECSP_0226"
FT                   /product="Hsp100/Clp ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70114"
FT                   /protein_id="ACT70114.1"
FT                   /translation="MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQM
FT                   LAMPRSDLRVITRQGDIGMEELRQALTVENYTTARSADSYPAFSPMLVEWLKEGWLLAS
FT                   AEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGINRDRLQQDFVQWTQESAESVVPD
FT                   ADGKGAGTLTDASDTLLARYAKNMTEDARNGRLAPVLCRDHEIDLMIDILCRRRKNNPV
FT                   VVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGL
FT                   MAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKK
FT                   YFEKDAALSRRFQLVKVSEPNAAEATIILRGLSAVYERSHGVLIDDDALQAAATLSERY
FT                   LSGRQLPDKAIDVLDTACARVAINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRT
FT                   DTSRMTEVLVQYDETLTALDELEAAWHQQQTLVREIIALRQQLLGVAEDDAAPLPDADT
FT                   VEDTQPESESESESEQDNTGAVPADETDREQPEETAETVSPVQRLAQLTAELDALHNDR
FT                   LLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLHKH
FT                   LLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHT
FT                   VSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMAD
FT                   GEGRLIDCKNIVFFLTSNLGYQVIVEHADDPETMQEALYPVLADFFKPALLARMEVVPY
FT                   LPLSKETLATIIAGKLARLDNVLRSRFGAEVVIEPEVTDEIMSRVTRAENGARMLESVI
FT                   DGDMLPPLSLLLLQKMAANTAIARIRLSAVDGAFTADVEDAQNDESVTKDETVL"
FT   gene            complement(253896..254657)
FT                   /locus_tag="ECSP_0227"
FT   CDS_pept        complement(253896..254657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0227"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70115"
FT                   /protein_id="ACT70115.1"
FT                   /translation="MDEGSLSLPPFTGYDEKSLRDYHLALHGNSLNPMIDAATPLLGMV
FT                   MRLSTMNSQTMPEHLFAQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNG
FT                   WSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIREPKRYQDLLEFLWLCFSLGFRGRY
FT                   KVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTVKHIFCGG
FT                   VVVLALFYLFYLLRLDSQTQDILHQLNKLLR"
FT   gene            complement(254662..255993)
FT                   /locus_tag="ECSP_0228"
FT   CDS_pept        complement(254662..255993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0228"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70116"
FT                   /protein_id="ACT70116.1"
FT                   /translation="MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWG
FT                   FTELTLNNELLAQGKIMIDSASGTLPDGTVFSIPDQDALPDPLHPQNFPDERSRNIYLA
FT                   LPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGDARTLTLGQLTPRIMSGAEDMSAY
FT                   ITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAIGGRASDLANRIG
FT                   SPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAELLGELMTFTEPSR
FT                   LPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSELLQ
FT                   SATFVLAVAANMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYH
FT                   SGFSYFELDKSGQAWTEMAAAGAVALHVSGSFPDLNMQLWAIRG"
FT   gene            complement(255996..256520)
FT                   /locus_tag="ECSP_0229"
FT   CDS_pept        complement(255996..256520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0229"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70117"
FT                   /protein_id="ACT70117.1"
FT                   /translation="MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSE
FT                   ITVTLLTEPDTNTNAEGESAAVDVQLVYLTDDSKLQAADYDQIASTPLPDVLGKNYIDH
FT                   QDFNLLPDTIKTLPPIKLDEKTQFIGVVAYFSDDQATEWKQIETVEGTGHHYRLLVHVR
FT                   QSSIEMKKEDE"
FT   gene            complement(256517..257818)
FT                   /locus_tag="ECSP_0230"
FT   CDS_pept        complement(256517..257818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0230"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70118"
FT                   /protein_id="ACT70118.1"
FT                   /translation="MIITEQNMPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHA
FT                   PECHWSVQDRQQSIPAQAFTVILHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEI
FT                   QIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLSTEGAPHYPGMTHRHQLA
FT                   DTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIY
FT                   ASPGDHNDDISAAEMAQRHLAVTPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKGL
FT                   LDLQQQRNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNV
FT                   RHHEEANRAAIVESLRVLLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEE
FT                   LASDRQQGFEMLFNEVYAQVYDRVLREKQREPEA"
FT   gene            complement(257822..258904)
FT                   /locus_tag="ECSP_0231"
FT   CDS_pept        complement(257822..258904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0231"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70119"
FT                   /protein_id="ACT70119.1"
FT                   /translation="MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAEL
FT                   LHRLAKGEKGTPELSLRDDPAQETLRFSADASLAFPCSDISALKRDTSGAFRMTTTFMG
FT                   LQGSQSPLPGYYLDHLAWKAVHEQSPVGDFLDMFSHRLTQFVWHIWRKYRYHISFRNGG
FT                   VDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEIICGLVSHCFDLSE
FT                   VTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSIT
FT                   SLTRKQFLSFLPSGENFLPLTTFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLG
FT                   WTSFLGTPEERPSVTIRVRS"
FT   gene            complement(258868..260718)
FT                   /locus_tag="ECSP_0232"
FT   CDS_pept        complement(258868..260718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0232"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70120"
FT                   /protein_id="ACT70120.1"
FT                   /translation="MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERL
FT                   LEGVAFLTGNLRQKIEDEFPELTHGLIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLI
FT                   PRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLCRDIWLLPVRLEQIENRSTTRNGV
FT                   INITFSVAPGTDFRTLDLNKLRFWLGNDDNYTRDQLYLWFCEYLQGADLTVGEQHIRLP
FT                   EFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEFF
FT                   TLQLRFSRPLPVDIRLRRDSLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQH
FT                   YDVFSVNSVVSQVQDMFRKKDLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRT
FT                   KTSLFHRGFDHTLAFIHADGSYPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTG
FT                   KNAAVASFRNITRPTQPLWPVIDGSLHWSLLSAMNLNYLSLLDTDALKQVIANFDRHAI
FT                   HHPQTARLSQQKLDAIERLETRPVDRLFTGIPVRGLASTLYLHPEPFVCEGEMYLLGTV
FT                   LSHFLSLYASVNSFHMLTVVNTESQETWKWTERIGQHPLI"
FT   gene            complement(260722..261135)
FT                   /locus_tag="ECSP_0233"
FT   CDS_pept        complement(260722..261135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0233"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70121"
FT                   /protein_id="ACT70121.1"
FT                   /translation="MILDRERTTGSLFERMEASSARNRQGGSIHSLRQSIRQNLRNILN
FT                   TRSGSCRGAPELGIDEPEGAENFRESMSRAIEQCIERYEPRISHAEVQAVVSSASSPLD
FT                   MTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD"
FT   gene            complement(261226..262617)
FT                   /locus_tag="ECSP_0234"
FT   CDS_pept        complement(261226..262617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0234"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70122"
FT                   /protein_id="ACT70122.1"
FT                   /translation="MSLQEEELVSSHAGQPEQESSLLDQIMAQTRIQPGSEGYDVARQG
FT                   VTAFIASILQSTASAEPVNKLAVDSMIADIDERISRQMDVIIHAPAFQQVESFWRSLKT
FT                   MVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQSGFYKHVYSSGFGQFGGEPIAAVL
FT                   GAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELPNIKDLYAIFEGP
FT                   AYTKWRALRDSEDSRYLGLTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNTA
FT                   WMLACNIADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREF
FT                   ELAEEGFITLTMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAH
FT                   YIKVLQREQLGSWKERSDLERELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEG
FT                   EPGWY"
FT   gene            complement(262668..262892)
FT                   /locus_tag="ECSP_0235"
FT   CDS_pept        complement(262668..262892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0235"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70123"
FT                   /protein_id="ACT70123.1"
FT                   /translation="MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTL
FT                   DRRISDLLDEIIHFCEFQQSASHWQRVLH"
FT   gene            complement(262927..263427)
FT                   /locus_tag="ECSP_0236"
FT   CDS_pept        complement(262927..263427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0236"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70124"
FT                   /protein_id="ACT70124.1"
FT                   /translation="MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNT
FT                   QETSSLDERQAVSVNKHNFGAVMAEAAIGLNFTVPATLKGSTTDDEMNVALNIKSLDDF
FT                   SPDSVARQVPEVNKLLELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGQV
FT                   SNK"
FT   gene            263854..263997
FT                   /locus_tag="ECSP_0237"
FT   CDS_pept        263854..263997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0237"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70125"
FT                   /protein_id="ACT70125.1"
FT                   /translation="MIQLWPFYGGNTDFEQLGMAIQIYIIKLLLNKRFNDFKNSFYDNR
FT                   KF"
FT   gene            264124..264642
FT                   /locus_tag="ECSP_0238"
FT   CDS_pept        264124..264642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0238"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70126"
FT                   /protein_id="ACT70126.1"
FT                   /translation="MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFL
FT                   HNVTVPTDPQSGQPAGQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVE
FT                   GKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGA
FT                   DDWRAPLEA"
FT   gene            264675..264812
FT                   /locus_tag="ECSP_0239"
FT   CDS_pept        264675..264812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70127"
FT                   /protein_id="ACT70127.1"
FT                   /translation="MLFLYYAVERKVVSKGLRSREMAAAGNFGGSVPERKRSTVLSQPL
FT                   "
FT   gene            264852..266993
FT                   /locus_tag="ECSP_0240"
FT   CDS_pept        264852..266993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0240"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70128"
FT                   /protein_id="ACT70128.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLALSLVSQQF
FT                   LSLEFQQILDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQKLYSMKVCPPLWRTGL
FT                   RQNFRIFQNEDIASILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAQKSTDQSLVLCDTVLYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWR
FT                   NNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTT
FT                   LDNHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNP
FT                   SNQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYKGSGFNELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNH
FT                   AEKIGNNQAITVTNNQILNIGVNQIQTVGVNQVETVGSNQIIKVGSNQVEKVGIIRALT
FT                   VGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQ
FT                   TAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPV
FT                   PDAPVPKDLPPGMPDMRQF"
FT   gene            267069..271301
FT                   /locus_tag="ECSP_0241"
FT   CDS_pept        267069..271301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0241"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70129"
FT                   /protein_id="ACT70129.1"
FT                   /translation="MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITY
FT                   ANPVNPVLGAKVLPGETDLALPGPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRL
FT                   QIRDEGLILNDNGGRSIHFEPLFPGEISYSRSESFWLARGGVAEQHSSQPLSALWQVLP
FT                   EDVRLSPHMYLATNSLQGPWWILNWPERVPGADEVLPPEPPAYRVLTGVVDGFGRTLAF
FT                   HRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSLV
FT                   FPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDELPAAPLARYTYTASGELRAVYDRSGT
FT                   QVRGFAYDAEHAGRMVAHHYAGRPESRYRYDDTGRVTELVNPEGLDYRFEYGQDRVTIT
FT                   DSLNRREVLYTEGEGGLKRVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMA
FT                   SGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPDGLRSSREYDEKGRLAAETSRSGETTRY
FT                   SYDDPASELPTGIQDATGSTKQMAWSRYGQLLTFTDCSGYTTRYEYDRYGQQIAVHREE
FT                   GISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTAIVAPDGSRSEIQYDAWGKAVST
FT                   TQGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKL
FT                   TQSEDEGLVTLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGY
FT                   DDKGRLTGERQTVENPETGEMLWEHETGHAYSEQGLATRQEPDGLPPVEWLTYGSGYLA
FT                   GMKLGGTPLVEYMRDRLHRETARSFGGEAYELATAWNTSGQLRSRHLNLPQLDRDYDWN
FT                   DNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPELHPDS
FT                   TLTAWPDNRIAEDAHYIYRYDEYGRLAEKTDRIPEGVIRMHDERTHHYHYDSQHRLVFH
FT                   TRIQHGEPQVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTV
FT                   QTQQTRIQTVYQPGSFTPLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELAVMLGR
FT                   LERELRQGSVSEESQQWLAQCGLTAEQMAAQLEAEYIPERKLHLYHCDHRGLPQALISP
FT                   EGETAWQGEYDEWGNLLGETSAQHLQQPYRLPGQQYDEESGLYYNRHRYYDPLQGRYIT
FT                   QDPIDIKGGWNLYSYALNPVSWIDPLGLTQCDSEGCNNDILFTGGSGPDNKILNELGPR
FT                   DGIDGLGSQNMKMYSGLLGGDILKPGILGGLTLGSVTQRPSRTAEEEVQAQIEYLAYKK
FT                   RCEQKPDSNLSRCAAAIFQKSRKEDCLRMRQEWDDKWWPGKHADEIKNVKASLKNTLID
FT                   VKKKMHAN"
FT   gene            271408..272157
FT                   /locus_tag="ECSP_0242"
FT   CDS_pept        271408..272157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0242"
FT                   /product="putative ankyrin repeat containing virulence
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70130"
FT                   /protein_id="ACT70130.1"
FT                   /translation="MEEANGGEAIVMNCLIFFKPKNYHLKSKLNYYPITQAAFLGETEV
FT                   VSNLIKLGVDLDARGDLGRTALNEAVSNGYFDIVKLLVESGADLTIKDEFGKTALELAE
FT                   VHQNYKIVEWLSHYRDHNPIPDFSVLINIYGERYFGGEIIDTDARTELGEGVLHIAVRK
FT                   RRQLDVRCFIQHGADINAKANNGFDFTPLHYSIGIGDFDMMKLLLKLGADIYLESEMGY
FT                   SPMDLAILMGDKRIIFYLYGYISHVSE"
FT   gene            272339..273847
FT                   /locus_tag="ECSP_0243"
FT   CDS_pept        272339..273847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0243"
FT                   /product="RhsG core protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70131"
FT                   /protein_id="ACT70131.1"
FT                   /translation="MDALQGNFPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYV
FT                   YRYDEYGRLAEKTDRIPEGVIRMHDERTHHYHYDSQHRLVFHTRIQHGEPQVESRYLYD
FT                   PLGRRTGKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTVQTQQTRIQTVYQPGSFT
FT                   PLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELAVMLGRLERELRQGSVSEESQQW
FT                   LAQCGLTAEQMAAQLEAEYIPERKLHLYHCDHRGLPLALISPEGETAWQGEYDEWGNLL
FT                   GETSAQHLQQSLRLPGQQYDEELGLYYNRNRYYDPLQGRYITQDPIGLEGGWNLYQYPL
FT                   NPIEHIDPLGLALDLNYYSPSDPIYKGSLNVREFPTGFTVGGHGSPTSMSDDRIKKGSD
FT                   LTIKQLASDIRANPKYHEGMPVVLFSCETGKGKNSFAQKLANELDATVIAPDEIIWIWP
FT                   DGNYAIMGQTARITIGGKDNGVFELVPDEKQPGDFHKFTPTGSK"
FT   gene            273850..274467
FT                   /locus_tag="ECSP_0244"
FT   CDS_pept        273850..274467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0244"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70132"
FT                   /protein_id="ACT70132.1"
FT                   /translation="MKVFTFLLIIMVCLYNFGVRAAMDNSKHSDEAEKLLAELSARKGE
FT                   GEGEGEGEGEGEGEGEGEPKSTVSVFYLQPEEVNTLSHQAKRGDGEAGFRLFLYYKLSN
FT                   YDEEKSSQWLKIAANNGHATAQYRLYVELQEQGETKEANEWLQKIKLAASNNDSSAIWF
FT                   LVNCYKNQGNKKEALQWAYKLKASKQPLDADRLIEELTKEQK"
FT   gene            complement(274470..274616)
FT                   /locus_tag="ECSP_0245"
FT   CDS_pept        complement(274470..274616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70133"
FT                   /protein_id="ACT70133.1"
FT                   /translation="MITGDEDASFGFNLRFDELVAVVVNVILCVGVVATGKVFLLSIFL
FT                   LPV"
FT   gene            274806..275105
FT                   /locus_tag="ECSP_0246"
FT   CDS_pept        274806..275105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70134"
FT                   /protein_id="ACT70134.1"
FT                   /translation="MELMKIIRLLLLACSITIHFFIVKEHVFKIFNQHAYCFLFAFYVL
FT                   IVFCFLLFFKRSFIVDLIACIIIPYISSVISFLFLSMLISPHLRERSPNAAFLY"
FT   mobile_element  275094..276359
FT                   /mobile_element_type="insertion sequence:ISEc1"
FT   gene            275213..276349
FT                   /locus_tag="ECSP_0247"
FT   CDS_pept        275213..276349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0247"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70135"
FT                   /protein_id="ACT70135.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDFGETHLDFLRQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAPPELLNILD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCEVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPKMTV
FT                   RYYISSADLTAGKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS"
FT   gene            276352..278112
FT                   /locus_tag="ECSP_0248"
FT   CDS_pept        276352..278112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0248"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70136"
FT                   /protein_id="ACT70136.1"
FT                   /translation="MPWLHRETARSFGGAGSTAGYEQVTAYTLTGQLQSRHLNLPQLDC
FT                   DYDWNDNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPE
FT                   LHPDSTLTAWPDNRIAEDAHYVYRYDEYGRLTEKTDRIPEGVIRMHDERTHHYHYDNQH
FT                   RLVFYTRIQYGEPLVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEVTWYGWDGD
FT                   RLTTVQTGTTRIQTVYRPGSFTPLIRIETENGEREKAQRRSLAEKLQQEGSEDGHGVVF
FT                   PAELVRMLDRLEEEIRADRVSSESRAWLAQCGLTVEQLEKQVEPEYTPARTLHLYHCDH
FT                   RGLPLALISEDGNTAWSAEYDEWGNQLNEENPHHLHQPYRLPGQQHDEESGLYYNRHRY
FT                   YDPLQGRYITPDPIGLRGGWNMYQYPLNPIQVIDPMGLDAIENMTSGGLIYAVSGVPGL
FT                   IVANSITNSAYQFGYDMDAIVGGAHNGAADAMRYCYLMCRMTKTFGSTIADVIGKNHEA
FT                   AGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNIGQLFGLDGIKADNPIKA
FT                   KQGSSDASNY"
FT   gene            278314..278577
FT                   /locus_tag="ECSP_0249"
FT   CDS_pept        278314..278577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0249"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70137"
FT                   /protein_id="ACT70137.1"
FT                   /translation="MVNNYKTHCGVVDINLNFFNDILYSVRLKNISKLENMEFCATKQR
FT                   VYFSDKNKKASYKIINYGDYYDVDYYDNNLKNEVFDWIGKWS"
FT   gene            278758..279930
FT                   /locus_tag="ECSP_0250"
FT   CDS_pept        278758..279930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0250"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70138"
FT                   /protein_id="ACT70138.1"
FT                   /translation="MSIQSLLDYISVIPDIRQQGKVKHKLSDILFLTVCAVIAGADEWQ
FT                   EIEDFGHERLEWLKKYGDFDNGIPVDDTIARVVSNIDSLAFEKIFIEWMQECHEITDGE
FT                   IIAIDGKTIRGSFDKGKRKGAIHMVSAFSNENGVVLGQVKTEAKSNEITAIPELLNLLD
FT                   LKKNLITIDAMGCQKDIASKIKDKKADYLLAVKGNQGKLHHAFEEKFPVNVFSNYKGDS
FT                   FSTQEISHGRKETRLHIVSNVTPEFCDFEFEWKGLKKLCVALSFRQKKEDKSAEGVSIR
FT                   YYISSKDMDAKEFAHAIRAHWLIEHSLHWVLDVKMNEDASRIRRGNAAEIISGIKKMAL
FT                   NLLRDCKDIKGGVKRKRKKVALNTCYIEEVLASCSELGFRTDKMKNLTQI"
FT   gene            complement(280048..280818)
FT                   /gene="yafV"
FT                   /locus_tag="ECSP_0251"
FT   CDS_pept        complement(280048..280818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="ECSP_0251"
FT                   /product="predicted C-N hydrolase family amidase,
FT                   NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70139"
FT                   /protein_id="ACT70139.1"
FT                   /translation="MPGLKITLLQQPLVWMDGPANLRHFDRQLEGITGRDVIVLPEMFT
FT                   SGFAMEAAASSLAQDDVVNWMTAKAQQCNALIAGSVALQTESGSVNRFLLVEPGGTVHF
FT                   YDKRHLFRMADEHLHYKAGNARVIVEWRGWRILPLVCYDLRFPVWSRNLNDYDLAIYVA
FT                   NWPAPRSLHWQALLTARAIENQAYVAGCNRVGSDGNGCHYRGDSRVINPQGEIIATADA
FT                   HQATRIDAELSMVALREYREKFPAWRDADEFRLR"
FT   gene            280972..281445
FT                   /gene="ivy"
FT                   /locus_tag="ECSP_0252"
FT   CDS_pept        280972..281445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ivy"
FT                   /locus_tag="ECSP_0252"
FT                   /product="inhibitor of vertebrate C-lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70140"
FT                   /protein_id="ACT70140.1"
FT                   /translation="MGRISSGGMMFKAITTVAALVIATSAMAQDDLTISSLAKGETTKA
FT                   AFNQMVQGHKLPAWVMKGGTYTPAQTVTLGDETYQVMSACKPHDCGSQRIAVMWSEKSN
FT                   QMTGLFSTIDEKTSQEKLTWLNVNDALSIDGKTVLFAALTGSLENHPDGFNFK"
FT   gene            complement(281488..283932)
FT                   /gene="fadE"
FT                   /locus_tag="ECSP_0253"
FT   CDS_pept        complement(281488..283932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="ECSP_0253"
FT                   /product="medium-long-chain fatty acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70141"
FT                   /protein_id="ACT70141.1"
FT                   /translation="MMILSILATVVLLGALFYHRVSLFISSLILLAWTAALGVAGLWSA
FT                   WVLVPLAIILVPFNFAPMRKSMISAPVFRGFRKVMPPMSRTEKEAIDAGTTWWEGDLFQ
FT                   GKPDWKKLHNYPQPRLTAEEQAFLDGPVEEACRMANDFQITHELADLPPELWAYLKEHR
FT                   FFAMIIKKEYGGLEFSAYAQSRVLQKLSGVSGILAITVGVPNSLGPGELLQHYGTDEQK
FT                   DHYLPRLARGQEIPCFALTSPEAGSDAGAIPDTGIVCMGEWQGQQVLGMRLTWNKRYIT
FT                   LAPIATVLGLAFKLSDPEKLLGGAEDLGITCALIPTTTPGVEIGRRHFPLNVPFQNGPT
FT                   LGKDVFVPIDYIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGVKSVALATGAYAHI
FT                   RRQFKISIGKMEGIEEPLARIAGNAYVMDAAASLITYGIMLGEKPAVLSAIVKYHCTHR
FT                   GQQSIIDAMDITGGKGIMLGQSNFLARAYQGAPIAITVEGANILTRSMMIFGQGAIRCH
FT                   PYVLEEMEAAKNNDVNVFDKLLFKHIGHVGSNKVRSFWLGLTRGLTSSTPTGDATKRYY
FT                   QHLNRLSANLALLSDVSMAVLGGSLKRRERISARLGDILSQLYLASAVLKRYDDEGRNE
FT                   ADLPLVHWGVQDALYQAEQAMDDLLQNFPNRVVAGLLNVVIFPTGRHYLAPSDKLDHKV
FT                   AKILQVPNATRSRIGRGQYLTPSEHNPVGLLEEALVDVIAADPIHQRICKELGKNLPFT
FT                   RLDELAHNALAKGLIDKDEAAILVKAEESRLRSINVDDFDPEELATKPVKLPEKVRKVE
FT                   AA"
FT   gene            284172..284750
FT                   /gene="lpcA"
FT                   /locus_tag="ECSP_0254"
FT   CDS_pept        284172..284750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpcA"
FT                   /locus_tag="ECSP_0254"
FT                   /product="D-sedoheptulose 7-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70142"
FT                   /protein_id="ACT70142.1"
FT                   /translation="MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFNDIFSRY
FT                   VEAVGREGDVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVP
FT                   HFGYADRIQEIHIKVIHILIQLIEKEMVK"
FT   gene            284855..285622
FT                   /gene="yafJ"
FT                   /locus_tag="ECSP_0255"
FT   CDS_pept        284855..285622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="ECSP_0255"
FT                   /product="predicted amidotransfease"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70143"
FT                   /protein_id="ACT70143.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLTGYKSLETGNFRPVGKTDSEKAFCWLLYKLTQRYPRTPGNMAAVFKYIASLA
FT                   DELRQKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWRLFCLGERVV"
FT   gene            complement(285593..286333)
FT                   /gene="yafK"
FT                   /locus_tag="ECSP_0256"
FT   CDS_pept        complement(285593..286333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="ECSP_0256"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70144"
FT                   /protein_id="ACT70144.1"
FT                   /translation="MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLK
FT                   PDSRYYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV
FT                   FGQPSVQVSIYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYV
FT                   VSKPLSHEVVQPQLASNYTLPEAK"
FT   gene            complement(286489..286749)
FT                   /locus_tag="ECSP_0257"
FT   CDS_pept        complement(286489..286749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70145"
FT                   /protein_id="ACT70145.1"
FT                   /translation="MNSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPAVYKDHP
FT                   LQGSWKGYRDAHVEPDWILIYKLTDKLLRFERTGTHAALFG"
FT   gene            complement(286768..287028)
FT                   /gene="dinJ"
FT                   /locus_tag="ECSP_0258"
FT   CDS_pept        complement(286768..287028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinJ"
FT                   /locus_tag="ECSP_0258"
FT                   /product="predicted antitoxin of YafQ-DinJ toxin-antitoxin
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70146"
FT                   /protein_id="ACT70146.1"
FT                   /translation="MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREK
FT                   ALPFDLREPNQLTIQSIKNSEAGVDVHKAKDADDLFDKLGV"
FT   gene            287238..287987
FT                   /gene="yafL"
FT                   /locus_tag="ECSP_0259"
FT   CDS_pept        287238..287987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafL"
FT                   /locus_tag="ECSP_0259"
FT                   /product="predicted lipoprotein and C40 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70147"
FT                   /protein_id="ACT70147.1"
FT                   /translation="MSLPSIPSFVLSGLLLICLPFSSFASATTSHISFSYAARQRMQNR
FT                   ARLLKQYQTHLKKQVSYIVEGNAESRRALRQHNREQIKQHPEWFPAPLKASDRRWQALA
FT                   ENNHFLSSDHLHNITEVAIHRLEQQLGKPYVWGGTRPDKGFDCSGLVFYAYNKILEAKL
FT                   PRTANEMYHYHRATIVANNDLRRGDLLFFHIHSREIADHMGVYLGDGQFIESPRTGETI
FT                   RVSRLAEPFWQDHFLGARRILTEETIL"
FT   gene            288163..288459
FT                   /gene="yafM"
FT                   /locus_tag="ECSP_0260"
FT   CDS_pept        288163..288459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafM"
FT                   /locus_tag="ECSP_0260"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70148"
FT                   /protein_id="ACT70148.1"
FT                   /translation="MSEYRRYYIKGGTWFFTVNLRNRRSHLLTAQFQMLRNAIINVKRD
FT                   RPFEINAWVVLPEHMHCIWTLPESDDDFSSRWREIKKQFTHACGLKNIWQPRF"
FT   gene            288460..288657
FT                   /pseudo
FT                   /locus_tag="ECSP_0261"
FT                   /note="C-terminal fragment; Transposase"
FT   gene            288678..288797
FT                   /locus_tag="ECSP_0262"
FT   CDS_pept        288678..288797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70149"
FT                   /protein_id="ACT70149.1"
FT                   /translation="MPDATLARLIMPTKLHSTVGRIRRSRRIRQLCTNAGCAP"
FT   gene            complement(288805..290544)
FT                   /locus_tag="ECSP_0263"
FT   CDS_pept        complement(288805..290544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0263"
FT                   /product="Flagellar component"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70150"
FT                   /protein_id="ACT70150.1"
FT                   /translation="MLSRSDLLTLLTINFIVVTKGAERISEVSARFTLDAMPGKQMAID
FT                   ADLNAGLINQAQAQTRRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVCIG
FT                   IFKYNLSADAAFQQYVLMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRHQLL
FT                   ASPSVLYTATGIMFVLAVVPGMPHLPFLLFSALLGFTGWRMSKQPQAAEAEEKSLETLT
FT                   RTITETSEQQVSWETIPLIEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGV
FT                   LLPEIRIRENFRLKPSQYAIFINGIKADEADIPADKLMALPSSETYGEIDGVLGNDPAY
FT                   GMPVTWIQPAQKAKALNMGYQVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLSS
FT                   MAPRLAEDLSAALNYSQLLKVYRALLTEGVSLRDIVTIATVLVASSAVTKDHILLAADV
FT                   RLALRRSITHPFVRKQELTVYTLNNELENLLTNVVNQAQQGGKVMLDSVPVDPNMLNQF
FT                   QSTMPQVKEQMKAAGKDPVLLVPPQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMG
FT                   ALS"
FT   gene            290504..291274
FT                   /locus_tag="ECSP_0264"
FT   CDS_pept        290504..291274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0264"
FT                   /product="chemotaxis motB protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70151"
FT                   /protein_id="ACT70151.1"
FT                   /translation="MIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHPPKPAT
FT                   VAVPEETEKKARDVNEKTALLKKKSATELGELATSINTIARDAHMEANLEMEIVPQGLR
FT                   VLIKDDQNRNMFERGSAQIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKNNIYNN
FT                   WNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQSAGNRRIEIMVLTKSA
FT                   SDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR"
FT   gene            291345..292400
FT                   /gene="dinB"
FT                   /locus_tag="ECSP_0265"
FT   CDS_pept        291345..292400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="ECSP_0265"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70152"
FT                   /protein_id="ACT70152.1"
FT                   /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTAN
FT                   YPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDE
FT                   AYLDVTDSVHCHGSATLIAQEIRQTIFSELQLTASAGVAPVKFLAKIASDMNKPNGQFV
FT                   ITPAEVSAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVILLKRFGKFGRIL
FT                   WERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDL
FT                   LIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLD
FT                   PQMERQLVLGL"
FT   gene            292452..292745
FT                   /gene="yafN"
FT                   /locus_tag="ECSP_0266"
FT   CDS_pept        292452..292745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafN"
FT                   /locus_tag="ECSP_0266"
FT                   /product="predicted antitoxin of the YafO-YafN
FT                   toxin-antitoxin system"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70153"
FT                   /protein_id="ACT70153.1"
FT                   /translation="MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASA
FT                   FEALMDMLAEQEEKKPIKARFRPSAARLEEITRRAEKYLNDMTDDDFNDFKE"
FT   gene            292748..293146
FT                   /gene="yafO"
FT                   /locus_tag="ECSP_0267"
FT   CDS_pept        292748..293146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafO"
FT                   /locus_tag="ECSP_0267"
FT                   /product="predicted toxin of the YafO-YafN toxin-antitoxin
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70154"
FT                   /protein_id="ACT70154.1"
FT                   /translation="MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYD
FT                   DSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRTNDESHLVYCQGAFDEQAWLLIAIL
FT                   KPEPHKLARDNNQMHKIGKMAEAFRMRF"
FT   gene            293156..293608
FT                   /gene="yafP"
FT                   /locus_tag="ECSP_0268"
FT   CDS_pept        293156..293608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="ECSP_0268"
FT                   /product="predicted acyltransferase with acyl-CoA
FT                   N-acyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70155"
FT                   /protein_id="ACT70155.1"
FT                   /translation="MNNIQIRNYQPGDFQQLCAIFIRAVMMTASQHYSPQQIAAWAQID
FT                   ESRWKEKLAKSQVRVAVINAQPVGFISRIEHYIDMLFVDPEYTRRGVASALLKPWIKSE
FT                   SELTVDASITAKPFFERYGFQTVKQQRVECRGAWFTNFSMRYKPQH"
FT   gene            293927..294181
FT                   /locus_tag="ECSP_0269"
FT   CDS_pept        293927..294181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70156"
FT                   /protein_id="ACT70156.1"
FT                   /translation="MGKYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQRVVGM
FT                   PDLHPGRGYPIGAAFFSVGRFYPTRRRGNGAGNRNGPLL"
FT   gene            294150..294650
FT                   /locus_tag="ECSP_0270"
FT   CDS_pept        294150..294650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0270"
FT                   /product="peptide chain release factor-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70157"
FT                   /protein_id="ACT70157.1"
FT                   /translation="MLETETGRYSDTLRSALISLDGDNAWALSESWCGTIQWICLSPYR
FT                   PHHGRKNWFLGIGRFTADEQEQSDAIRYETLRPSGPGGQHVNKTDSAVRATHLATGISV
FT                   KVQSERSQHANKRLARLLIAWKLEQQQQENSAVLKSQRRMFHHQIERGNPRRTFTGMAF
FT                   IEG"
FT   gene            complement(294707..296164)
FT                   /gene="pepD"
FT                   /locus_tag="ECSP_0271"
FT   CDS_pept        complement(294707..296164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="ECSP_0271"
FT                   /product="aminoacyl-histidine dipeptidase (peptidase D)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70158"
FT                   /protein_id="ACT70158.1"
FT                   /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEYIVGWAKEKGF
FT                   HVERDQVGNILIRKPATAGMENRKPVVLQAHLDMVPQKNNDTVHDFTKDPIQPYIDGEW
FT                   VKARGTTLGADNGIGMASALAVLADENVVHGPLEVLLTMTEEAGMDGAFGLQSNWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDFTSNLHLDREAVPAGFETFKLTLKGLKGGHSGGEIHV
FT                   GLGNANKLLVRFLAGHAEELDLRLIDFNGGTLRNAIPREAFATIAVAADKVDALKSLVN
FT                   TYQEILKNELAEKEKNLALLLDSVANDKAALIAKSRDTFIRLLNATPNGVIRNSDVAKG
FT                   VVETSLNVGVVTMTDNNVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGAYPGW
FT                   QPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPEMDMVSIGPTITGPHS
FT                   PDEQVHIESVGHYWTLLTELLKEIPAK"
FT   gene            296425..296883
FT                   /gene="gpt"
FT                   /locus_tag="ECSP_0272"
FT   CDS_pept        296425..296883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="ECSP_0272"
FT                   /product="guanine-xanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70159"
FT                   /protein_id="ACT70159.1"
FT                   /translation="MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR"
FT   gene            296975..298219
FT                   /gene="frsA"
FT                   /locus_tag="ECSP_0273"
FT   CDS_pept        296975..298219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frsA"
FT                   /locus_tag="ECSP_0273"
FT                   /product="fermentation/respiration switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70160"
FT                   /protein_id="ACT70160.1"
FT                   /translation="MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIP
FT                   HWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQ
FT                   AMVWQQKACAEEDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQR
FT                   LPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRG
FT                   IAMLTIDMPSVGFSSKWKLTQDSCLLHQRVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFD
FT                   KGLQEITDWIEKRLC"
FT   gene            298277..298678
FT                   /gene="crl"
FT                   /locus_tag="ECSP_0274"
FT   CDS_pept        298277..298678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="ECSP_0274"
FT                   /product="DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70161"
FT                   /protein_id="ACT70161.1"
FT                   /translation="MTLPSGHPKSRLIKKFTVLGPYIREGKCEDNRFFFDCLAVCVNVK
FT                   PAPEVREFWGWWMELEAQESRFTYSYQFGLFDKAGDWKSVPVKDTEVVERLEHTLREFH
FT                   EKLRELLTTLNLKLEPADDFRDEPVKLTA"
FT   gene            complement(298717..299772)
FT                   /gene="phoE"
FT                   /locus_tag="ECSP_0275"
FT   CDS_pept        complement(298717..299772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="ECSP_0275"
FT                   /product="outer membrane phosphoporin protein E"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70162"
FT                   /protein_id="ACT70162.1"
FT                   /translation="MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMS
FT                   DNDSKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKY
FT                   KDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVI
FT                   DGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSR
FT                   GTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLR
FT                   PSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINND
FT                   DIVAVGMTYQF"
FT   gene            300060..301163
FT                   /gene="proB"
FT                   /locus_tag="ECSP_0276"
FT   CDS_pept        300060..301163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="ECSP_0276"
FT                   /product="gamma-glutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70163"
FT                   /protein_id="ACT70163.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIAAGSKPGVIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVD
FT                   EGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAG
FT                   HHSQEIDAILGYEYGPVAVHRDDMITR"
FT   gene            301175..302428
FT                   /gene="proA"
FT                   /locus_tag="ECSP_0277"
FT   CDS_pept        301175..302428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="ECSP_0277"
FT                   /product="gamma-glutamylphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70164"
FT                   /protein_id="ACT70164.1"
FT                   /translation="MLEQMGIAAKQASYKLAQLSSREKNRVLEKIADELEAQSEIILNA
FT                   NAQDVADARANGLSEAMLDRLALTPARLKGIADDVRQVCNLADPVGQVIDGGVLDSGLR
FT                   LERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAVILRGGKETCRTNAATVVVIQDAL
FT                   KSCGLPAGAVQAIDNPDRALVSEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIYVDESAEIAEALKVIVNAKTQRPSTCNTVETLLVNKNIAYSFLPALSKQMAESG
FT                   VTLHADASALAQLQTGPAKVVAVKAEEYDDEFLSLDLNVKIVSDLDDAIAHIREHGTQH
FT                   SDAILTRDMRNAQRFVNEVDSSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGL
FT                   EALTTYKWIGIGDYTIRA"
FT   gene            302543..302618
FT                   /locus_tag="ECSP_0278"
FT   tRNA            302543..302618
FT                   /locus_tag="ECSP_0278"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon: CGT"
FT   gene            complement(302633..303607)
FT                   /gene="intH"
FT                   /locus_tag="ECSP_0279"
FT   CDS_pept        complement(302633..303607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intH"
FT                   /locus_tag="ECSP_0279"
FT                   /product="putative integrase for prophage CP-933H"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70165"
FT                   /protein_id="ACT70165.1"
FT                   /translation="MHKHAAANVAQRNRLNGKQIGFWLQHFAGMQLRDITESKIYSAMQ
FT                   KMTNRRHEENWKLRAEACRKKGKPVPEYTPKPASVATKATHLSFIKALLRAAEREWKML
FT                   DKAPIIKVPQPKNKRIRWLEPHEAQRLIDECPEPLKSVVEFALATGLRRSNIINLEWQQ
FT                   IDMQRRVAWINPEESKSNRAIGVALNDTACRVLKKQIGNHHRWVFVYKESCTKPDGTKA
FT                   PTVRKMRYDANTAWKAALRRAGIDDFRFHDLRHTWASWLVQAGVPLSVLQEMGGWESIE
FT                   MVRRYAHLAPNHLTEHARQIDSILNPSVPNLSQSKNKEGTNDV"
FT   mobile_element  complement(304028..305337)
FT                   /mobile_element_type="insertion sequence:IS1203"
FT   gene            complement(304070..304960)
FT                   /locus_tag="ECSP_0280"
FT   CDS_pept        complement(304070..304960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0280"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70166"
FT                   /protein_id="ACT70166.1"
FT                   /translation="MMPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARA
FT                   QHDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKK
FT                   VRTTISRKAVAAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGW
FT                   RVSSSMETTFVLDALEQALWARRPSGTIHHSDKGSQYVSLAYTERLKEAGLLASTGSTG
FT                   DSYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHTPPAEA
FT                   EKAYYASIGNDDLAA"
FT   gene            complement(304957..305283)
FT                   /locus_tag="ECSP_0281"
FT   CDS_pept        complement(304957..305283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0281"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70167"
FT                   /protein_id="ACT70167.1"
FT                   /translation="MTKNTRFSPEVRQRAIRMVLESQDEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTSAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            complement(305309..305692)
FT                   /locus_tag="ECSP_0282"
FT   CDS_pept        complement(305309..305692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70168"
FT                   /protein_id="ACT70168.1"
FT                   /translation="MKKAAILIDAGFFMQRVHATHRKHFAEHELTAQCIMKVIWSMVLS
FT                   HLNGKRQSQERREPLELYRIYFYDCPPLDIQTRLPLPEPGNKTPGRKNFKLEKSYILRT
FT                   ELHEELRKTRKTAIMNRPGNPGD"
FT   gene            complement(305820..306533)
FT                   /locus_tag="ECSP_0283"
FT   CDS_pept        complement(305820..306533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0283"
FT                   /product="putative cI repressor protein for prophage
FT                   CP-933H"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70169"
FT                   /protein_id="ACT70169.1"
FT                   /translation="MSAKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ
FT                   SGVGALFNGINALNAYNAALLAKILNVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY
FT                   PVFSHVQAGMFSPELRTFTKGDAEKWVSTTKKASGSAFWLEVEGNSMTAPTGSKPSFPD
FT                   GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV
FT                   VGKVIASQWPEETFG"
FT   gene            306634..306834
FT                   /locus_tag="ECSP_0284"
FT   CDS_pept        306634..306834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0284"
FT                   /product="regulatory protein cro"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70170"
FT                   /protein_id="ACT70170.1"
FT                   /translation="MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTIN
FT                   ADGSVYAEEVKPFPSNKKTTA"
FT   gene            306953..307246
FT                   /locus_tag="ECSP_0285"
FT   CDS_pept        306953..307246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0285"
FT                   /product="putative cII antiterminator protein for prophage
FT                   CP-933H"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70171"
FT                   /protein_id="ACT70171.1"
FT                   /translation="MVRANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKR
FT                   DWIPKFSMLLAVLEWGVVDDDMARLARQVAAILTNKKRPAATERSEQIQMEF"
FT   gene            307279..308198
FT                   /pseudo
FT                   /locus_tag="ECSP_0286"
FT                   /note="frameshift mutation due to deletion of 16
FT                   nucleotides relative to ECSP_3213; replication protein O
FT                   for prophage"
FT   gene            308198..308509
FT                   /locus_tag="ECSP_0287"
FT   CDS_pept        308198..308509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0287"
FT                   /product="replication protein P for prophage CP-933H"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70172"
FT                   /protein_id="ACT70172.1"
FT                   /translation="MKNIAAQMVNFDREQMRRIANIDNQDMTISVWVFPDTDISDVSRE
FT                   LIAAIKQGYLTVKAAGVWAGGIETPSVETPSEGSKFFGFDMDNEFISGFDVGAWGVLL"
FT   gene            308509..309303
FT                   /locus_tag="ECSP_0288"
FT   CDS_pept        308509..309303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0288"
FT                   /product="putative tail fiber protein from prophage
FT                   CP-933H"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70173"
FT                   /protein_id="ACT70173.1"
FT                   /translation="MAKNDFKAFATDRNANVMSQEEWEALPALISGFTAGKASSAQVNK
FT                   VIRQASFIAAALAQFVSDKTQRDVLDNGDLPGFVELLGSGFAVEYLSRKNPFGDIKSDG
FT                   TVKTALQNLGLGEGAPAIGVPFFWPSAAMPNTVIDSWSCMVFLKFNGAKFSATDYPVLA
FT                   KVFPSLVLPEARGDFIRIWDDGRGADGGRELLSWQAATNFSQFAGNIGEGAGHAINFHD
FT                   GIAGNQPGFSRFNFTSNSVGDGVNFVAVRPRNIAFNFLVRAK"
FT   gene            309303..309896
FT                   /locus_tag="ECSP_0289"
FT   CDS_pept        309303..309896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70174"
FT                   /protein_id="ACT70174.1"
FT                   /translation="MKPVFDENGLATVPGDMRCFYYDAETSEYTGWSDEYINTGVSMPA
FT                   CSTGIDPGENIPGRVAVFTGKGWSHEEDHRNETVYSIENGAAVTVDYIGAIKDGYVTIS
FT                   PLTPYDKWDGEKWVTDTEAQHSAAVDAAEAQRQSLIDAAMASISLIQLKLQAGRKLTQA
FT                   ETTRLNAVLDYIDAVTATDTSTAPDVIWPELPEA"
FT   gene            complement(309868..310320)
FT                   /locus_tag="ECSP_0290"
FT   CDS_pept        complement(309868..310320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70175"
FT                   /protein_id="ACT70175.1"
FT                   /translation="MIYMDEYVYSARHNAFFPVDMIDKYKSEGWDLSDAKEVNQNIISE
FT                   FMAEPPQGKIRIAGDDGLPAWADIPPPTHEELIEITESERQLLINQANEYMNSKQWPGK
FT                   AAIGRLKGDELTQYNLWLDYLDALELVDTSGAPDIEWPTPPAVQAR"
FT   gene            complement(310332..310766)
FT                   /locus_tag="ECSP_0291"
FT   CDS_pept        complement(310332..310766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70176"
FT                   /protein_id="ACT70176.1"
FT                   /translation="MSLTKAGMMPFARYFCIFINVGLGEAAKRDVGTGENQIPDMASFA
FT                   SGNGWMKLPNGKILQYGRGAVTPTLSTQTMRITFSIPFPKKADCAMLTHSGDGGAPLGA
FT                   GRGFVMTAEGPTLTGFNSAYRTSSTSDTVSMNYSWWAVGE"
FT   gene            310772..311326
FT                   /gene="pinH"
FT                   /locus_tag="ECSP_0292"
FT   CDS_pept        310772..311326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pinH"
FT                   /locus_tag="ECSP_0292"
FT                   /product="DNA invertase from prophage CP-933H"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70177"
FT                   /protein_id="ACT70177.1"
FT                   /translation="MLIGYVRVSTNDQNTDLQRNALNCAGCELIFEDKISGTKSERPGL
FT                   KKLLRTLSAGDTLVVWKLDRLGRSMRHLVILVEELRERGVNFRSLTDAIDTSTPMGRFF
FT                   FHVMGALAEMERELIVERTKAGLEAARAQGRIGGRRPKLTPEQWAQAGRLIAAGIPRQK
FT                   VAIIYDVGVSTLYKKFPAGDK"
FT   gene            complement(311384..312157)
FT                   /locus_tag="ECSP_0293"
FT   CDS_pept        complement(311384..312157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70178"
FT                   /protein_id="ACT70178.1"
FT                   /translation="MDITEFPSGVIEHLGWYVYRLIDPRDGSTFYVGKGKGNRVFAHMR
FT                   GEVAAADDDDLLSNKLKQIREIRLAGLEVIHVIHRHGMTDEKTAYEVEAALIDAYPGLT
FT                   NIMNGAGSNEFGAAHVKELIATYQPETITFHHKALMISVNRSAKDSELYDAVRFSWRIN
FT                   VSRASKAEVILATVRGIVRGVFIADKWLKSTREHFPTMKYWDEDPDFEATQSSRYGFEG
FT                   REAPPEIANLYLGKKIPDELRKKGAMSPVRYSPNF"
FT   gene            312980..313723
FT                   /locus_tag="ECSP_0294"
FT   CDS_pept        312980..313723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0294"
FT                   /product="putative AraC-type regulatory protein encoded in
FT                   prophage CP-933H"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70179"
FT                   /protein_id="ACT70179.1"
FT                   /translation="MATTCSVILILESFDVYFGKESVFLERGSSVLVDSSSRDFFLTYP
FT                   ERVIVADFGAEFISRYLKANNLRDISDCREYPSYLKINFADFSLIKGLISWANHCAEYI
FT                   EIFDESIAFTCLSAFSSEKQFGVFLFGCLKSTGAKVKTIIHTDLSAPWRLKDISSRLYL
FT                   SESLLKRKLKEEGVSFSKIILDERMQMAEYLLSTRCYPISKVAKVCGYASVSYFTYVFR
FT                   RYFGVSPSQYSQRSSESKILTHQGI"
FT   gene            complement(313765..314130)
FT                   /locus_tag="ECSP_0295"
FT   CDS_pept        complement(313765..314130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70180"
FT                   /protein_id="ACT70180.1"
FT                   /translation="MQDVMLGAIEKRFGDKVPEQSIQWLTDNGSAYRAHETRQFARELN
FT                   LEPCTTAISSPQSNGIAERFVKTMKEDYIAFMPKPNVRTALHNLAVAIEHYNENHPHSA
FT                   LGYRSPREYRRQRVTLT"
FT   mobile_element  complement(315206..316515)
FT                   /mobile_element_type="insertion sequence:IS1203"
FT   gene            complement(315248..316138)
FT                   /locus_tag="ECSP_0296"
FT   CDS_pept        complement(315248..316138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0296"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70181"
FT                   /protein_id="ACT70181.1"
FT                   /translation="MMPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARA
FT                   QHDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKK
FT                   VRTTISRKAVAAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGG
FT                   RVSSSMETTFVLDALEQALWARRPSGTIHHSDKGSQYVSLAYTERLKEAGLLASTGSTG
FT                   DSYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHTPPAEA
FT                   EKAYYASIGNDDLAA"
FT   gene            complement(316135..316461)
FT                   /locus_tag="ECSP_0297"
FT   CDS_pept        complement(316135..316461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0297"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70182"
FT                   /protein_id="ACT70182.1"
FT                   /translation="MTKNTRFSPEVRQRAIRMVLESQDEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTSAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            316491..317177
FT                   /pseudo
FT                   /locus_tag="ECSP_0298"
FT                   /note="N-term disrupted by IS element; integrase"
FT   gene            317184..318187
FT                   /pseudo
FT                   /locus_tag="ECSP_0299"
FT                   /note="gene disrupted by frameshift mutation; hypothetical
FT                   protein"
FT   gene            318190..318648
FT                   /locus_tag="ECSP_0300"
FT   CDS_pept        318190..318648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70183"
FT                   /protein_id="ACT70183.1"
FT                   /translation="MVRIYNSSLEVACRMAKVLVAIYPSSLSLERLICFDFILVNLKDF
FT                   LPEEISLHPPIPRRDAQLALKREIVLESLALLQGYELASKIYTHRGFVYKASEKTYAFT
FT                   NSLHNEYVAQMEHNINLVVKLYSDIPDEQLQSIIKNKIGKYDMEFNYE"
FT   gene            318641..319273
FT                   /locus_tag="ECSP_0301"
FT   CDS_pept        318641..319273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70184"
FT                   /protein_id="ACT70184.1"
FT                   /translation="MNDNFFTFRKIKVTGFNKLDAIIEFGSKLTILYGGSDSGKTYIYY
FT                   LIRYLLGSEKLKNKDIDHAQGYDLAYLEFNFQGRVMTIERSLQDSAHYRLYDSSIENVS
FT                   EANLLMVFSKSASSKKSFSSYFYGRLNFKEAKVRTNLSNTLHKFNLNNVFEFFCIDELR
FT                   VLTEKSLILSDIPSEETKRKSEFKFLLTQRDDTNSLAEKPNKKARYF"
FT   gene            319304..319693
FT                   /locus_tag="ECSP_0302"
FT   CDS_pept        319304..319693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70185"
FT                   /protein_id="ACT70185.1"
FT                   /translation="MKAQLIYPEYDQVIVSRELEKVEQDIESSKDILKGIVDALDDKKQ
FT                   LLKELSDELYSISDREKYLSLLIERFSLLKDQYFIDLQRIDVVSQANFYLNNFADIYCE
FT                   FCNTPQKKKMKYHMMIVFCRVMQKN"
FT   gene            319893..320459
FT                   /locus_tag="ECSP_0303"
FT   CDS_pept        319893..320459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70186"
FT                   /protein_id="ACT70186.1"
FT                   /translation="MDHTKHSILSSLQDKEDDVDELKYSAEDFDSLTVADLYDIEIAMQ
FT                   DFLNDINFENSKDNKVRFDEDTYDFNINGKRRGMFGKGTRAVMHAIFTICFAEFLSRKG
FT                   NPFIGFVVLDSPLVTHFDKDRGGSLSDVNSVSLSDSFYHALIKRDYNFQIVILENKGPT
FT                   FQIKINDANKIHNLNKNGSSGFYPV"
FT   gene            complement(320869..321141)
FT                   /locus_tag="ECSP_0304"
FT   CDS_pept        complement(320869..321141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0304"
FT                   /product="putative activator encoded in prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70187"
FT                   /protein_id="ACT70187.1"
FT                   /translation="MALKCPECGTTAHARTSAYEAPSVKRSWYQCQNLECSYTFTALES
FT                   VDTIIMKPRRNEQESEKAQMPEKQQQTLNRYGSASKLSSRQQIPV"
FT   gene            complement(321147..321698)
FT                   /gene="psuI"
FT                   /locus_tag="ECSP_0305"
FT   CDS_pept        complement(321147..321698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psuI"
FT                   /locus_tag="ECSP_0305"
FT                   /product="putative polarity suppression protein encoded in
FT                   CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70188"
FT                   /protein_id="ACT70188.1"
FT                   /translation="MMARVTPDQALISFRNARILWAGHSESRKAVEQQIESLLTAMEKP
FT                   ADYARQLELQREHLDVLKWQINCAARECIYSQHQLMEACTEDALSNFMQANGAALTSAL
FT                   APFLKGRGGVDVASRILRNALVRQLAITPPEIAGDYRMILDESGVMPDPMMVRDCQSSY
FT                   TPAQQLRFQQRLDYINGMQE"
FT   gene            complement(321695..322447)
FT                   /gene="sidI"
FT                   /locus_tag="ECSP_0306"
FT   CDS_pept        complement(321695..322447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sidI"
FT                   /locus_tag="ECSP_0306"
FT                   /product="putative capsid morphogenesis protein encoded in
FT                   CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70189"
FT                   /protein_id="ACT70189.1"
FT                   /translation="MTIPEQNNNPIVEISIPVSTQQALEKVNATKSAWLEARRQQKAAA
FT                   DNIATIRQRRAEMEATTNALNEEWRTLFRESQGVVSKEMKKLRTEIALGRETLEDFDEL
FT                   LAAQESENALLPQEAAELAGKYIHAHDTLVGIRAKQIWEDFMQSHGKALIQTLSLLKST
FT                   MGREASAVVGVVHSVNDPDTLLKDFIHKHITRPALTNDAMPEQDPVFKLAGVAPDYAAR
FT                   LDFSNKLSPAAMHKMKVRQERAEKEKAV"
FT   gene            322850..323020
FT                   /locus_tag="ECSP_0307"
FT   CDS_pept        322850..323020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70190"
FT                   /protein_id="ACT70190.1"
FT                   /translation="MFLPGNNIFASGHGVAFHTDFYKTRSVRFFMDSFGYILRFKVMLF
FT                   NIKVFMQAQCL"
FT   gene            323381..323641
FT                   /locus_tag="ECSP_0308"
FT   CDS_pept        323381..323641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0308"
FT                   /product="putative regulatory protein encoded in prophage
FT                   CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70191"
FT                   /protein_id="ACT70191.1"
FT                   /translation="MRNISVSAPAPAAPLFPVSNHHERFLRLPEVMHLCGLSRSTVYDL
FT                   ISRDAFPKQIPLGGKNVAWAQSEVSAWMADRISARGRGCDA"
FT   gene            323638..324195
FT                   /locus_tag="ECSP_0309"
FT   CDS_pept        323638..324195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0309"
FT                   /product="putative regulator encoded in prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70192"
FT                   /protein_id="ACT70192.1"
FT                   /translation="MMIPAYIKYLYSGLLTVVISRYSFSAVAKSAAGIGVPYNLLATID
FT                   APCVFFYVVAQAQPFSGLWCLCLHHGSIEIMVVRAGQPSGWPVSNKAGYANPVRAATSE
FT                   IGVSGGSNNRYLLEAAIMATILTPSHPQYVFVFAAIRRADTHPRICMLRTVSCDERSAR
FT                   RLLVRDYVLSLSARLPAGEVTL"
FT   gene            324413..324736
FT                   /locus_tag="ECSP_0310"
FT   CDS_pept        324413..324736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70193"
FT                   /protein_id="ACT70193.1"
FT                   /translation="MICCESLLALRAALYRRAVACAWLALSNHQERYSGLTLAELEDAI
FT                   ARELEGFYLRQHGQQRGLEIACALLSDLMESGPLKACPVLSLLGMTVMDELCSRHLNKP
FT                   ALH"
FT   gene            324750..327083
FT                   /locus_tag="ECSP_0311"
FT   CDS_pept        324750..327083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0311"
FT                   /product="alpha replication protein of prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70194"
FT                   /protein_id="ACT70194.1"
FT                   /translation="MSGMKVSQAEKAARGHWSRILPALGVNVLKNRHQPCPVCAGKDRF
FT                   RFDDQEGRGTWFCNQCGAGDGLALVSKVLDVGISEAADRINGIIGNLLPVSQGMLESGS
FT                   PEKEDGRKAAAVLAARLFDKSRQTTGNAYLTSKGFPALPCRELTAMHKVGGVAFRAGDL
FT                   VVPLYADGELVNLQLINANGGKCFLKGGQVKNAFYLVEGTAKAAKRLWIAEGYATALTI
FT                   NYLTGDAVMVAFSSVNFLSLASIACSEYPTHQIIIAADRDLNGAGQTRGAAVTGACNCT
FT                   MALPPVFGDWNDAFTQNGEEATRHAIHEVIKPAVASPFDTMSEAEFTALSVSEKAQRVV
FT                   DHYKNSLAVDPNGQLLSRYEAGAWKVIYYADFARDVAALFQRLDAPFSSAKIASLVETL
FT                   KLIVPQQQNPARQLIGFRNGVLDTRTGLFSPHDKKHWLRTLCEVDYTQPVDGESLETHA
FT                   PAFWRWLDRAAGFNPEKRDIILAALFMVLANRYDWQLFLEVTGPGGSGKSILAEIATML
FT                   AGEDNATSATIEMLESPRERAALIGFSLIRLPDQEKWSGDGAGLKAITGGDAVSVDPKY
FT                   QNAYSTHIPAVILAVNNNPMRFTDRSGGVSRRRVILHFPDQIAPEERDTQLKEKIASEL
FT                   AVIVRQLMQRFSDPMSARTLLQSQQNSDEALTIKRDADSAFDFCGYLEVLPDTTGMFMG
FT                   NANIVPRQPRTYLYHAYLVYMEANGYKNTLSLTMFGKGLPLMLKEYGLQYEKRRTNQGM
FT                   QTNLALREESNADWLPKCDEFAAK"
FT   gene            complement(327216..328172)
FT                   /locus_tag="ECSP_0312"
FT   CDS_pept        complement(327216..328172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70195"
FT                   /protein_id="ACT70195.1"
FT                   /translation="MTSYSNFSNQIKETINNKFDHEIHDWDIIKNSITTLINKNIHGAG
FT                   RNIVDFIDLGNWDFISNFSFDDSTRRLELEWHPNDKFHIYIESVVFVEFNDTIYAFLKG
FT                   YYHNQLSLNRIYNTKCSSCSFENSGSYMVDVYRTVKRVNETIQTPNINCYTTCILTRPA
FT                   NGHVTSTGFSRNLMDAINISLAEHKIASLHNEVMSIEEYDRDSLQEKGNTARRYLEYIL
FT                   MLVNIRIMHLNNVQYQEQMLGSLVSVIEALDYEPLMKNDVEITKDILNACSHHGGVRIE
FT                   KKDVIFSLEVIENLIKAIKKTDINKLQLDGMFKSIQK"
FT   gene            complement(328848..329747)
FT                   /locus_tag="ECSP_0313"
FT   CDS_pept        complement(328848..329747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0313"
FT                   /product="putative LysR-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70196"
FT                   /protein_id="ACT70196.1"
FT                   /translation="MKIDLNLLPIFIAVAEESNFSKAAARLGVTRSAVSQGIRRLEDAF
FT                   GTMLVMRTTRSVNLTEAGERLHKSLSLPLSGIEAAFEEMVSDHVPRGLLRIAVTSIAEE
FT                   FLSGPLIASFAAANPAVTLDIVVTDEEFDIVAAGYDAGVRLGEVIEKDMIAVPLTGRQR
FT                   EMVVASPSYLAANSTPVHPRELVNHKCIGWRQSPEVAPYRWPFEENGRAFDLAIEPQIT
FT                   TNDLRLMLRLALAGGGITIATQETFRPYIESGKLVSLLDDFLPQFPGFYLYFPQRRNIA
FT                   PKLRALIDHVKEWRQQLA"
FT   gene            329846..330568
FT                   /locus_tag="ECSP_0314"
FT   CDS_pept        329846..330568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0314"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70197"
FT                   /protein_id="ACT70197.1"
FT                   /translation="MDKVILITGASSGIGEGIARELGMTGAKVLLGARRVERIEAIATE
FT                   ICRAGGIAKARELDVTDRQSMADFVQAALDSWGRVDVLINNAGVMPLSPLAAGKQDEWA
FT                   LTIDVNIKGVLWGIGAVLPVMEAQGSGQIINLGSIGALSVVPTGAVYCASKFAVRAISD
FT                   GLRQESSKIRVTCVNPGVVESELASTITHVETMKAMDAYRSVALQPADIARAVRHIIES
FT                   PESVDTTEITIRPTASAN"
FT   gene            330735..331013
FT                   /locus_tag="ECSP_0315"
FT   CDS_pept        330735..331013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0315"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70198"
FT                   /protein_id="ACT70198.1"
FT                   /translation="MSLYIKLILSIVREISVNTICSLIVVVALSLLSFSSVAKTITAVG
FT                   STINSTEKEISLQAEKQGKSYKILGAFFKNRVYMIAKLTPVSKNDAS"
FT   gene            331288..331437
FT                   /locus_tag="ECSP_0316"
FT   CDS_pept        331288..331437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0316"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70199"
FT                   /protein_id="ACT70199.1"
FT                   /translation="MITNQTEMVKSSNSYLIRFLTPLNSLKRMHILNISEMNSLLPLLI
FT                   EMEG"
FT   gene            complement(331716..332600)
FT                   /locus_tag="ECSP_0317"
FT   CDS_pept        complement(331716..332600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0317"
FT                   /product="putative LysR-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70200"
FT                   /protein_id="ACT70200.1"
FT                   /translation="MAKRENYNELYLFMQVVREGSFTAAAKRLGLAQSGVSRSVRELEE
FT                   RLGVQLLVRTTRKLSLTQAGEQLYQKTASGFEMLDLGLATLAHYRETPSGTVRINASQH
FT                   AIDKCLLPKLAVFKQRYPDIQLELINESRFVDIIEERFDAGVRLGPEVSQGMVAVRITP
FT                   DMEMAIVGTPEHFRRYGFPQTPADLKAHPCIAYQFADGSVYQWELNQDDKKITHQPEGQ
FT                   WAFSDSYMEAEAARLGLGLAYVPVELVADDLEHGKLIRVLQRYSLRMEGLFLYYPHRNV
FT                   SPALRMVIDTLKI"
FT   gene            332864..333922
FT                   /locus_tag="ECSP_0318"
FT   CDS_pept        332864..333922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0318"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70201"
FT                   /protein_id="ACT70201.1"
FT                   /translation="MSYADSTNPNAPVSMTDKWDKTFAESQKVDHRKVSFPNRYGITLV
FT                   GDLYLPKDRGDRKLAAIAVSGPFGAVKEQSSGLYAQTLAERGFVTLAFDPSYTGESGGY
FT                   PRNVASPDINTEDFSAAVDFLGLQKEVDRNRIGLLGICGWGGMALNDAAMDTRVKAVAT
FT                   SVMYDMSRAMGHGVGDGEDRYSTADRRAVLQYLNEQRWKDAQSGTFAHGGHDINVDSNG
FT                   KVSAGERILPETLPANPHPVLKEFFDYYRMPRGFHERSVNSTGAWTATMPLSFMNMPLL
FT                   SYASEITIPTLIVTGEKAHSRYFAEDAYKAVGSKDKELVVVPGANHVDLYDNVAGKIPF
FT                   AKFEQFFQTKLK"
FT   gene            333998..335191
FT                   /locus_tag="ECSP_0319"
FT   CDS_pept        333998..335191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0319"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70202"
FT                   /protein_id="ACT70202.1"
FT                   /translation="MSTLSQTPSPHHQHAYWGGIFAMTLCVFVLIASEFMPVSLLTPIA
FT                   RDLGVTEGLAGRGIAISGALAVLTSLTLSTLAGKMNRKFLLLGMTVLMAVSGLIIALAT
FT                   SYLMYMVGRAMIGVAIGGFWSMSAATAIRLVPQHQVTRALAIFNAGNALATVVAAPLGS
FT                   YLGATVGWRGAFLCLVPMAVVAFIWQCISLPSMDANKSHTSCGAVFRLFSRRMVVVGMI
FT                   ACGLFFMGQFALFTYVRPFLESVTRVNSLGLSLILLIIGVAGFIGTLVVSIFLNRKFYP
FT                   TLMAIPGLMAVIAIGLMLTGHHVWMVSLLLGLWGMLATAAPTGWWTWIARTLPDNAEAG
FT                   GGLMVAVIQLSIALGSTAGGIVFDRLGWQSTFAMSSVLLLCAGVLTFVTARQKAGAL"
FT   gene            complement(335370..336326)
FT                   /gene="yagQ"
FT                   /locus_tag="ECSP_0320"
FT   CDS_pept        complement(335370..336326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagQ"
FT                   /locus_tag="ECSP_0320"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70203"
FT                   /protein_id="ACT70203.1"
FT                   /translation="MSYPLFDKDEHWHKPEQAFLTDDHRTILRFAVEALMSGKGAVLVT
FT                   LVEIRGGAARPLGAQMVVREDGRYCGFVSGGCVEAAAAFEALEMMGSGCDREIRYGEGS
FT                   PWFDIVLPCGGGITLTLHKLRSAQPLLAVLNRLEQRKPAGLRYDPQAQSLVCLPTQTRT
FT                   GWNLNGFEVGFRPCVRLMIYGRSLEAQATASLAAATGYDSHIFDLFPASASAQIDTDTA
FT                   VILLCHDLNRELPVLQAAREAKPFYLGALGSYRTHTLRLQKLHELGWSREETAQIRAPV
FT                   GIFPKARNAHTLALSVLAEVASVRLHQEEDSCLPPSS"
FT   gene            complement(336336..338534)
FT                   /gene="yagR"
FT                   /locus_tag="ECSP_0321"
FT   CDS_pept        complement(336336..338534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagR"
FT                   /locus_tag="ECSP_0321"
FT                   /product="predicted oxidoreductase with molybdenum-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70204"
FT                   /protein_id="ACT70204.1"
FT                   /translation="MKFDKPAGENPIDQLKVVGRPHDRIDGPLKTTGTARYAYEWHEES
FT                   PNAAYGYIVGSAIAKGRLTALDTDAAQKAPGVLPVITASNAGALSKGDKNTARLLGGPT
FT                   IEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVSQPPEDTPDKNVG
FT                   DFDGAFSSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAK
FT                   TLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTH
FT                   RPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLAT
FT                   LDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQIDPADPTRRFSRR
FT                   QLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEPNGT
FT                   VTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTS
FT                   GVYAACVKLREMIASAVGFDPEQSQFADGKITNGTRSAILHEATAGGRLTAEESIEFGT
FT                   LSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMG
FT                   AALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV"
FT   gene            complement(338531..339487)
FT                   /gene="yagS"
FT                   /locus_tag="ECSP_0322"
FT   CDS_pept        complement(338531..339487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagS"
FT                   /locus_tag="ECSP_0322"
FT                   /product="predicted oxidoreductase with FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70205"
FT                   /protein_id="ACT70205.1"
FT                   /translation="MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETP
FT                   THLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLVAHERVRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPS
FT                   DMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPL
FT                   GGKHIYRKVRDRASYAFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQA
FT                   VYDALFASAHPTAENTFKLLLAKRTLASVLAEARAQA"
FT   gene            complement(339484..340173)
FT                   /gene="yagT"
FT                   /locus_tag="ECSP_0323"
FT   CDS_pept        complement(339484..340173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagT"
FT                   /locus_tag="ECSP_0323"
FT                   /product="predicted xanthine dehydrogenase, 2Fe-2S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70206"
FT                   /protein_id="ACT70206.1"
FT                   /translation="MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAAAAVVYPHS
FT                   TLAASVPAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDALRENLHLIGTKKGCDHGQC
FT                   GACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTS
FT                   GQICSSVAVLKEIQDGIPSHVTVDLVSPPERTADEIRERMSGNICRCGAYANILAAIED
FT                   AAGEIKS"
FT   gene            340591..341205
FT                   /gene="yagU"
FT                   /locus_tag="ECSP_0324"
FT   CDS_pept        340591..341205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagU"
FT                   /locus_tag="ECSP_0324"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70207"
FT                   /protein_id="ACT70207.1"
FT                   /translation="MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPV
FT                   DMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWY
FT                   ENVSEIFGHLVWFWSIEIIRRDLRNRITHEPDPEIPLGSNR"
FT   gene            complement(341453..341782)
FT                   /gene="ykgJ"
FT                   /locus_tag="ECSP_0325"
FT   CDS_pept        complement(341453..341782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgJ"
FT                   /locus_tag="ECSP_0325"
FT                   /product="predicted ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70208"
FT                   /protein_id="ACT70208.1"
FT                   /translation="MSNLNPCMTCGACCAFFRVSFYWAEADDAGGTIPARLTEQISPFH
FT                   RCMSGTNQKNPRCIALAGTPGKNACCTIYKNRSSTCREFAMSGENGVVNEACNRARAKY
FT                   GLTPL"
FT   gene            complement(342095..342805)
FT                   /gene="ecpE"
FT                   /locus_tag="ECSP_0326"
FT   CDS_pept        complement(342095..342805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpE"
FT                   /locus_tag="ECSP_0326"
FT                   /product="predicted chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70209"
FT                   /protein_id="ACT70209.1"
FT                   /translation="MFRRRGVTLTKALLTAVCMLAAPLTQAISVGNLTFSLPSETDFVS
FT                   KRVVNNNKSARIYRIAISAIDSPGSSELRTRPVDGELLFAPRQLALQAGESEYFKFYYH
FT                   GPQDNRERYYRVSFREVPTRNLTKRSPTGGEVSTEPVVVMDTILVVRPRQVQFKWSFDQ
FT                   VTGTVSNTGNTWFKLLIKPGCDSTEEEGDAWYLRPEDVVHQPELRQPGNHYLVYNDKFI
FT                   KISDSCPAKPPSAD"
FT   gene            complement(342774..344417)
FT                   /gene="yagW"
FT                   /locus_tag="ECSP_0327"
FT   CDS_pept        complement(342774..344417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagW"
FT                   /locus_tag="ECSP_0327"
FT                   /product="predicted receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70210"
FT                   /protein_id="ACT70210.1"
FT                   /translation="MRVNLLIAMIIFALIWPVTALRAAVSKTTWADAPAREFVFVENNS
FT                   DDNFFVTPGGALDPRLTGANRWTGLKYNGSGTIYQQSLGYIDNGYNTGLYTNWKFDMWL
FT                   ENSPVSSPLTGLRCINWYAGCNMTTSLILPQTTDTSGFYGATVTSGGAKWMHGMLSDAF
FT                   YQYLQQMPVGSSFTMTINACQTSVNYDASSGARCKDQASGNWYVRNVTHTKAANLRLIN
FT                   THSLAEVFINSDGVPTLGEGNADCRTQTIGSRSGLSCKMVNYTLQTNGLSNTSIHIFPA
FT                   IANSSLASAVGAYDMQFSLNGSSWKPVSNTAYYYTFNEMKSADSIYVFFSSNFFKQMVN
FT                   QGISDINTKDLFNFRFQNTTSPESGWYEFSTSNTLIIKPRDFSISIISDEYTQTPSREG
FT                   YVGSGESALDFGYIVTTSGKTAADEVLIKVTGPAQVIGGRSYCVFSSDDGKAKVPFPAT
FT                   LSFITRNGATKTYDAGCDDSWRDMTDALWLTTPWTDISGEVGQMDKTTVKFSIPMDNAI
FT                   SLRTVDDNGWFGEVSASGEIHVQATWRNIN"
FT   gene            complement(344407..346932)
FT                   /gene="ecpC"
FT                   /locus_tag="ECSP_0328"
FT   CDS_pept        complement(344407..346932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpC"
FT                   /locus_tag="ECSP_0328"
FT                   /product="predicted usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70211"
FT                   /protein_id="ACT70211.1"
FT                   /translation="MPLRRFSPGLKAQFAFGMVFLFVQPDASAADISAQQIGGVIIPQA
FT                   FSQALQDGMSVPLYIHLAGSQGRQDDQRIGSAFIWLDDGQLRIRKIQLEESEDNASVSE
FT                   QTRQQLMALANAPFNEALTIPLTDNAQLDLSLRQLLLQLVVKREALGTVLRSRSEDIGQ
FT                   SSVNTLSSNLSYNFGIYNNQLRNGGSNTSSYLSLNNVTALREHHVVLDGSLYGIGSGQQ
FT                   DSELYKAMYERDFAGHRFAGGTLDTWNLQSLGPMTAISAGKIYGLSWGNQASSTIFDSS
FT                   QSATPVIAFLPAAGEVHLTRDGRLLSVQNFTMGNHEVDTRGLPYGIYDVEVEVIVNGRV
FT                   ISKRTQRVNKLFSRGRGVGAPLAWQVWGGSFHMDRWSENGKKTRPAKESWLAGASTSGS
FT                   LSTLSWAATGYGYDNQAVGETRLTLPLGGAINVNLQNMLASDSSWSSIGSISATLPGGF
FT                   SSLWVNQEKTRIGNQLRRSDADNRAIGGTLNLNSLWSKLGTFSISYNDDRRYNSHYYTA
FT                   DYYQNVYSGTFGSLGLRAGIQRYNNGDSNANTGKYIALDLSLPLGNWFSAGMTHQNGYT
FT                   MANLSARKQFDEGTIRTVGANLSRAISGDTGDDKTLSGGAYAQFDARYASGTLNVNSAA
FT                   DGYVNTNLTANGSVGWQGKNIAASGRTDGNAGVIFNTGLEDDGQISAKINGRIFPLNGK
FT                   RNYLPLSPYGRYEVELQNSKNSLDSYDIVSGRKSHLTLYPGNVAVIEPEVKQMVTVSGR
FT                   IRAEDGTLLANARINNHIGRTRTDENGEFVMDVDKKYPTIDFRYSGNKTCEVALELNQA
FT                   RGAVWVGDVVCSGLSSWAAVTQTGEENES"
FT   gene            complement(346958..347626)
FT                   /gene="ecpB"
FT                   /locus_tag="ECSP_0329"
FT   CDS_pept        complement(346958..347626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpB"
FT                   /locus_tag="ECSP_0329"
FT                   /product="predicted chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70212"
FT                   /protein_id="ACT70212.1"
FT                   /translation="MKKHLLLLALLLSGISPAQALDVGDISSFMNSDSSTLSKTIKNST
FT                   DSGRLINIRLERLSSPLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEK
FT                   ERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQANYHFQYANGTLTNTG
FT                   NATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK
FT                   "
FT   gene            complement(347684..348271)
FT                   /gene="ecpA"
FT                   /locus_tag="ECSP_0330"
FT   CDS_pept        complement(347684..348271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpA"
FT                   /locus_tag="ECSP_0330"
FT                   /product="Mat fimbrillin"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70213"
FT                   /protein_id="ACT70213.1"
FT                   /translation="MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKL
FT                   VVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGST
FT                   LNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGT
FT                   TNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS"
FT   gene            complement(348346..348936)
FT                   /gene="ecpR"
FT                   /locus_tag="ECSP_0331"
FT   CDS_pept        complement(348346..348936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpR"
FT                   /locus_tag="ECSP_0331"
FT                   /product="predicted regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70214"
FT                   /protein_id="ACT70214.1"
FT                   /translation="MTWQNDYSRDYEVENHMECQNRSDKYIWSPHDAYFYKGLSELIVD
FT                   IDRLIYLSLEKIRKDFVFINLNTDSLTEFINRDNEWLSAVKGKQVVLIAARKSEALANY
FT                   WYYNSNIRGVVYAGLSRDIRKELAYVINGRFLRKDIKKDKITDREMEIIRMTAQGMLPK
FT                   SIARIENCSVKTVYTYRRNAEAKLYSKLYKLVQ"
FT   gene            complement(349135..349230)
FT                   /locus_tag="ECSP_0332"
FT   CDS_pept        complement(349135..349230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70215"
FT                   /protein_id="ACT70215.1"
FT                   /translation="MQVRIERYIANNLMKLNVFFFLSKKQYFHFL"
FT   gene            complement(349342..349566)
FT                   /locus_tag="ECSP_0333"
FT   CDS_pept        complement(349342..349566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0333"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70216"
FT                   /protein_id="ACT70216.1"
FT                   /translation="MQCPGKEAIVPVTTGSLRLTSLNLALRGLTGQMTYLHLFNFSSLI
FT                   GMNTHNHFVRHVNPLKHLTDWQIIFNYDS"
FT   gene            349713..349904
FT                   /gene="ykgL"
FT                   /locus_tag="ECSP_0334"
FT   CDS_pept        349713..349904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgL"
FT                   /locus_tag="ECSP_0334"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70217"
FT                   /protein_id="ACT70217.1"
FT                   /translation="MQAASQREETEWRVQSKRGLMPAYRGEAGQQVNINIMEYSERNVR
FT                   QLTLNEQEDTSPGKLMLV"
FT   gene            complement(349974..350114)
FT                   /gene="ykgO"
FT                   /locus_tag="ECSP_0335"
FT   CDS_pept        complement(349974..350114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgO"
FT                   /locus_tag="ECSP_0335"
FT                   /product="putative second copy of 50S ribosomal protein
FT                   L36"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70218"
FT                   /protein_id="ACT70218.1"
FT                   /translation="MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKK
FT                   R"
FT   gene            complement(350114..350377)
FT                   /gene="ykgM"
FT                   /locus_tag="ECSP_0336"
FT   CDS_pept        complement(350114..350377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgM"
FT                   /locus_tag="ECSP_0336"
FT                   /product="predicted ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70219"
FT                   /protein_id="ACT70219.1"
FT                   /translation="MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPYV
FT                   TIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRFVSTKKGA"
FT   mobile_element  350549..352990
FT                   /mobile_element_type="insertion sequence:ISEc8"
FT   gene            350620..351021
FT                   /locus_tag="ECSP_0337"
FT   CDS_pept        350620..351021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0337"
FT                   /product="unknown protein encoded in ISEc8"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70220"
FT                   /protein_id="ACT70220.1"
FT                   /translation="MGTKVSDMQKNVTPGRRKGCPNYPPEFKQQLVAASCEPGISISKL
FT                   ALENGINANLLFKWRQQWREGKLLLPSSESPQLLPVTLDAAAEQPESLAEDPEPLSISC
FT                   EVTFRHGTLRFNGNVSEKLLTLLIQELKR"
FT   gene            351018..351365
FT                   /locus_tag="ECSP_0338"
FT   CDS_pept        351018..351365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0338"
FT                   /product="Transposase ISEc8"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70221"
FT                   /protein_id="ACT70221.1"
FT                   /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFI
FT                   FRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTQAQLAMLLEGIDWRQ
FT                   PKRLLTSLTML"
FT   gene            351415..352953
FT                   /locus_tag="ECSP_0339"
FT   CDS_pept        351415..352953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0339"
FT                   /product="Transposase ISEc8"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70222"
FT                   /protein_id="ACT70222.1"
FT                   /translation="MNDISSDDIFLLKQRLAEQEALIHALQEKLSNREREIDHLQAQLD
FT                   KLRRMNFGSRSEKVSRRIAQMEADLNRLQKESDTLTGRVYDPAVQRPLRQTRTRKPFPE
FT                   SLPRDEKRLLPAAPCCPNCGGSLSYLGEDTAEQLELMRSAFRVIRTVREKHACTQCDAI
FT                   VQAPAPSRPIERGIAGPGLLARVLTSKYAEHTPLYRQSEIYGRQGVELRRSLLSGWVDA
FT                   CCRLLSPLEEALHGYVMTDGKLHADDTPVQVLLPGNKKTKTGRLWAYVRDDRNAGSALA
FT                   PAVWFAYSPDRKGIHPQTHLACFSGVLQADAYAGFNELYRNGGITEAACWAHARRKIHD
FT                   VHVRIPSALTEEALEQIGQLYAIEADIRGMPAEQRLAERQRKTKPLLKSLESWLREKMK
FT                   TLSRHSELAKAFAYALNQWPALTYYANDGWVEIDNNIAENALRAVSLGRKNFLFFGSDH
FT                   GGERGALLYSLIGTCKLNDVDPESYLRHVLGVIADWPVNRVSELLPWRIALPAE"
FT   gene            complement(353765..354907)
FT                   /locus_tag="ECSP_0340"
FT   CDS_pept        complement(353765..354907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0340"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70223"
FT                   /protein_id="ACT70223.1"
FT                   /translation="MTNKHPSLFSPFMLTEKIKLRNRIVMAPMTTWSANPDGTISEQEL
FT                   EFYKRRSQNVGLVITGCTYVTPSGIGFTHEFAAYDDRFINSLEKLAAAAKSGGAPAILQ
FT                   IFHAGNKAIPELVPNNDVISASASSVKSGDFMKRVVQSREMTENEIQETIRAFGDVTKR
FT                   AIKAGFDGIELHGAHGFLLQNFFSPLFNQRNDRWGGDLEGRMRFPLAVLQEVKNVVYEY
FT                   ATKPFAIGYRISPEESATGGLRIEDTYKLLDRLISSGISYIHTSLVSINDSYPVESPNG
FT                   PRTIELILNHIAGRVPVIAAGKIRTPSQAQEAISTGLPLVAIGKGLVINPEWVTLAESG
FT                   RGHEIQTTLNPQLVPELTIPDKLWDQIQASKGTGWFPLMD"
FT   gene            complement(355142..356062)
FT                   /locus_tag="ECSP_0341"
FT   CDS_pept        complement(355142..356062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0341"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70224"
FT                   /protein_id="ACT70224.1"
FT                   /translation="MKTVSIKHTYWDIAADIYFPDDFNSEKKYPAIISAHPIGSCKEQT
FT                   SGSVYGAALAKAGFIVIAFDASFQGSSGGEPRYLEDPTMRVKDFSIVVDYLTSLPYVDA
FT                   GRIGVLGICGGGGYAINAAMTERRIKAIGTVTGANYGRLMREGFTAFNPIGALEAMAQQ
FT                   RTDEANGAKLRVDDLLPSSPDAALEAGLTEIDLFEATEYYRSPRGYAPNGVNRSLFSHQ
FT                   TVAVGWDAFHLAEVLLTQPIMVVVGDRVGAFGAYRDGCEIIGRAASKHKELVVVEGYSH
FT                   YDLYDKPEPVKQALDKLIPFYKTHL"
FT   gene            356156..357145
FT                   /locus_tag="ECSP_0342"
FT   CDS_pept        356156..357145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0342"
FT                   /product="putative LysR-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70225"
FT                   /protein_id="ACT70225.1"
FT                   /translation="MTCIGYHQWSNIYHSVKLRFTMMKIEPSILPSLAWFALIVRAGSF
FT                   SRAASEMGITLAALSQNLKSLEERLNTKLIYRTTRNISLTEEGQRLYEVLVSALGQIDD
FT                   ALKDVGDTQLEPTGLLRINSSRVAARMLVEPHIGEFLTRYPKTKIELIMDDGLSNIIAD
FT                   GCDVGIRLEQGLDEHMTAVPVSPLIKLVTVASPDYLKEHGIPETPQELSNHNCLRLRHK
FT                   SSGALSAWEFSKVVGGNEEFEIEVSGKYISNDDESMIRMALNGTGIIQHLDFAIAEHIN
FT                   AGKLQPILEDWAVSFPGFYIYVSSRVRMPSKVRAFIDFMVEKRVKLEN"
FT   gene            complement(357433..357789)
FT                   /locus_tag="ECSP_0343"
FT   CDS_pept        complement(357433..357789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0343"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70226"
FT                   /protein_id="ACT70226.1"
FT                   /translation="MNKNLILAFALFSLPVFAEEDLGPGKYVCDIRISSLDTATQILSK
FT                   SATVLDNGNNFIVQMPNGDQLYSPDLENVDDGIKQKATIGGVTFIRRPTFNDRFIVEDG
FT                   NTGFFYKMRNCEKK"
FT   gene            357820..357948
FT                   /locus_tag="ECSP_0344"
FT   CDS_pept        357820..357948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0344"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70227"
FT                   /protein_id="ACT70227.1"
FT                   /translation="MLHKKHVNEKSDWLMSNAINPRMAYFSLAAVLNLIEYGQDSD"
FT   gene            complement(357982..358557)
FT                   /locus_tag="ECSP_0345"
FT   CDS_pept        complement(357982..358557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0345"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70228"
FT                   /protein_id="ACT70228.1"
FT                   /translation="MQKVKLNNGIEMPLLGFGVFQMTDAAECERAVIDAINTGYRLIDT
FT                   AASYQNEPQVGNALKQSGIARNELFVTTKLWLQDTSYEGAKAQFERSLNRLQLDYVDLY
FT                   LIHQPYGDVHGAWRAMEELQQAGKIRAIGVSNFHPDRLADLIAFNNVVPAVNQVEVNPF
FT                   NQQLHAVPWMQSRGIQPEAWAPFAVTGR"
FT   gene            359123..363376
FT                   /gene="eaeH"
FT                   /locus_tag="ECSP_0346"
FT   CDS_pept        359123..363376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eaeH"
FT                   /locus_tag="ECSP_0346"
FT                   /product="putative adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70229"
FT                   /protein_id="ACT70229.1"
FT                   /translation="MSRYKTGHKQPRFRYSVLARCVAWANISVQVLFPLAVTFTPVMAA
FT                   RAQHAVQPRLSMGNTTVTADNNVEKNVASFAANAGTFLSSQPDSDATRNFITGMATAKA
FT                   NQEIQEWLGKYGTARVKLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAIHRTDDRTQ
FT                   SNIGFGWRHFSGNDWMAGVNTFIDHDLSRSHTRIGVGAEYWRDYLKLSANGYIRASGWK
FT                   KSPDIEDYQERPANGWDIRAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHAI
FT                   SAEVTYTPVPLLTLSAGHKQGKSGENDTRFGLEVNYRIGEPLAKQLDTDSIRERRVLAG
FT                   SRYDLVERNNNIVLEYRKSEVIRIALPERIEGKGGQTLSLGLVVSKATHGLKNVQWEAP
FT                   SLLAEGGKITGQGSQWQVTLPAYRPGKDNYYAISAVAYDNKGNTSKRVQTEVVITGAGM
FT                   SADRTALTLDGQSRIQMLANGNEQKPLVLSLRDAEGQPVTGMKDQIKTELTFKPAGNIV
FT                   TRSLKATKSQAKPTLGEFTETEAGVYQSVFTTGTQSGEATITVSVDGMSKTVTAELRAT
FT                   MMDVANSTLSANEPSGDVVADGQQAYTLTLTAVDSEGNPVTGEASRLRFVPQDTNGVTV
FT                   GAISEIKPGVYSAAVSSTRAGNVVVRAFSEQYQLGTLQQTLKFVAGPLDAAHSSITLNP
FT                   DKPVVGGTVTAIWTVKDAYDNPVTSLTPEAPSLAGAAAEGSTASGWTNNGDGTWTAQIT
FT                   LGSTAGELEVMPKLNGQNAAANAAKVTVVADALSSNQSKVSVAEDHVKAGESTTVTLVA
FT                   KDAHGNAISGLALSASLTGTASEGATVSSWTEKGNGSYVATLTTGGKTGELRVMPLFNG
FT                   QPAATEAAQLTVIAGEMSSANSTLVADNKAPTVKTTTELTFTVKDAYGNPVTGLKPDAP
FT                   VFSGAASTGSERPSAGNWTEKGNGVYVSTLTLGSAAGQLSVMPRVNGQNAVAQPLVLNV
FT                   AGDASKAEIRDMTVKVNNQLANGQSANQITLTVVDTYGNPLQGQEVTLTLPQGVTSKTG
FT                   NTVTTNAAGKADIELMSTVAGEHNISASVNGAQKTVTVKFNADASTGQANLQVDAAAQK
FT                   VANGKDAFTLTANVEDKNGNPVPGSLVTFNLPRGVKPLTGDNVWVKANDEGKAELQVVS
FT                   VTAGTYEITASAGNSQPSNTQTITFVADKATATVSGIEVIGNYALADGNAKQTYKVTVT
FT                   DANNNLLKDSEVTLTASPANLVLTPNGTAKTNEQGQAIFTATTTVAAKYTLTAKVSQAD
FT                   GQESTKTAESKFVADDKNAVLTASSDVTSLVADGISTAKLEVTLMSANNPVGGNMWVDI
FT                   KTPEGVTEKDYQFLPSKNDHFVSGKITRTFSTSKPGVYTFTFNALTYGGYEMKPVTVTI
FT                   TAVDADTAKGEEAMN"
FT   gene            complement(363497..364387)
FT                   /gene="ykgA"
FT                   /locus_tag="ECSP_0347"
FT   CDS_pept        complement(363497..364387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgA"
FT                   /locus_tag="ECSP_0347"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70230"
FT                   /protein_id="ACT70230.1"
FT                   /translation="MRYDKELTENVMIRQKILQQLLEWIECNLEHPISIEDIAQKSGYS
FT                   RRNIQLLFRNFMHVPLGEYIRKRRLCRAAILVRLTAKSMLDIAISLHFDSQQSFSREFK
FT                   KLFGCSPRVYRHRDYWDLANIFPSFLIRQQQKTECRLVNFPETPIFGNSFKYDIEVSNK
FT                   SPDEEVKLRRHHLARCMKNFKTDIYFVSTFEPSTKSVDLLTVETFAGTVCKQTDSEMPK
FT                   EWTINRGLYASFRYEGEWEHYPEWARNLYLMELPARGLARVNGSDIERFYYNEDFVEKD
FT                   SNDVVCEIFIPVRPV"
FT   gene            364603..365472
FT                   /locus_tag="ECSP_0348"
FT   CDS_pept        364603..365472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0348"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70231"
FT                   /protein_id="ACT70231.1"
FT                   /translation="MEFSVLSNNLKMPMMGFGVFQVTDKNVCKQSVLNAIRTGYRLIDT
FT                   AAVYGNEDAVGEAVREAISEGLCTREELFITSKLWVQDMLNQDTAAAGIEASLKKSGLE
FT                   YFDLYLLHQAMRDYFSAWRALEDAYEEGKLKAIGVSNFYPHVLANFCETVRVKPMVNQV
FT                   ELHPYFAQPEALATMKYYNVQPEAWAPLGGGRHKPFENNLLQSIADAHQKSISQVILRW
FT                   NIQRGVVVIPKSTHQQRIEENFAIWDFSLTEKEMAQISSLDLGYVGESVKHFNPEFVRG
FT                   CLAVKIHD"
FT   gene            complement(365632..366225)
FT                   /gene="ykgB"
FT                   /locus_tag="ECSP_0349"
FT   CDS_pept        complement(365632..366225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgB"
FT                   /locus_tag="ECSP_0349"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70232"
FT                   /protein_id="ACT70232.1"
FT                   /translation="MEKYLHLLSRGDKIGLALIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQSANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSAREILKQGSNESSSTLKTEY"
FT   gene            complement(366237..366473)
FT                   /gene="ykgI"
FT                   /locus_tag="ECSP_0350"
FT   CDS_pept        complement(366237..366473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgI"
FT                   /locus_tag="ECSP_0350"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70233"
FT                   /protein_id="ACT70233.1"
FT                   /translation="MFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASPTVLED
FT                   AIADIARKYNASSWKVTSMRIDNNSTATAVLYK"
FT   gene            complement(366582..367907)
FT                   /gene="ykgC"
FT                   /locus_tag="ECSP_0351"
FT   CDS_pept        complement(366582..367907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgC"
FT                   /locus_tag="ECSP_0351"
FT                   /product="predicted oxidoreductase with FAD/NAD(P)-binding
FT                   domain and dimerization domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70234"
FT                   /protein_id="ACT70234.1"
FT                   /translation="MNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCIN
FT                   IGCIPTKTLVHDAQQHTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVINGQAEFINN
FT                   HSLRVHRPEGNLEIHGEKIFINTGAQTVVPPIPGITTTPGVYDSTGLLNLKELPGHLGI
FT                   LGGGYIGVEFASMFANFGSKVTILEAASLFLPREERDIADNIATILRDQGVDIILNAHV
FT                   ERISHHENQVQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERGAIVVDKRLH
FT                   TTADNIWAMGDVTGGLQFTYISLDDYRIVRDELLGEGKRSTDDRKNVPYSVFMTPPLSR
FT                   VGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRILGASLLCVDS
FT                   HEMINIVKMVMDAGLPYSILRDQIFTHPSMSESLNDLFSLVK"
FT   gene            368133..368987
FT                   /gene="ykgD"
FT                   /locus_tag="ECSP_0352"
FT   CDS_pept        368133..368987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgD"
FT                   /locus_tag="ECSP_0352"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70235"
FT                   /protein_id="ACT70235.1"
FT                   /translation="MDALSRLLMLNAPQGTIDKNCVLGSDWQLPHGAGELSVIRWHALT
FT                   QGAAKLEMPTGEIFTLRPGNVVLLPQNSAHRLSHVDNESTCIVCGTLRLQHSARYFLTS
FT                   LPETLFLAPVNHSVEYNWLREAIPFLQQESRSAMPGVDALCSQICATFFTLAVREWIAQ
FT                   VNTEKNILSLLLHPRLGAVIQQMLEMPGHAWSVESLASIAHMSRASFAQLFRDVSGTTP
FT                   LAVLTKLRLQIAAQMFSREMLPVVVIAESVGYASESSFHKAFVREFGCTPGEYRERVRQ
FT                   LAP"
FT   gene            369514..370233
FT                   /gene="ykgE"
FT                   /locus_tag="ECSP_0353"
FT   CDS_pept        369514..370233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="ECSP_0353"
FT                   /product="predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70236"
FT                   /protein_id="ACT70236.1"
FT                   /translation="MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQP
FT                   AINSGYIKEAIPGMKNLIAALEDNDDPIISPAGSCTYAVKSYPTYLADEPEWASRAEKV
FT                   AARMQDLTSFIVNKLGVVDVGASLQGRAVYHPSCSLARKLGVKDEPLTLLKNVRGLELL
FT                   TFAEQDTCCGFGGTFSVKMAEISGEMVKEKVAHLMEVRPEYLIGADVSCLLNISGRLQR
FT                   EGQKVKVMHIAEVLMSR"
FT   gene            370244..371671
FT                   /gene="ykgF"
FT                   /locus_tag="ECSP_0354"
FT   CDS_pept        370244..371671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="ECSP_0354"
FT                   /product="predicted amino acid dehydrogenase with
FT                   NAD(P)-binding domain and ferridoxin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70237"
FT                   /protein_id="ACT70237.1"
FT                   /translation="MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDEL
FT                   GLWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFAKTKEDATRYILQVAQRK
FT                   NARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRH
FT                   QIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAG
FT                   HVDGPEEFHLVIVDNGRSEVLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYKDFKDLPYACSLCTACDNVCPVRIPLSKLILRHRRVMAEKGITAKAE
FT                   QRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGE
FT                   SFRSWFKKHQAQEKKNG"
FT   gene            371664..372359
FT                   /gene="ykgG"
FT                   /locus_tag="ECSP_0355"
FT   CDS_pept        371664..372359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="ECSP_0355"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70238"
FT                   /protein_id="ACT70238.1"
FT                   /translation="MDNRGEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQ
FT                   RCDAFIQFASDVMLTRCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQ
FT                   QECNAVVWDPAKGAKNISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPESS
FT                   LFILRKSTILPRVAQLAERLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVK
FT                   AVYLIIEDC"
FT   gene            complement(372433..372630)
FT                   /locus_tag="ECSP_0356"
FT   CDS_pept        complement(372433..372630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70239"
FT                   /protein_id="ACT70239.1"
FT                   /translation="MNTNKTLGSNKQHSDRECLYKAEVTMTGKGTRFQEWMPVFFTVNI
FT                   LALVMPGYLQKRSITMTERG"
FT   gene            complement(372605..373270)
FT                   /pseudo
FT                   /locus_tag="ECSP_0357"
FT                   /note="disrupted by in-frame stop codon; hypothetical
FT                   protein"
FT   gene            complement(373455..373640)
FT                   /pseudo
FT                   /locus_tag="ECSP_0358"
FT                   /note="C-terminal fragment; autotransporter"
FT   gene            complement(373618..374712)
FT                   /locus_tag="ECSP_0359"
FT   CDS_pept        complement(373618..374712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0359"
FT                   /product="autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70240"
FT                   /protein_id="ACT70240.1"
FT                   /translation="MKNSKAFYRSALATAIVMALSAPAFAADNAVSTDSVTLNKDKTTL
FT                   DQDVVISNTADKQITAVTINAADEDLNVAFAGHDITAESTADKKFVEGVKVSGNKNVVI
FT                   NATDSTITAQGEGTYVRTAMVIDSTGDVVVNGGNFVAKNEKGSATGISLEGAKGNNVTL
FT                   NGTTINAQGNKSSSNASTAIFAQKGSLLNSFEGDATDNITLAGSNIINGQIETIVTAGN
FT                   KTGIHTVNLNIKDGSVIGAANNKQTIYASASAQGTGSATQNLNLSVADSTIYSDVLALS
FT                   ESENSAATTTNVNMNVARSYWEGNAYTFNSGDKAGSNLDINLSDSSVWKGKVSGAGNAS
FT                   VSLQNESVWNVTGSSTVDALAPSG"
FT   gene            complement(374754..375515)
FT                   /locus_tag="ECSP_0360"
FT   CDS_pept        complement(374754..375515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0360"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70241"
FT                   /protein_id="ACT70241.1"
FT                   /translation="MRFVLFCPSGIVPAQFAALSTGSVGNVTCIGTEEELRNKLRHRPQ
FT                   SVVISAGRPAECAEMWFRFYRDHSFVVVLCVAPFFLPPDVSISGVLKNLRLLKPGMSVE
FT                   HVISIANSSGGLSGLKHAENLPVMDSYSVFMKEVNNRTKTIVMSERFPEKQKKVLSLLL
FT                   AGHSWEYSAQFLKTGIRQIWLAEQSLKKRWGIPDSMSLREALLLSSNKFHGDGNALEKT
FT                   NAMTLRENGNTNRYSVVVNAGTQVLSLHKYK"
FT   gene            complement(375669..376253)
FT                   /locus_tag="ECSP_0361"
FT   CDS_pept        complement(375669..376253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70242"
FT                   /protein_id="ACT70242.1"
FT                   /translation="MRSDAGQWQVCLTGDSDWFDNAPAASLYNGFPRIGTMLTASRYQN
FT                   QIIRWLLRPLPGDMSDFWLLTARELSVLKILMQGMSFSEIARYEQRSSKTLHAIATRAL
FT                   MKLGLGTLSDFRLLYTGCGDSRVKRNIRLHARYVGQHSAHRLTQYVQNMVSGILYPEKV
FT                   AVGESINSDAISGKVLPGQRKNISKKRPGLL"
FT   gene            complement(376345..376482)
FT                   /locus_tag="ECSP_0362"
FT   CDS_pept        complement(376345..376482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70243"
FT                   /protein_id="ACT70243.1"
FT                   /translation="MAWTSLNEEASGYYQCLSVYQAGTGVSHPSGQVYRAGVQQRHYRG
FT                   "
FT   gene            complement(376796..377355)
FT                   /pseudo
FT                   /locus_tag="ECSP_0363"
FT                   /note="a single nucleotide deletion after codon 113
FT                   relative to ipbA in Escherichia coli CFT073 results in a
FT                   frameshift leading to termination after codon 127;
FT                   site-specific recombinase, phage integrase family"
FT   gene            377599..377733
FT                   /locus_tag="ECSP_0364"
FT   CDS_pept        377599..377733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70244"
FT                   /protein_id="ACT70244.1"
FT                   /translation="MCVTSNVLVMFSSFEIFDVISYKVVFIVYFIDFICILSFNEVIV"
FT   gene            378162..378413
FT                   /locus_tag="ECSP_0365"
FT   CDS_pept        378162..378413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0365"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70245"
FT                   /protein_id="ACT70245.1"
FT                   /translation="MLTVSGSEQVTIARNTSGVILKLSGISPAVYQCIHSTFISEIERV
FT                   SLEFAGEVVTMKHESYPYVLYNDSVPIPGTVTLNLIGS"
FT   gene            complement(378415..380103)
FT                   /gene="betA"
FT                   /locus_tag="ECSP_0366"
FT   CDS_pept        complement(378415..380103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="ECSP_0366"
FT                   /product="choline dehydrogenase, a flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70246"
FT                   /protein_id="ACT70246.1"
FT                   /translation="MQFDYIIIGAGSAGNVLATRLTEDPNTSVLLLEAGGPDYRFDFRT
FT                   QMPAALAFPLQGKRYNWAYETEPEPFMNNRRMECGRGKGLGGSSLINGMCYIRGNAMDL
FT                   DNWAKEPGLENWSYLDCLPYYRKAETRDVGENDYHGGDGPVSVTTSKPGVNPLFEAMIE
FT                   AGVQAGYPRTDDLNGYQQEGFGPMDRTVTPQGRRASTARGYLDQAKSRPNLTIRTHAMT
FT                   DHIIFDCKRAVGVEWLEGDSTIPTRATANKEVLLCAGAIASPQILQRSGVGNAELLAEF
FT                   DIPLVHDLPGVGENLQDHLEMYLQYECKEPVSLYPALQWWNQPKIGAEWLFGGTGVGAS
FT                   NHFEAGGFIRSREEFAWPNIQYHFLPVAINYNGSNAVKEHGFQCHVGSMRSPSRGHVRI
FT                   KSRDPHQHPAILFNYMSHEQDWQEFRDAIRITREIMHQPALDQYRGREISPGTECQTDE
FT                   QLDEFVRNHAETAFHPCGTCKMGYDEMSVVDGEGRVHGLEGLRVVDASIMPQIITGNLN
FT                   ATTIMIGEKMADMIRGKEALPRSTAGYFVANGMPVRAKKMSRDLN"
FT   gene            complement(380117..381589)
FT                   /gene="betB"
FT                   /locus_tag="ECSP_0367"
FT   CDS_pept        complement(380117..381589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="ECSP_0367"
FT                   /product="betaine aldehyde dehydrogenase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70247"
FT                   /protein_id="ACT70247.1"
FT                   /translation="MSRMAEQQLYIHGGYTSATSGRTFETINPANGNVLATVQAAGRED
FT                   VDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLETLDTGKAYSETSTV
FT                   DIVTGADVLEYYAGLIPSLEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWKS
FT                   APALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEHPGI
FT                   AKVSFTGGVASGKKVMANSAASSLKEVTMELGGKSPLIVFDDADLDLAADIAMMANFFS
FT                   SGQVCTNGTRVFVPAKCNAAFEQKILARVERIRAGDVFDPQTNFGPLVSFPHRDNVLRY
FT                   IAKGKEEGARVLCGGDVLKGDGLDNGAWVAPTVFTDCSDEMTIVREEIFGPVMSILTYE
FT                   SEDEVIRRANDTDYGLAAGIVTADLNRAHRVIHQLEAGICWINTWGESPAEMPVGGYKH
FT                   SGIGRENGVMTLQSYTQVKSIQVEMAKFQSIF"
FT   gene            complement(381603..382190)
FT                   /gene="betI"
FT                   /locus_tag="ECSP_0368"
FT   CDS_pept        complement(381603..382190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="ECSP_0368"
FT                   /product="DNA-binding transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70248"
FT                   /protein_id="ACT70248.1"
FT                   /translation="MPKLGMQSIRRRQLIDATLEAINEVGMHDATIAQIARRAGVSTGI
FT                   ISHYFRDKNGLLEATMRDITSQLRDAVLNRLHALPQGSAEQRLQAIVGGNFDETQVSSA
FT                   AMKAWLAFWASSMHQPMLYRLQQVSSRRLLSNLVSEFRRELPRHQAQEAGYGLAALIDG
FT                   LWLRAALSGKPLDKPLAHSLTRHFITQHLPTD"
FT   gene            382319..384352
FT                   /gene="betT"
FT                   /locus_tag="ECSP_0369"
FT   CDS_pept        382319..384352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="ECSP_0369"
FT                   /product="choline transporter of high affinity"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70249"
FT                   /protein_id="ACT70249.1"
FT                   /translation="MTDLSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGR
FT                   TLDWVSKTFGWYYLLAATLYIVFVVCIACSRFGSVKLGPEQSKPEFSLLSWAAMLFAAG
FT                   IGIDLMFFSVAEPVTQYMQPPEGAGQTIEAARQAMVWTLFHYGLTGWSMYALMGMALGY
FT                   FSYRYNLPLTIRSALYPIFGKRINGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLS
FT                   VLFDIPDSMAAKAALIALSVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDT
FT                   SFLLNALVLNVGDYVNRFMGMTLNSFAFDRPVEWMNNWTLFFWAWWVAWSPFVGLFLAR
FT                   ISRGRTIRQFVLGTLIIPFTFTLLWLSVFGNSALYEIIHGGAAFAEEAMVHPERGFYSL
FT                   LAQYPAFTFSASVATITGLLFYVTSADSGALVLGNFTSQLKDINSDAPGWLRVFWSVAI
FT                   GLLTLGMLMTNGISALQNTTVIMGLPFSFVIFFVMAGLYKSLKVEDYRRESANRDTAPR
FT                   PLGLQDRLSWKKRLSRLMNYPGTRYTKQMMETVCYPAMEEVAQELRLRGAYVELKSLPP
FT                   EEGQQLGHLDLLVHMGEEQNFVYQIWPQQYSVPGFTYRARSGKSTYYRLETFLLEGSQG
FT                   NDLMDYSKEQVITDILDQYERHLNFIHLHREAPGHSVMFPDA"
FT   gene            384860..388909
FT                   /locus_tag="ECSP_0370"
FT   CDS_pept        384860..388909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0370"
FT                   /product="putative beta-barrel outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70250"
FT                   /protein_id="ACT70250.1"
FT                   /translation="MAFNALLFMQSWFYLDVLLEIVMNKIYRLKWNRSRNCWSVCSELG
FT                   SRVKGKKSRAVLISAISLYSSLVFADDVIVNQDKTIDFGKENQSIDYRITVTDNANLVI
FT                   NATDTSRPRLTLASGGGLDITGGKVTINGPLNFLLKGTGFLNVSNAGSELYADDLYESN
FT                   SGMRHDRGYFNVSNGGKIHVKGTSRLTYLQGNVSGEGSQVNSETFFMGVYGSYGGNQYL
FT                   SVNNGGEVNARKQISLGYYDQVSDTTLAVSEGGKISAPTISLSTNSELALGAQEGSAAK
FT                   AAGIIDAEKIEFVWAKTSEKKITLNHTDKDATISADIVSGSEGLGYINALNGTTYLTGD
FT                   NSAFSGKVKIEQNGALGITQNIGTAEINNRGKLHLKADDSMTFANKISGNGTISIDSGT
FT                   VELTGNNYAFSGYIDVASGAVAVISEDKNIGRAELDVDGKLQINANKDWVFDNDLEGRG
FT                   IVEINMGNHEFSFDEFAYTDWFQGSLAFQNTTFNLEKNAEFLQKGGITAGQGSLVTVGK
FT                   GAHSISTLGFSGGTVDFGALTAGAQMTEGTVNVSKTLDLRGEGVIQVSDSDVVRSVSRD
FT                   IDSALSLTEVDDGNSTIKLVDAQGAEVLGDAGNLQLQDKNGQILSSSAQRDIQQNGQKA
FT                   AVGTYDYRLTSGVNNDGLYIGYGLTQLDLHATDSDALVLSSNGKSENAADLSAKITGSG
FT                   DLAFSSQKGQTVSLSNKDNDYTGVTDLRSGTLLLNNDNVLGNTHELRLAAETELDMNGH
FT                   SQTVGTLNGSADSLLSLNGGSLTVTNGGTSTGSLTGSGELNIQGGTLDIAGDNSNLTAN
FT                   VNIANSANVLVSHAQGLGSANVENNGTLALNNSAEKRAAASVNYALGGNLTNNGTLMTG
FT                   MSGQQAGNVLVVKGNYHGNNGQLVMNTVLNGDDSVTDKLVVEGDTSGTTAVTVNNAGGT
FT                   GAKTLNGIELIHVDGKSEGEFVQAGRIVAGAYDYTLARGQGANSGNWYLTSGSDSPELQ
FT                   PEPDPMPNPEPNPNPEPNPNPTPTPGPDLNVDNDLRPEAGSYIANLAAANTMFTTRLHE
FT                   RLGNTYYTDMVTGEQKQTTMWMRHEGGHNKWRDGSGQLKTQSNRYVLQLGGDVAQWSQN
FT                   GSDRWHVGVMAGYGNSDSKTISSRTGYRAKASVNGYSTGLYATWYADDESRNGAYLDSW
FT                   AQYSWFDNTVKGDDLQSESYKSKGFTASLEAGYKHKLAEFNGSQGTRNEWYVQPQAQVT
FT                   WMGVKADKHRESNGTLVHSNGDGNVQTRLGVKTWLKSHHKMDDGKSREFQPFVEVNWLH
FT                   NSKDFSTSMDGVSVTQDGARNIAEIKTGVEGQLNANLNVWGNVGVQVADRGYNDTSAMV
FT                   GIKWQF"
FT   gene            389051..390139
FT                   /gene="yahA"
FT                   /locus_tag="ECSP_0371"
FT   CDS_pept        389051..390139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahA"
FT                   /locus_tag="ECSP_0371"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70251"
FT                   /protein_id="ACT70251.1"
FT                   /translation="MASHDLSVFLEEFGATVNLTLPGIVSEKERLLLKLLMEGMSVTEI
FT                   SQYRNRSAKTISHQKKQLYEKLGIQSDITFWRDIFFQYHPQVISGTGNKNNFYIPDNRC
FT                   HHIVTPEAISLALENHEFKPWIQPVFCAQTGVLTGCEVLVRWEHPQTGIIPPDQFIPLA
FT                   ESSGLIVIMTRQLMKQTADILMPVKHLLPDNFHIGINVSAGCFLAAGFEKECLNLVKKL
FT                   GNDKIKLVLELTERNPIPVTPEARAIFDSLHQHNITFALDDFGTGYATYRYLQAFPVDF
FT                   IKIDKSFVQMAGVDEISGHIVDNIVELARKPGLSIVAEGVETQEQADLMIGKGVHFLQG
FT                   YLYSPPVPGNKFISEWVMKAGG"
FT   gene            complement(390184..391112)
FT                   /pseudo
FT                   /locus_tag="ECSP_0372"
FT                   /note="frameshift mutation; transcriptional regulator, LysR
FT                   family"
FT   gene            complement(391204..391506)
FT                   /locus_tag="ECSP_0373"
FT   CDS_pept        complement(391204..391506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70252"
FT                   /protein_id="ACT70252.1"
FT                   /translation="MVWAFFAALAAGWLASVSGLSAFWASVITTVPFSAVVVWQGRFWL
FT                   LSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKRDGY"
FT   gene            391969..392574
FT                   /gene="yahD"
FT                   /locus_tag="ECSP_0374"
FT   CDS_pept        391969..392574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="ECSP_0374"
FT                   /product="predicted transcriptional regulator with ankyrin
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70253"
FT                   /protein_id="ACT70253.1"
FT                   /translation="MSIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCDRQGKTAITL
FT                   ASLYQQYACVQALIDAGADINKQDHTCLNPFLISCLNGDLTLLRIILPAKPDLNCVTRF
FT                   GGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLL
FT                   LEHGASPHLTDKYGKTPLELARERGFEEIAQLLIAAGA"
FT   gene            392614..393477
FT                   /gene="yahE"
FT                   /locus_tag="ECSP_0375"
FT   CDS_pept        392614..393477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="ECSP_0375"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70254"
FT                   /protein_id="ACT70254.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   RLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVIDKQNIASA
FT                   VASMMGLGIGLTPSADDYLTGLALILFISGHPAGKYKEEFYLGLQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
FT   gene            393467..395014
FT                   /gene="yahF"
FT                   /locus_tag="ECSP_0376"
FT   CDS_pept        393467..395014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="ECSP_0376"
FT                   /product="predicted acyl-CoA synthetase with NAD(P)-binding
FT                   domain and succinyl-CoA synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70255"
FT                   /protein_id="ACT70255.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPELEQAKNGDLMIVINGKSGADNEQLLVEIEELFNTKAQSGSHEARYATI
FT                   ASAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIALISKPPAPAVARKVLERARACRKPVVVC
FT                   FLGRGETPVDEQGLQFARGTKEAALKAVMLSGVKQEHLDLHTLNQPLITDVRARLKPQQ
FT                   KYIRGLFCGGTLCDETMFAVMEKHSDVYSNIQPDPEFRLKDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIEAIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
FT   gene            395014..396432
FT                   /gene="yahG"
FT                   /locus_tag="ECSP_0377"
FT   CDS_pept        395014..396432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="ECSP_0377"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70256"
FT                   /protein_id="ACT70256.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQFDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKIAAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   ITWEKMCGAMKGAVTGALVFEGLAKDLDEAAELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNIAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPILRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVAQQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   GENPNVTIPLLGFMGVPSAVDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
FT   gene            396451..396915
FT                   /locus_tag="ECSP_0378"
FT   CDS_pept        396451..396915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70257"
FT                   /protein_id="ACT70257.1"
FT                   /translation="MRRERLIRPTNGARICRPDKRSASGICHHCRMRRERLIRPTSGAR
FT                   ICRPDKRSASGIYHHCRMRRERLIRPTNGARICRPDKRSASGICHHCRMRRERLIRPTN
FT                   GTRIVGLISVAHQAFVTIAGCGVNALSGLRMAREFVGLVSVAHQAVWRWS"
FT   gene            396947..397897
FT                   /gene="yahI"
FT                   /locus_tag="ECSP_0379"
FT   CDS_pept        396947..397897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="ECSP_0379"
FT                   /product="predicted carbamate kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70258"
FT                   /protein_id="ACT70258.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGAFFSESQRDELQKANPDWRFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTDAGDYQSVDAVIDKDLSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPEKQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
FT   gene            397907..399289
FT                   /gene="yahJ"
FT                   /locus_tag="ECSP_0380"
FT   CDS_pept        397907..399289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="ECSP_0380"
FT                   /product="predicted deaminase with metallo-dependent
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70259"
FT                   /protein_id="ACT70259.1"
FT                   /translation="MKENNSRREFLSQSGKMVTAAALFGTSVPLAHAAVSGTTNCEANN
FT                   TMKITDPHYYLDNVLLETGFDYENGVAVQTRTARQTVEIQNGKIVALRENKQHPDATLP
FT                   HYDAGDKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGL
FT                   LLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   SGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELAHRMAAQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
FT   gene            399588..399998
FT                   /locus_tag="ECSP_0381"
FT   CDS_pept        399588..399998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0381"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70260"
FT                   /protein_id="ACT70260.1"
FT                   /translation="MTIKEKFSQKYPHASFCTFGDSAALADHLATLIATGVKTASCGSL
FT                   AGCIEDNAFPMIGEYKIVENSRGEPVCVIRVIGLHLLRFSDVTAELARKEGEGDLSLEY
FT                   WRNEHRRFFQAEGSYSPEMDVIFEEYALIDVV"
FT   gene            complement(400026..400127)
FT                   /locus_tag="ECSP_0382"
FT   CDS_pept        complement(400026..400127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70261"
FT                   /protein_id="ACT70261.1"
FT                   /translation="MVINMDKTGSNNKCDIHHVKNSKINKISDILCL"
FT   gene            400249..401235
FT                   /locus_tag="ECSP_0383"
FT   CDS_pept        400249..401235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0383"
FT                   /product="putative periplasmic binding protein, probable
FT                   substrate ribose"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70262"
FT                   /protein_id="ACT70262.1"
FT                   /translation="MMNKRFVINMVSSLLLGAALISAPLQAAEKVVVNISKVDGMPWFN
FT                   RMGEGVVEAGKAFGVNASQVGPSSTDAPQQVKIIEDLIARKVNAITIVPNDANVLEPVF
FT                   KKARDAGIVVLTNESPGQPSANWDIEIIDNEKFAAEYVEHMAKRMGGKGGYVIYVGSLT
FT                   VPQHNLWADLLVKYQKEHYPDMHEVTRRMPVAESVDVSRRTTLDLMKTYPDLKAVVSFG
FT                   SNGPIGAGRAVKEKRAKNKVAVYGMMIPSQAASLIKSGDITEGITYDPASAGYALAAVA
FT                   STLLKGEEIKPGLEMQNLGKADVDMDKRIIRFHKVLLVNKDNIDSLY"
FT   gene            401284..402768
FT                   /locus_tag="ECSP_0384"
FT   CDS_pept        401284..402768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0384"
FT                   /product="carbohydrate uptake transporter-2 (CUT2) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70263"
FT                   /protein_id="ACT70263.1"
FT                   /translation="METFLSLRHINKTFHATRALRDVSLDFMSGEVHCLAGQNGCGKST
FT                   LIKIMSGVYRPDEGAEITLGGKNWSKLTPAASVAQGIQVIYQDLSLFPNLSVWENIAVN
FT                   HYHHGLFVNRRRLREVAQAAMTSINVTLPLDTLVSELSIARCQLVAICRALAQDARLIV
FT                   MDEPTASLTHQEVQGLLQVVHQLRERGICVVFVSHRLEEVMEVSDRISVLKDGELVGTF
FT                   PAAEMTTKQLGFLMTGQEFEYQVRELWQGKSSTPVLEVRNLSRHGEYLNINLRVEAGEV
FT                   VSIVGLLGAGRTELCLSLFGMTRPDAGEILINGQLVTLHSNQDAIRHGIGYVSEDRMSR
FT                   GLVMAQSIEDNIISTVFHKVKDRFGFLSETKVRDLVDRLIKALTIKVSDPHLPVNTLSG
FT                   GNAQRVSIAKWLAIGPRLLILDSPTVGVDIANKAGIYGIISDLAAHGIAVLMICDEIEE
FT                   AWYQSHRILVMQKGQITHSFLPDSSSQARIAEVVNG"
FT   gene            402761..403732
FT                   /locus_tag="ECSP_0385"
FT   CDS_pept        402761..403732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0385"
FT                   /product="putative permease component of transport system,
FT                   probably ribose specific"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70264"
FT                   /protein_id="ACT70264.1"
FT                   /translation="MAELKKRHEFWLALLIVVLFVGLAWRSDEFLTFGNLYDLANNYAM
FT                   LTILACGLFVVLISGGIDISFPAMTIIAQYGMVLLLQKIGGNFAVAFALAGCIGILLGL
FT                   INALLVNRLRVPSIIITISTLNIFYGLLLWLSKGVWLYDFPPWFEQGVMLFKYTDADGY
FT                   DYGLGLPLIAMITVVLLTAFIMNFTSVGRKIYALGGNRESASRIGFSVLKLQLFVYGYM
FT                   GLMSGAAGVVQSWTVMTVAPDSLLGYELTVLAAVVLGGTSLLGGRGTLTGTLLGVVLLA
FT                   VMQNGLNLLGVSSYWQTLITGIIIVASISATAWSQHQNRSLL"
FT   gene            403729..404685
FT                   /locus_tag="ECSP_0386"
FT   CDS_pept        403729..404685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0386"
FT                   /product="putative permease component of transport system,
FT                   probably ribose specific"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70265"
FT                   /protein_id="ACT70265.1"
FT                   /translation="MKKSWRNNVEFYLIGLLVLTVAAFSITMPEIFWSISNFQSVASQM
FT                   PVLGILALAMAVTMLCGGINLSIIATANACSLVMAWVATQYPPGIATVVATLLAGAGAA
FT                   VIIGLCNGVLIAGIRVLPILATLGMMTLLKGINILVTGGSAIANYPSWVLWLNHAQWFG
FT                   IPLPMWLFAAVALGLWILLEKTPLGKAIYLIGSNERATLYSGINTRRVLIWVYVISALL
FT                   CAVAAFLMMSKLNSAKASYGESYLLVSILAAVLGGVNPDGGSGRIIGMVLALFLLQIIE
FT                   SGFNILGISPYLTMALWGTLLLCFIQARGMLGLDRVV"
FT   gene            404772..405821
FT                   /gene="yahK"
FT                   /locus_tag="ECSP_0387"
FT   CDS_pept        404772..405821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahK"
FT                   /locus_tag="ECSP_0387"
FT                   /product="predicted oxidoreductase, Zn-dependent and
FT                   NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70266"
FT                   /protein_id="ACT70266.1"
FT                   /translation="MKIKAVGSYSAKQPLEPMDITRREPGPNDVKIEIAYCGVCHSDLH
FT                   QVRSEWAGTVYPCVPGHEIVGRVVAVGDQVEKHAPGDLVGVGCIVDSCKHCEECEDGLE
FT                   NYCDHMTGTYNSPTPDEPGHTLGGYSQQIVVHERYVLRIRHPQEQLAAVAPLLCAGITT
FT                   YSPLRHWQAGPGKKVGVVGIGGLGHMGIKLAHAMGAHVVAFTTSEAKREAAKALGADEV
FT                   VNSRNADEMAAHLKSFDFILNTVAAPHNLDDFTTLLKRDGTMTLVGAPATPHKSPEVFN
FT                   LIMKRRAIAGSMIGGIPETQEMLDFCAEHGIVADIEMIRADQINEAYERMLRGDVKYRF
FT                   VIDNRTLTD"
FT   gene            406064..406879
FT                   /gene="yahL"
FT                   /locus_tag="ECSP_0388"
FT   CDS_pept        406064..406879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahL"
FT                   /locus_tag="ECSP_0388"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70267"
FT                   /protein_id="ACT70267.1"
FT                   /translation="MISLKAPHNNLMPYTQQSILNTVKNNQLPEDIKSSLVSCVDIFKV
FT                   LIKQYYDYPYDCRDDLVDDDKLIHLMAAVRDCEWSDDNALTINVQFNDFPGFYDWMDYP
FT                   DHPVKFVFRILENQKGTVWVYDQDDAFLDIKANVQAGRFTGLKKLVQFINSVRTDCKCI
FT                   LLEHHMPLLRLFPKGKECMHVEKWLREMSSIPETDAPIKQALAHGLLLHLKNIYPVFPE
FT                   SLVMLLLSVLDVKTYRDDARLNEGISNRVQELGDRYYPVNKHVKIRYTL"
FT   gene            407295..407537
FT                   /pseudo
FT                   /locus_tag="ECSP_0389"
FT                   /note="disrupted by in frame stop codon; hypothetical
FT                   protein"
FT   gene            complement(407557..408228)
FT                   /gene="yahN"
FT                   /locus_tag="ECSP_0390"
FT   CDS_pept        complement(407557..408228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="ECSP_0390"
FT                   /product="neutral amino-acid efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70268"
FT                   /protein_id="ACT70268.1"
FT                   /translation="MMQLVHLFMDEITMDPLHAVYLTVGLFVITFFNPGANLFVVVQTS
FT                   LASGRRAGVLTGLGVALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCS
FT                   MRRQSTPQMSTLQQPINAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARL
FT                   MAWAGIVLASIIWRVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQ
FT                   R"
FT   gene            408375..408650
FT                   /gene="yahO"
FT                   /locus_tag="ECSP_0391"
FT   CDS_pept        408375..408650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="ECSP_0391"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70269"
FT                   /protein_id="ACT70269.1"
FT                   /translation="MKIISKMLVGALAFAVTNVYAAELMTKAEFEKVESQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTADIYKKK"
FT   gene            complement(408748..410334)
FT                   /gene="prpR"
FT                   /locus_tag="ECSP_0392"
FT   CDS_pept        complement(408748..410334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="ECSP_0392"
FT                   /product="DNA-binding transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70270"
FT                   /protein_id="ACT70270.1"
FT                   /translation="MAHPPRLNDDKPVIWTVSVTRLFELFRDISLEFDHLANITPIQLG
FT                   FEKAVTYIRKKLANERCDAIIAAGSNGAYLKSRLSVPVILIKPSGYDVLQALAKAGKLT
FT                   SSIGVVTYQETIPALVAFQKTFNLRLDQRSYITEEDARGQINELKANGTEAVVGAGLIT
FT                   DLAEEAGMTGIFIYSAATVRQAFSDALDMTRMSLRHNTHDATRNALRTRYVLGDMLGQS
FT                   PQMEQVRQTILLYARSSAAVLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAV
FT                   NCGAIAESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQTRLL
FT                   RVLEEKEVTRVGGHQPVPVDVRVISATHCNLEEDMRQGQFRRDLFYRLSILRLQLPPLR
FT                   ERVADILPLAESFLKVSLAALSAPFSAALRQGLQASETVLVHYDWPGNIRELRNMMERL
FT                   ALFLSVEPTPDLTPQFLQLLLPELARESAKIPAPRLLTPQQALEKFNGDKTAAANYLGI
FT                   SRTTFWRRLKS"
FT   gene            410573..411463
FT                   /gene="prpB"
FT                   /locus_tag="ECSP_0393"
FT   CDS_pept        410573..411463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="ECSP_0393"
FT                   /product="2-methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70271"
FT                   /protein_id="ACT70271.1"
FT                   /translation="MSLHSPGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLS
FT                   GGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVDADIGFGSSAFNVARTVKSM
FT                   IKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAKTDPDFVIMARTDALA
FT                   VEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQVPILANITEFGATPLFTT
FT                   DELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYH
FT                   YEEKLDDLFVRSQAK"
FT   gene            411619..412788
FT                   /gene="prpC"
FT                   /locus_tag="ECSP_0394"
FT   CDS_pept        411619..412788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="ECSP_0394"
FT                   /product="2-methylcitrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70272"
FT                   /protein_id="ACT70272.1"
FT                   /translation="MSDTTILQNSTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYR
FT                   GYDILDLAEHCEFEEVAHLLIHGKLPTRDELAAYKTKLKALRGLPANVRTVLEALPAAS
FT                   HPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPE
FT                   TDDDSIGGHFLHLLHGEKPSQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDMYSA
FT                   IIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVESKEVVIGFGHPVYTIAD
FT                   PRHQVIKRVAKQLSQEGGSLKMYNIADRLETVMWESKKMFPNLDWFSAVSYNMMGVPTE
FT                   MFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYVGPEDRQFVALDKRQ"
FT   gene            412822..414273
FT                   /gene="prpD"
FT                   /locus_tag="ECSP_0395"
FT   CDS_pept        412822..414273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="ECSP_0395"
FT                   /product="2-methylcitrate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70273"
FT                   /protein_id="ACT70273.1"
FT                   /translation="MSAQINNIRPEFDREIVDIVDYVMNYEISSKVAYDTAHYCLLDTL
FT                   GCGLEALEYPACKKLLGPIVPGTVVPNGVRVPGTQFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRNAVASGKAPLTMKQVLTGMIKAHEIQGCIALENS
FT                   FNRVGLDHVLLVKVASTAVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKS
FT                   WAAGDATSRAVRLALMAKTGEMGYPSALTAPVWGFYDVSFKGESFRFQRPYGSYVMENV
FT                   LFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVSIRTHEACIRIIDKKGPLNN
FT                   PADRDHCIQYMVAIPLLFGRLTAADYEDNVAQDKRIDALREKINCFEDPVFTADYHDPE
FT                   KRAIANAITLEFTDGTRFEEVVVEYPIGHARRRQDGIPKLVDKFKINLARQFPTRQQQR
FT                   ILEVSLDRARLEQMPVNEYLDLYVI"
FT   gene            414313..416199
FT                   /gene="prpE"
FT                   /locus_tag="ECSP_0396"
FT   CDS_pept        414313..416199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="ECSP_0396"
FT                   /product="predicted propionyl-CoA synthetase with ATPase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70274"
FT                   /protein_id="ACT70274.1"
FT                   /translation="MSFSEFYQRSINEPEQFWAEQARRIDWQTPFTQTLDHSNPPFARW
FT                   FCEGRTNLCHNAIDRWLEKQPEALALIAVSSETEEERTFTFRQLHDEVNAVASMLRSLG
FT                   VQRGDRVLVYMPMIAEAHITLLACARIGAIHSVVFGGFASHSVAARIDDAKPVLIVSAD
FT                   AGARGGKIIPYKKLLDDAISQAQHQPRHVLLVDRGLAKMARVSGRDVDFASLRHQHIGA
FT                   RVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTWPDCGVWWKIVEKYQVSRMFSAPTAIRVL
FT                   KKFPTAEIRKHDLSSLEVLYLAGEPLDEPTASWVSNTLDVPVIDNYWQTESGWPIMAIA
FT                   RGLDDRPTRLGSPGVPMYGYNVQLLNEVTGEPCGVNEKGMLVVEGPLPPGCIQTIWGDD
FT                   DRFVKTYWSLFSRPVYATFDWGIRDADGYHFILGRTDDVINVAGHRLGTREIEESISSH
FT                   PGVAEVAVVGVKDALKGQVAVAFVIPKESDSLEDRDVAHSQEKAIMALVDSQIGNFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLNQIRQAMEE"
FT   gene            complement(416468..416746)
FT                   /locus_tag="ECSP_0397"
FT   CDS_pept        complement(416468..416746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70275"
FT                   /protein_id="ACT70275.1"
FT                   /translation="MIRRISVASGTEHGVGCGASALSDLRFRPVGMIRRISVASGICAW
FT                   CRMRRERLIRPTVQACRHDKTRLRRIRHRRMVSNAARAPYPTYGSGL"
FT   gene            417093..418352
FT                   /gene="codB"
FT                   /locus_tag="ECSP_0398"
FT   CDS_pept        417093..418352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="ECSP_0398"
FT                   /product="cytosine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70276"
FT                   /protein_id="ACT70276.1"
FT                   /translation="MSQDNNFSQGPVPQSARKGVLALTFVMLGLTFFSASMWTGGTLGT
FT                   GLSYHDFFLAVLIGNLLLGIYTSFLGYIGAKTGLTTHLLARFSFGVKGSWLPSLLLGGT
FT                   QVGWFGVGVAMFAIPVGKATGLDINLLIAVSGLLMTVTVFFGISALTVLSLIAVPAIAC
FT                   LGGYSVWLAVNGMGGLDALKAVVPAQPLDFNVALALVVGSFISAGTLTADFVRFGRNAK
FT                   LAVLVAMVAFFLGNSLMFIFGAAGAAALGMADISDVMIAQGLLLPAIVVLGLNIWTTND
FT                   NALYASGLGFANITGMSSKTLSVINGIIGTVCALWLYNNFVGWLTFLSAAIPPVGGVII
FT                   ADYLMNRRRYEHFATTRMMSVNWVAILAVALGIAAGHWLPGIVPVNAVLGGALSYLILN
FT                   PILNRKTTAAMTHVEANSVE"
FT   gene            418342..419625
FT                   /gene="codA"
FT                   /locus_tag="ECSP_0399"
FT   CDS_pept        418342..419625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="ECSP_0399"
FT                   /product="cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70277"
FT                   /protein_id="ACT70277.1"
FT                   /translation="MSNNALQTIINARLPGKEGLWQIHLQDGKISAIDAQSGVMPITEN
FT                   SLDAEQGLVIPPFVEPHIHLDTTQTAGQPNWNQSGTLFEGIERWAERKALLTHDDVKQR
FT                   AWQTLKWQIANGIQHVRTHVDVSDATLTALKAMLEVKLEVAPWIDLQIVAFPQEGILSY
FT                   PNGEALLEEALRLGADVVGAIPHFEFTREYGVESLHKTFALAQKYDRLIDVHCDEIDDE
FT                   QSRFVETVAALAHREGMGARVTASHTTAMHSYNGAYTSRLFRLLKMSGINFVANPLVNI
FT                   HLQGRFDTYPKRRGITRVKEMLESGINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQ
FT                   LMGYGQINDGLNLITHHSARTLNLQDYSIAAGNSANLIILPAENGFDALRRQVPVRYSV
FT                   RGGKVIASTQPAQTTVYLEQPEAIDYKR"
FT   gene            complement(419758..420657)
FT                   /gene="cynR"
FT                   /locus_tag="ECSP_0400"
FT   CDS_pept        complement(419758..420657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynR"
FT                   /locus_tag="ECSP_0400"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70278"
FT                   /protein_id="ACT70278.1"
FT                   /translation="MLSRHINYFLAVAEHGSFTRAASALHVSQPALSQQIRQLEESLGV
FT                   PLFDRSGRTIHLTDAGEVWRQYASRALQELGAGKRAIHDVADLTRGSLRIAVTPTFTSY
FT                   FIGPLMADFYARYPGITLQLQEMSQEKIEDLLCRDELDVGIAFAPVHLPELEAIPLLTE
FT                   SLALVVAQHHPLAACEQVALSRLHDEKLVLLSAEFATREQIDHYCEKAGLHPQVVIEAN
FT                   SISAVLELIRRTSLSTLLPAAIATQHDGLKAIPLAPPLLERTAVLLRRKNSWQTAAAKA
FT                   FLHMALEECADVGENESR"
FT   gene            420767..421426
FT                   /gene="cynT"
FT                   /locus_tag="ECSP_0401"
FT   CDS_pept        420767..421426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="ECSP_0401"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70279"
FT                   /protein_id="ACT70279.1"
FT                   /translation="MKEIIDGFLKFQREAFPKREALFKQLATQQSPRTLFISCSDSRLV
FT                   PELVTQREPGDLFVIRNAGNIVPSYGPEPGGVSASVEYAVAALRVSDIVICGHSNCGAM
FT                   TAIASCQCMDHMPAVSHWLRYADSARVVNEARPHSDLPSKAAAMVRENVIAQLANLQTH
FT                   PSVRLALEEGRIALHGWVYDIESGSIAAFDGATRQFVPLAANPRVCAIPLRQPTAA"
FT   gene            421457..421927
FT                   /gene="cynS"
FT                   /locus_tag="ECSP_0402"
FT   CDS_pept        421457..421927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="ECSP_0402"
FT                   /product="cyanate aminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70280"
FT                   /protein_id="ACT70280.1"
FT                   /translation="MIQSQINRNIRLDLADAILLSKAKKDLSFAEIADGTGLAEAFVTA
FT                   ALLGQQALPADAARQVGAKLDLDEDAILLLQMIPLRGCIDDRIPTDPTMYRFYEMLQVY
FT                   GTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGERAVITLDGKYLPTKPF"
FT   gene            421960..423114
FT                   /gene="cynX"
FT                   /locus_tag="ECSP_0403"
FT   CDS_pept        421960..423114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynX"
FT                   /locus_tag="ECSP_0403"
FT                   /product="predicted cyanate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70281"
FT                   /protein_id="ACT70281.1"
FT                   /translation="MLLVLVLIGLNMRPLLTSVGPLLPQLRQASGMSFSVAALLTALPV
FT                   VTMGGLALAGSWLHQHVSERRSVAISLLLIAVGALMRELYPQSALLLSSALLGGVGIGI
FT                   IQAVMPSVIKRRFQQRTPLVMGLWSAALMGGGGLGAALTPWLVQHSETWYQTLAWWALP
FT                   AVVALFAWWWQSTREVASSHKTTTIPVRVVFTPRAWTLGVYFGLINGGYASLIAWLPAF
FT                   YIEIGASAQYSGSLLALMTLGQAAGALLMPAMARHQDRRKLLMLALALQLVGFCGFIWL
FT                   PLQLPVLWAMVCGLGLGGAFPLCLLLALDHSVQPAIAGKLVAFMQGIGFIIAGLAPWFS
FT                   GVLRSIRGNYLMDWAFHALCVVGLMIITLRFAPARFPQLWVKEA"
FT   gene            complement(423217..423828)
FT                   /gene="lacA"
FT                   /locus_tag="ECSP_0404"
FT   CDS_pept        complement(423217..423828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /locus_tag="ECSP_0404"
FT                   /product="thiogalactoside acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70282"
FT                   /protein_id="ACT70282.1"
FT                   /translation="MNMSMTERIKAGKLFTDMCEGLPEKRLRRKTLMYEFNHSHPSEVD
FT                   KRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLI
FT                   APNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSI
FT                   VTKDIPPNVVAAGVPCRVIREINDRDKQYYFRDYKVESSV"
FT   gene            complement(423894..425147)
FT                   /gene="lacY"
FT                   /locus_tag="ECSP_0405"
FT   CDS_pept        complement(423894..425147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacY"
FT                   /locus_tag="ECSP_0405"
FT                   /product="lactose/galactose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70283"
FT                   /protein_id="ACT70283.1"
FT                   /translation="MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDT
FT                   GIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNIL
FT                   VGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFT
FT                   INNQFVFWLGSGCALILAILLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKL
FT                   WFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPL
FT                   IINRIGGKNALLLAGTIMSVRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQ
FT                   FEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFT
FT                   LSGPGPLSLLRRQVNEVA"
FT   gene            complement(425199..428273)
FT                   /gene="lacZ"
FT                   /locus_tag="ECSP_0406"
FT   CDS_pept        complement(425199..428273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="ECSP_0406"
FT                   /product="beta-D-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70284"
FT                   /protein_id="ACT70284.1"
FT                   /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART
FT                   NRPSQQLRSLNGEWQFVWFPAPEAVPESWLECDLPDADTVVVPSNWQMHGYDAPIYTNV
FT                   TYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYG
FT                   QDSRLLSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQ
FT                   ISDFHVATLFNDDFSRAVLEAEVQMYGELRDELRVTVSLWQGETQVASGTAPFGGEIID
FT                   ERGGYADRVTLGLNVENPKLWSAEIPNIYRAVVELHTADGTLIEAEACDVGFREVRIEN
FT                   GLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLW
FT                   YTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWS
FT                   LGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTSATDIICPMYARVDEDQPFPAVP
FT                   KWSIKKWLSLPGEMRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDLVDQSL
FT                   IKYDENGNPWSAYGGDFGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGR
FT                   TIEVTSEYLFHHSDNELLHWTVALDGKPLASGEVPLDVAPQGKQVIELPELPRLESTGQ
FT                   LWLTVHVVQPNATAWSEAGHISAWQQWRLAENLSVTLPSAPHAIPQLTTSETDFCIELD
FT                   NKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWK
FT                   AAGHYQAEAALLQCTADTLADAVLITTVHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
FT                   EVASDTPHPARIGLTCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPY
FT                   VFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDG
FT                   FHMGIGGDDSWSPSVSAEFQLSAGRYHYQLVWCQK"
FT   gene            complement(428396..429478)
FT                   /gene="lacI"
FT                   /locus_tag="ECSP_0407"
FT   CDS_pept        complement(428396..429478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="ECSP_0407"
FT                   /product="DNA-binding transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70285"
FT                   /protein_id="ACT70285.1"
FT                   /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
FT                   NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
FT                   EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACANVPALFLDVSDQTPINSIIFSH
FT                   EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
FT                   MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
FT                   YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPKTQTASPR
FT                   ALADSLMQLARQVSRLESGQ"
FT   gene            complement(429515..430468)
FT                   /locus_tag="ECSP_0408"
FT   CDS_pept        complement(429515..430468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0408"
FT                   /product="putative AraC-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70286"
FT                   /protein_id="ACT70286.1"
FT                   /translation="MRPLTVAIIAVAGFSPFHLSVPFIVFSEKMAEKKRFHVIICAEKP
FT                   GNVDSADGFSVTATHDYTAVIQADIVIIPYWGTITQKPPQKLLEALTTARDNGAQIVGL
FT                   CLGTFVLGYAGLLKNKRAATHWEFEREFQARFPQTHLDINALYVDDDGIITSAGTAAAL
FT                   DCCLYIVRQHFGSDYANHIARRMVVPPYRTGGQAQFIEQPVPKNTHDERINLLLDYLRQ
FT                   NIAQQHDLDSLAQRVMMSRRTLTRHFMKATGSSIAEWLITERLRRSQELLGSSQLPVER
FT                   IAAEVGFLSPVTWRQHFKSHFGVSPAEWRKTFRGMA"
FT   gene            complement(430488..431264)
FT                   /locus_tag="ECSP_0409"
FT   CDS_pept        complement(430488..431264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0409"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70287"
FT                   /protein_id="ACT70287.1"
FT                   /translation="MKITQIRNATQIIQYAGKTFLIDPLLAPKGSYPGFAGTARAEIRN
FT                   PTVELPCDLTTLLNVDALIVTHLHEDHWDETASRVVPKDKLIYVQNEQDAESLNKQGFT
FT                   HLTVLTDETKFGDITLHKTTGQHGSDRTYADPAMAKRLGAACGVVFQHPTEKTLYLAGD
FT                   TLWRDDVEATMLTFQPEVVVLNAGFAHVLGHGAIIMGAEDILKTHFTLPEAQIIATHME
FT                   AVNHCLLTRDALKEYARDNQIIEFVNVPEDGETLTF"
FT   gene            complement(431379..432212)
FT                   /gene="mhpR"
FT                   /locus_tag="ECSP_0410"
FT   CDS_pept        complement(431379..432212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpR"
FT                   /locus_tag="ECSP_0410"
FT                   /product="DNA-binding transcriptional activator,
FT                   3HPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70288"
FT                   /protein_id="ACT70288.1"
FT                   /translation="MQNNEQTEYKTVRGLTRGLMLLNMLNKLDGGASVGLLAELSGLHR
FT                   TTVRRLLETLQEEGYVRRSPSDDSFRLTIKVRQLSEGFRDEQWISALAAPLLGDLLREV
FT                   VWPTDVSTLDVDAMVVRETTHRFSRLSFHRAMVGRRLPLLKTASGLTWLAFCPEQERKE
FT                   LIEMLASRPGDDYQLAREPLKLEAILARARKEGYGQNYRGWDQEEKIASIAVPLRSEQR
FT                   VIGCLNLVYMASAMTIEQAAEKHLPALQRVAKQIEEGVESQAILVAGRRSGVHLR"
FT   gene            432403..434067
FT                   /gene="mhpA"
FT                   /locus_tag="ECSP_0411"
FT   CDS_pept        432403..434067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpA"
FT                   /locus_tag="ECSP_0411"
FT                   /product="3-(3-hydroxyphenyl)propionate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70289"
FT                   /protein_id="ACT70289.1"
FT                   /translation="MAIQHPDIQPAVNHSVQVAIAGAGPVGLMMANYLGQMGIDVLVVE
FT                   KLDKLIDYPRAIGIDDEALRTMQSVGLVDNVLPHTTPWHAMRFLTPKGRCFADIQPMTD
FT                   EFGWPRRNAFIQPQVDAVMLEGVSRFPNVRCLFSRELEAFSQQDDEVTLHLKTAEGLRE
FT                   IVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRPY
FT                   VSAALPHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARL
FT                   AQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDTYQQ
FT                   ERRDHAKAMIDLSVTAGNVLAPPKRWQGTLRDGVSWLLNYLPPVKRYFLEMRFKPMPQY
FT                   YGGALVREGEAKHSPVGKMFIQPKVTLENGDVTLLDNAIGANFAVIGWGCNPLWGMSDE
FT                   QIQQWRALSTRFIQVVPEVQIHTAQDNHDGVLRVGDTQGRLRSWFAQHNASLVVMRPDR
FT                   FVAATAIPQTLGKTLNKLASVMTLTRPDADVSVEKVA"
FT   gene            434069..435013
FT                   /gene="mhpB"
FT                   /locus_tag="ECSP_0412"
FT   CDS_pept        434069..435013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpB"
FT                   /locus_tag="ECSP_0412"
FT                   /product="2,3-dihydroxyphenylpropionate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70290"
FT                   /protein_id="ACT70290.1"
FT                   /translation="MHAYLHCLSHSPLVGYVDPAQEVLDEVNGVIASARERIAAFSPEL
FT                   VVLFAPDHYNGFFYDVMPPFCLGVGATAIGDFGSAAGELPVPVELAEACAHAVMKSGID
FT                   LAVSYCMQVDHGFAQPLEFLLGGLDKVPVLPVFINGVATPLPGFQRTRMLGEAIGRFTS
FT                   TLNKRVLFLGSGGLSHQPPVPELAKADAHMRDRLLGSGKDLPASERELRQQRVISAAEK
FT                   FVEDQRTLHPLNPIWDNQFMTLLEQGRIQELDAVSNEELSAIAGKSTHEIKTWVAAFAA
FT                   ISAFGNWRSEGRYYRPIPEWIAGFGSLSARTEN"
FT   gene            435016..435897
FT                   /gene="mhpC"
FT                   /locus_tag="ECSP_0413"
FT   CDS_pept        435016..435897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="ECSP_0413"
FT                   /product="2-hydroxy-6-ketonona-2,4-dienedioic acid
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70291"
FT                   /protein_id="ACT70291.1"
FT                   /translation="MQEKMMSYQPQTEAATSRFLNVEEAGKTLRIHFNDCGQGDETVVL
FT                   LHGSGPGATGWANFSRNIDPLVEAGYRVILLDCPGWGKSDSIVNSGSRSDLNARILKSV
FT                   VDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMGGGTGGMSLFTPMPTEGIKRL
FT                   NQLYRQPTIENLKLMMDIFVFDTSDLTDALFEARLNNMLSRRDHLENFVKSLEANPKQF
FT                   PDFGPRLAEIKAQTLIVWGRNDRFVPMDAGLRLLSGIAGSELHIFRDCGHWAQWEHADA
FT                   FNQLVLNFLARA"
FT   gene            435907..436716
FT                   /gene="mhpD"
FT                   /locus_tag="ECSP_0414"
FT   CDS_pept        435907..436716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpD"
FT                   /locus_tag="ECSP_0414"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70292"
FT                   /protein_id="ACT70292.1"
FT                   /translation="MTKHTLEQLAADLRRAAEQGEAIAPLRDLIGIDNAEAAYAIQHIN
FT                   VQYDVAQGRRVVGRKVGLTHPKVQQQLGVDQPDFGTLFADMCYGDNEIIPFSRVLQPRI
FT                   EAEIALVLNRDLPATDITFDELYNAIEWVLPALEVVGSRIRDWSIQFVDTVADNASCGV
FT                   YVIGGPAQRPAGLDLKNCAMKMTRNNEEVSSGRGSECLGHPLNAAVWLARKMASLGEPL
FT                   RAGDIILTGALGPMVAVNAGDRFEAHIEGIGSVAAAFSSAAPKGSLS"
FT   gene            436713..437663
FT                   /gene="mhpF"
FT                   /locus_tag="ECSP_0415"
FT   CDS_pept        436713..437663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpF"
FT                   /locus_tag="ECSP_0415"
FT                   /product="acetaldehyde-CoA dehydrogenase II, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70293"
FT                   /protein_id="ACT70293.1"
FT                   /translation="MSKRKVAIIGSGNIGTDLMIKILRHDQHLEMAVMVGIDPQSDGLA
FT                   RARRMGVATTHEGVIGLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTP
FT                   AAIGPYCVPVVNLEENVDQLNVNMVTCGGQATIPMVAAVSRVVRVHYAEIIASIASKSA
FT                   GPGTRANIDEFTETTSRAIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDI
FT                   EASINEMAEAVQAYVPGYRLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAH
FT                   YLPAYAGNLDIMTSSALATAEKMAQSLARKAGEAA"
FT   gene            437660..438673
FT                   /gene="mhpE"
FT                   /locus_tag="ECSP_0416"
FT   CDS_pept        437660..438673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpE"
FT                   /locus_tag="ECSP_0416"
FT                   /product="4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic
FT                   acid aldolase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70294"
FT                   /protein_id="ACT70294.1"
FT                   /translation="MNGKKLYISDVTLRDGMHAIRHRYSLENVRQIAKALDDARVDSIE
FT                   VAHGDGLQGSSFNYGFGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGA
FT                   RVVRVATHCTEADVSAQHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCI
FT                   YVVDSGGAMNMSDIRDRFRALKAVLKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDA
FT                   SLAGMGAGAGNAPLEVFIAAVDKLGWQHGADLYALMDAADDLVRPLQDRPVRVDRETLA
FT                   LGYAGVYSSFLRHCETAAARYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK"
FT   gene            438849..440060
FT                   /gene="mhpT"
FT                   /locus_tag="ECSP_0417"
FT   CDS_pept        438849..440060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpT"
FT                   /locus_tag="ECSP_0417"
FT                   /product="predicted 3-hydroxyphenylpropionic transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70295"
FT                   /protein_id="ACT70295.1"
FT                   /translation="MSTRTPSSSSSRLMLTIGLCFLVALMEGLDLQAAGIAAGGIAQAF
FT                   ALDKMQMGWIFSAGILGLLPGALVGGMLADRYGRKRILIGSVALFGLFSLATAIAWDFP
FT                   SLVFARLMTGVGLGAALPNLIALTSEAAGPRFRGTAVSLMYCGVPIGAALAATLGFAGA
FT                   NLAWQTVFWVGGVVPLILVPLLMRWLPESAVFAGEKQAAPPLRALFAPETATATLLLWL
FT                   CYFFTLLVVYMLINWLPLLLVEQGFQPSQAAGVMFALQMGAASGTLMLGALMDKLRPVT
FT                   MSLLIYSGMLASLLALGTVSSFNGMLLAGFVAGLFATGGQSVLYALAPLFYSSQIRATG
FT                   VGTAVAVGRLGAMSGPLLAGKMLALGTGTVGVMAASAPGILVAGLAVFILMSRRLRMQP
FT                   CADA"
FT   gene            440162..440701
FT                   /gene="yaiL"
FT                   /locus_tag="ECSP_0418"
FT   CDS_pept        440162..440701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="ECSP_0418"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70296"
FT                   /protein_id="ACT70296.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDDPYADFKVPDDLMW"
FT   gene            complement(440826..441659)
FT                   /gene="frmB"
FT                   /locus_tag="ECSP_0419"
FT   CDS_pept        complement(440826..441659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmB"
FT                   /locus_tag="ECSP_0419"
FT                   /product="predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70297"
FT                   /protein_id="ACT70297.1"
FT                   /translation="MELIEKHASFGGWQNVYRHYSASLKCEMNVGVYLPPKAAGEKLPV
FT                   LYWLSGLTCNEQNFITKSGVQRYAAEHNIIVVAPDTSPRGSHVADADRYDLGQGAGFYL
FT                   NATQAPWNEHYKMYDYIRNELPDLVMNHFPATAKKSISGHSMGGLGALVLALRNPDEYV
FT                   SVSAFSPIVSPSQVPWGQQAFAAYLGENKEAWLDYHPVSLISQGQRVAEIMVDQGLSDD
FT                   FYAEQLRTQNLEKICQEMNIKTLIRYHEGYDHSYYFVSSFIGEHIAYHANKLNMR"
FT   gene            complement(441752..442861)
FT                   /gene="frmA"
FT                   /locus_tag="ECSP_0420"
FT   CDS_pept        complement(441752..442861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmA"
FT                   /locus_tag="ECSP_0420"
FT                   /product="alcohol dehydrogenase class III"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70298"
FT                   /protein_id="ACT70298.1"
FT                   /translation="MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAF
FT                   TLSGDDPEGVFPVVLGHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECEFCRSGKTN
FT                   LCVAVRETQGKGLMPDGTTRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPEANHEH
FT                   VCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPK
FT                   KFDLARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGW
FT                   GQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPF
FT                   VTHTMSLDEINDAFDLMHEGKSIRTVIRY"
FT   gene            complement(442896..443171)
FT                   /gene="frmR"
FT                   /locus_tag="ECSP_0421"
FT   CDS_pept        complement(442896..443171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmR"
FT                   /locus_tag="ECSP_0421"
FT                   /product="regulator protein that represses frmRAB operon"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70299"
FT                   /protein_id="ACT70299.1"
FT                   /translation="MPSTPEEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAV
FT                   RGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVRAYLK"
FT   gene            complement(443331..444377)
FT                   /gene="afuC"
FT                   /locus_tag="ECSP_0422"
FT   CDS_pept        complement(443331..444377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuC"
FT                   /locus_tag="ECSP_0422"
FT                   /product="putative ATP-binding component of a transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70300"
FT                   /protein_id="ACT70300.1"
FT                   /translation="MSQKNFVELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGK
FT                   TTILRLVAGLEKPSEGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLK
FT                   MLGVSRSEVKQRVKEALAMVDLEGFEDRYVDQISGGQQQRVALARALILKPKVLLFDEP
FT                   LSNLDANLRRSMRDKIRELQKQFNITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQ
FT                   DLYRQPASRFMASFMGDANLFPANFSEEYVDIYGYRLPRAAHFPVQGSGTVGVRPEAIT
FT                   LSNHGEESQRCVIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDIGEHYYLEIHPYG
FT                   MFVLADAA"
FT   gene            complement(444389..446467)
FT                   /gene="afuB"
FT                   /locus_tag="ECSP_0423"
FT   CDS_pept        complement(444389..446467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuB"
FT                   /locus_tag="ECSP_0423"
FT                   /product="putative permease component of transport system
FT                   for ferric iron"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70301"
FT                   /protein_id="ACT70301.1"
FT                   /translation="MSQTLALHPVKKRDAIFLWVLLGWLAFVLLPSWSLDYGLLESTSD
FT                   EILGAYGWSHFNISWLWYLLPSLLLVRPFRQATREQRSRHYFDAGWALLCMAFIVISAT
FT                   VAGRGLGYAAIVLFVELGAIMTLALTRLEWLGGDRFVIGSLIAIVALIGIFIVWPSIAI
FT                   FIPMFTNDAGELAPLAFMTVLSQAHIVQVIVNSIVLSIAVGIGCAFFGLVLAIYTTRIA
FT                   KRSAIIGRIFSILPIVTPPFVVGLGVTLMMGRSGYVTEFMVEWFGLTNTNWLYGFTGIW
FT                   LAQVLAFTPMAFMILDGAIKTIHPSLEEASYTLRASRWQTFNGVFVPLLKPALANAFLI
FT                   VVVQSLADFSNPLVLGGNFDVLATQIYFYITGSQLDYQAASTLGAFLLLFSLLVFCIQY
FT                   MWIGKRSYVTVSGKSYRGDVQPLPVTLVWSVVAILAIWIAFNALLYGSIFYGSFTVNWG
FT                   VDYTLTLDNFIKLFGQGMSDGAWPSLLDTLLYAGIAAPITAIFGLLIAWVVVRQQFKGK
FT                   KTIEFTTMLCFAVPGTVAGVSYILAFNSAPVYLTGTAAIVIISMVMRNVPVGIRAGIAG
FT                   LGQIDKSLDEASLSLRAGSLRTITHILLPLLRPAILSALIYSFVRAITTVSAIVFLVTP
FT                   DTRVATAYILNRVEDGEYGVAIAYGSILIVVMLAIIFLFDWLIGEARISRSKAKNQA"
FT   gene            complement(446536..447567)
FT                   /gene="afuA"
FT                   /locus_tag="ECSP_0424"
FT   CDS_pept        complement(446536..447567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuA"
FT                   /locus_tag="ECSP_0424"
FT                   /product="periplasmic ferric iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70302"
FT                   /protein_id="ACT70302.1"
FT                   /translation="MKMTFTSTLIASAVALATLTGAAQAKGRLVVYCSATNEMCEAETK
FT                   AFGEKYDVKTSFIRNGSGSTLAKVDAEKKNPQADVWYGGTLDPQSQAGEMGLLQAYKSP
FT                   NLEQIMEKFRDPAKVKGNLSSAVYVGILGFGVNTDRLKEKNLPVPKCWKDLTKPEYKGE
FT                   IQIADPQSSGTAYTALATFAQLWGEDQAFDYLKQLNANVSQYTKSGIAPARNAARGETA
FT                   IGIGFLHDYSLEKEQGAPLELISPCEGTGYEIGGVSILKGARNLDNAKLFVDWVLSKEA
FT                   QELAWKKGKSYQILTNTTAETSPNSLKLDDLKLINYDMDKYGSTDVRKALINKWVSEVK
FT                   MGK"
FT   gene            complement(447564..448868)
FT                   /locus_tag="ECSP_0425"
FT   CDS_pept        complement(447564..448868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0425"
FT                   /product="putative permease; hexosephosphate transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70303"
FT                   /protein_id="ACT70303.1"
FT                   /translation="MHARSAREINQCYRTLRPRLLMCMIIGYAAFYLTRKSVNYVLPAL
FT                   QTDLGLDKGDIGLLGSLFYLSYGLSKFTAGLWHDSHGQRGFMGVGLFATGLLNVVFAFG
FT                   ESLTLLLVVWTLNGFFQGWGWPPCARLLTHWYSRNERGFWWGCWNMSINIGGAIIPLIS
FT                   AFAAHWWGWQAAMLTPGIISMALGIWLTLQLKGTPQEEGLPTVGHWRHDPLELRQEQQS
FT                   PPMGLWQMLRTTMLQNPLIWLLGVSYVLVYVIRIALNDWGNIWLTESHGVNLLSANATV
FT                   MLFEVGGLLGALFAGWGSDLLFSGQRAPMILLFTLGLMVSVAALWLAPVHHYALLAVCF
FT                   FTVGFFVFGPQMLIGLAAVECGHKAAAGSITGFLGLFAYLGAALAGWPLSLVIERYGWP
FT                   GMFSLLSVAAVLMGLLLMPLLMAGITTTHARRIKQ"
FT   gene            complement(448953..450494)
FT                   /locus_tag="ECSP_0426"
FT   CDS_pept        complement(448953..450494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0426"
FT                   /product="putative sensor kinase; hexosephosphate
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70304"
FT                   /protein_id="ACT70304.1"
FT                   /translation="MSRNLRHWVILLFIVLAWGTGWLMLWTLSFYLTNNGQQAVLFLPQ
FT                   GVYLALVILLSRRYWPALVLPPLLMMFWLHSEQLLNGYLMLATPVISLFPALLAQNFWH
FT                   RFPLYWQRLTLLLATVTAASLLNTALLSPFMSGPIMLPGLTSFTGGVLLTPFVYLIFEF
FT                   LRQQHRYQLLGLDTHNPPLRTSLIIWCSLFFIIGIGTQMVLSPEIERLLLIVVFLPNVV
FT                   MAWKFGWQGGVLSGLLGSMMITIARQIGVGFSNLVELEIFLATQALLGIGLGIAISRQQ
FT                   HLALNLHHYRQRLEAELAARRALAEKLIHTEEDTRKNLARELHDEIGQNITAIQIQSQL
FT                   VKRARDPAQIQSAASQINELARRIHLSTRQLLRQLRPPALDELTFREALLHLINEFAFS
FT                   ERGIHCQFAYQLNSTPENETVRFTLYRLLQELLNNICKHAEASEVTIILRQQGEVLHLE
FT                   VSDNGVGIASGKMAGFGIQGMRERVSALGGDLTLEKQHGTRVIVNLPTFLQQIAG"
FT   gene            complement(450494..451123)
FT                   /locus_tag="ECSP_0427"
FT   CDS_pept        complement(450494..451123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0427"
FT                   /product="putative response regulator; hexosephosphate
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70305"
FT                   /protein_id="ACT70305.1"
FT                   /translation="MIRVVLVDDHVVVRSGFAQLLSLEDDLEVIGQYSSAAQAWSALIR
FT                   DDVNVAVIDIAMPDENGLSLLKRLRAQKPQFRAIILSIYDAPIFVQSALDAGASGYLTK
FT                   RCGPEELVQAVRSVGLGGHYLCADAIRALRGGGQPAQALEILTPREREVFELLVKGDSV
FT                   KEIAFKLELSHKTVHVHRANVLGKLNCHSTIELVHFALDHHLLAGH"
FT   gene            451426..452388
FT                   /gene="tauA"
FT                   /locus_tag="ECSP_0428"
FT   CDS_pept        451426..452388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="ECSP_0428"
FT                   /product="taurine transporter subunit, periplasmic-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70306"
FT                   /protein_id="ACT70306.1"
FT                   /translation="MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGN
FT                   SEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVK
FT                   AFAKSAIDAQQPYIANPDVWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAE
FT                   LTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
FT   gene            452401..453168
FT                   /gene="tauB"
FT                   /locus_tag="ECSP_0429"
FT   CDS_pept        452401..453168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="ECSP_0429"
FT                   /product="taurine transporter subunit, ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70307"
FT                   /protein_id="ACT70307.1"
FT                   /translation="MLQISHLYADYGGKPVLEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKRIEGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGIEKIQ
FT                   RLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSPGPGRVLERLPLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
FT   gene            453165..453992
FT                   /gene="tauC"
FT                   /locus_tag="ECSP_0430"
FT   CDS_pept        453165..453992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="ECSP_0430"
FT                   /product="taurine transporter subunit, membrane component
FT                   of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70308"
FT                   /protein_id="ACT70308.1"
FT                   /translation="MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVAALQ
FT                   LISPLFLPPPQQVLAKLLTIAGPQGFMDATLWQHLAASLTRIVLALLAAVLIGIPVGIA
FT                   MGLSPTVRGILDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
FT   gene            453989..454840
FT                   /gene="tauD"
FT                   /locus_tag="ECSP_0431"
FT   CDS_pept        453989..454840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="ECSP_0431"
FT                   /product="taurine dioxygenase, 2-oxoglutarate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70309"
FT                   /protein_id="ACT70309.1"
FT                   /translation="MSERLSITPLGPYIGAQISGADLTRPLSDNQFEQLYHAVLRHQVV
FT                   FLRDQAITPQQQRALAQRFGELHIHPVYPHAEGVDEIIVLDTHNDNPPDNDNWHTDVTF
FT                   IETPPAGAILAAKELPSTGGDTLWTSGIAAYEALSVPFRQLLSGLRAEHDFRKSFPEYK
FT                   YRKTEEEHQRWREAVAKNPPLLHPVVRTHPVSGKQALFVNEGFTTRIVDVSEKESEALL
FT                   GFLFAHITKPEFQVRWRWQPNDIAIWDNRVTQHYANADYLPQRRIMHRATILGDKPFYR
FT                   AG"
FT   gene            complement(454947..455921)
FT                   /gene="hemB"
FT                   /locus_tag="ECSP_0432"
FT   CDS_pept        complement(454947..455921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="ECSP_0432"
FT                   /product="porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70310"
FT                   /protein_id="ACT70310.1"
FT                   /translation="MTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYK
FT                   AVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSR
FT                   ICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIA
FT                   PSAAMDGQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMN
FT                   PMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKF
FT                   AALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR"
FT   gene            456447..459372
FT                   /pseudo
FT                   /locus_tag="ECSP_0433"
FT                   /note="disrupted by frameshift mutation; flagellin
FT                   structural protein"
FT   gene            459463..460086
FT                   /gene="yaiV"
FT                   /locus_tag="ECSP_0434"
FT   CDS_pept        459463..460086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiV"
FT                   /locus_tag="ECSP_0434"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70311"
FT                   /protein_id="ACT70311.1"
FT                   /translation="MLSVVKPLQEFGKLDKCLSRYGTRFEFNNEKQVIFSSDVNNEDTF
FT                   VILEGVISLRREENVLIGITQAPYIMGLADGLMKNDIPYKLISEGNCTGYHLPAKQTIT
FT                   LIEQNQLWRDAFYWLAWQNRILELRDVQLIGHNSYEQIRATLLSMIDWNEELRSRIGVM
FT                   NYIHQRTRISRSVVAEVLAALRKGGYIEMNKGKLVAINRLPSEY"
FT   gene            complement(460087..461244)
FT                   /gene="ampH"
FT                   /locus_tag="ECSP_0435"
FT   CDS_pept        complement(460087..461244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="ECSP_0435"
FT                   /product="beta-lactamase/D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70312"
FT                   /protein_id="ACT70312.1"
FT                   /translation="MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYG
FT                   SGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQG
FT                   TVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQ
FT                   RWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTY
FT                   TPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQAD
FT                   RMQTLIYQRAQFTKVIGMDVPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAM
FT                   IPQKNIGAFVVVTRSPLTRFKNMSDGINDLVTELSGNKPLVIPAS"
FT   gene            complement(461336..461458)
FT                   /locus_tag="ECSP_0436"
FT   CDS_pept        complement(461336..461458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70313"
FT                   /protein_id="ACT70313.1"
FT                   /translation="MFRRISQTKDCLHKRINTRRITNAGIGEQEKDRVYAPLRF"
FT   gene            461596..462816
FT                   /gene="sbmA"
FT                   /locus_tag="ECSP_0437"
FT   CDS_pept        461596..462816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="ECSP_0437"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70314"
FT                   /protein_id="ACT70314.1"
FT                   /translation="MFKSFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQI
FT                   PISAARFWSLDFLIFYAYYIVCVGLFALFWFIYSPHRWQYWSILGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMANWQQLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPELPIIGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDATRATPPTVRELFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQ
FT                   EVTHTLS"
FT   gene            462829..463923
FT                   /gene="yaiW"
FT                   /locus_tag="ECSP_0438"
FT   CDS_pept        462829..463923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="ECSP_0438"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70315"
FT                   /protein_id="ACT70315.1"
FT                   /translation="MSRVNHLSSLSFLAVLVLAGCSSQAPQPLKKGEKAIDVASVVRQK
FT                   MPASVKDRDAWAKDLATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQ
FT                   EIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSGIFDDLISMVPMGQT
FT                   LFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPA
FT                   SYSAPIYRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRK
FT                   LAAKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAEAKTGKSLPREMLPGIQLESPK
FT                   ITRNLTTAWFAKRVDERRARCMKQ"
FT   gene            complement(463982..464290)
FT                   /gene="yaiY"
FT                   /locus_tag="ECSP_0439"
FT   CDS_pept        complement(463982..464290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="ECSP_0439"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70316"
FT                   /protein_id="ACT70316.1"
FT                   /translation="MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
FT                   VHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ"
FT   gene            464550..464762
FT                   /gene="yaiZ"
FT                   /locus_tag="ECSP_0440"
FT   CDS_pept        464550..464762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="ECSP_0440"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70317"
FT                   /protein_id="ACT70317.1"
FT                   /translation="MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGL
FT                   VTWVISFWLAGLIIRRRDEETENAQ"
FT   gene            complement(464786..465880)
FT                   /gene="ddlA"
FT                   /locus_tag="ECSP_0441"
FT   CDS_pept        complement(464786..465880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="ECSP_0441"
FT                   /product="D-alanine-D-alanine ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70318"
FT                   /protein_id="ACT70318.1"
FT                   /translation="MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDK
FT                   QGQWHVSDASNYLLNADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFP
FT                   IVHGTLGEDGSLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTR
FT                   ANRHNISFAEVESKLGLPLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQ
FT                   GIKGREIECAVLGNDNPQASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDK
FT                   IRAIAVQAYQTLGCAGMARVDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYT
FT                   DLITRLIELALERHAADNALKTTM"
FT   gene            465958..466161
FT                   /locus_tag="ECSP_0442"
FT   CDS_pept        465958..466161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70319"
FT                   /protein_id="ACT70319.1"
FT                   /translation="MLQSSADKACNVLVKKVRYLKDVRKITKMMNGKLIYSWLKWPCGE
FT                   FFSLNYKLTKRIYFITFIYNKG"
FT   gene            466175..466297
FT                   /locus_tag="ECSP_0443"
FT   CDS_pept        466175..466297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70320"
FT                   /protein_id="ACT70320.1"
FT                   /translation="MFCVGNYLNKRNVSLVIKQKIFAQSISFAIKIIPPDTMKL"
FT   gene            466343..466603
FT                   /gene="iraP"
FT                   /locus_tag="ECSP_0444"
FT   CDS_pept        466343..466603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iraP"
FT                   /locus_tag="ECSP_0444"
FT                   /product="anti-adaptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70321"
FT                   /protein_id="ACT70321.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ"
FT   gene            466704..468119
FT                   /gene="phoA"
FT                   /locus_tag="ECSP_0445"
FT   CDS_pept        466704..468119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="ECSP_0445"
FT                   /product="bacterial alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70322"
FT                   /protein_id="ACT70322.1"
FT                   /translation="MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGAR
FT                   RLTADQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTG
FT                   QYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGL
FT                   ATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARA
FT                   DVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLF
FT                   ADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFF
FT                   LQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIV
FT                   APDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQT
FT                   DLFYTMKAALGLK"
FT   gene            468238..468558
FT                   /gene="psiF"
FT                   /locus_tag="ECSP_0446"
FT   CDS_pept        468238..468558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ECSP_0446"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70323"
FT                   /protein_id="ACT70323.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
FT   gene            468660..469775
FT                   /gene="adrA"
FT                   /locus_tag="ECSP_0447"
FT   CDS_pept        468660..469775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adrA"
FT                   /locus_tag="ECSP_0447"
FT                   /product="predicted diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70324"
FT                   /protein_id="ACT70324.1"
FT                   /translation="MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPR
FT                   AVGLAGMFLPIASTLVSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKT
FT                   DAVLAGMWVGVMGVNVLPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGI
FT                   TVSFNSAPLEWWLSLPIIVIYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRR
FT                   HWETMLRNEFDNCRRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRG
FT                   SDVIGRFGGDEFAVIMSGTPAESAITAMLRVHEGLNTLRLPNTPQVNLRISVGVAPLNP
FT                   QMSHYREWLKSADLALYKAKKAGRNRTEVAA"
FT   gene            complement(469792..470601)
FT                   /gene="proC"
FT                   /locus_tag="ECSP_0448"
FT   CDS_pept        complement(469792..470601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="ECSP_0448"
FT                   /product="pyrroline-5-carboxylate reductase,
FT                   NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70325"
FT                   /protein_id="ACT70325.1"
FT                   /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAAL
FT                   HDKFGINAAESAQEVAQIADIIFAAVKPGIMIKVLSEITSSLNKDSLVVSIAAGVTLDQ
FT                   LARALGHDRKIIRAMPNTPALVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEP
FT                   MIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGEHP
FT                   GALKDMVCSPGGTTIEAVRVLEEKGFRAAVIEAMTKCMEKSEKLSKS"
FT   gene            470721..471179
FT                   /gene="yaiI"
FT                   /locus_tag="ECSP_0449"
FT   CDS_pept        470721..471179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="ECSP_0449"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70326"
FT                   /protein_id="ACT70326.1"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRE
FT                   RLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKWWLEVQRSRG"
FT   gene            471362..471886
FT                   /gene="aroL"
FT                   /locus_tag="ECSP_0450"
FT   CDS_pept        471362..471886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="ECSP_0450"
FT                   /product="shikimate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70327"
FT                   /protein_id="ACT70327.1"
FT                   /translation="MTQPLFLIGPRGCGKTTVGMALADSLNRRFVDTDQWLQSQLNMTV
FT                   AEIVEREEWAGFRARETAALEAVTAPSTVIATGGGIILTEFNRHFMQNNGIVVYLCAPV
FT                   SVLVNRLQAAPEEDLRPTLTGKPLSEEVQEVLEERDALYREVAHIIIDATNEPSQVISE
FT                   IRSALAQTINC"
FT   gene            471936..472127
FT                   /gene="yaiA"
FT                   /locus_tag="ECSP_0451"
FT   CDS_pept        471936..472127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="ECSP_0451"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70328"
FT                   /protein_id="ACT70328.1"
FT                   /translation="MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAQEAMDAKKRYEDPDKE"
FT   gene            472385..473062
FT                   /gene="aroM"
FT                   /locus_tag="ECSP_0452"
FT   CDS_pept        472385..473062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="ECSP_0452"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70329"
FT                   /protein_id="ACT70329.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNHLAHVSRRKVERDLQGVVEVLDNQGYDVIILMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEELLTVQAQKWQILQKPPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFNQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLV"
FT   gene            473134..473418
FT                   /gene="yaiE"
FT                   /locus_tag="ECSP_0453"
FT   CDS_pept        473134..473418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="ECSP_0453"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70330"
FT                   /protein_id="ACT70330.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
FT   gene            475560..475841
FT                   /gene="ykiA"
FT                   /locus_tag="ECSP_0454"
FT   CDS_pept        475560..475841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykiA"
FT                   /locus_tag="ECSP_0454"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70331"
FT                   /protein_id="ACT70331.1"
FT                   /translation="MLQSRNDHLRQTALRNAHTPASLLTTLTESQDRSLAINNPQLAAD
FT                   VKTVWLKEDPSLLLFVDKPDLSQLRDLVKTGATRKIRNEARHRLEEKQ"
FT   gene            475838..476287
FT                   /locus_tag="ECSP_0455"
FT   CDS_pept        475838..476287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0455"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70332"
FT                   /protein_id="ACT70332.1"
FT                   /translation="MTQRPWSKLQREIYDLLTPTINLQIHCTRYPMRSQNGGSTDLPRY
FT                   WITLDKNVIWDYPKDFIAGNGGVRNFHGETCWYPYLTDICSISDLLREYIDTPKAELLT
FT                   KQFTSDKWGLVNILRAADRRIGMRRLDQLRRKTHNIAALKNYCPP"
FT   gene            complement(476372..477283)
FT                   /gene="rdgC"
FT                   /locus_tag="ECSP_0456"
FT   CDS_pept        complement(476372..477283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="ECSP_0456"
FT                   /product="DNA-binding protein, non-specific"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70333"
FT                   /protein_id="ACT70333.1"
FT                   /translation="MLWFKNLMVYRLSREISLRAEEMEKQLASMAFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHVANGQIVICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLSMANPIELTLTEWVRSGSAAQGFQLLDEAELKSLLEDGGVIRAKKQDLTSEEITNH
FT                   IEAGKVVTKLALDWQQRIQFVMCDDGSLKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQNLIEGLGGEAQR"
FT   gene            477408..478316
FT                   /gene="mak"
FT                   /locus_tag="ECSP_0457"
FT   CDS_pept        477408..478316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="ECSP_0457"
FT                   /product="manno(fructo)kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70334"
FT                   /protein_id="ACT70334.1"
FT                   /translation="MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIAT
FT                   LVDMAEQATGQRGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWM
FT                   DEDELRYREEVPCYCGKQGCIETFISGTGFATDYRRLSGHALKGSEIIRLVEESDPVAE
FT                   LALRRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYQTVPQLIKQFVFGGECETPV
FT                   RKAKHGDSSGVRGAAWLWPQE"
FT   gene            complement(478459..479643)
FT                   /gene="araJ"
FT                   /locus_tag="ECSP_0458"
FT   CDS_pept        complement(478459..479643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="ECSP_0458"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70335"
FT                   /protein_id="ACT70335.1"
FT                   /translation="MKKVILSLALGTFGLGMAEFGIMGVLTELAHNVGISIPAAGHMIS
FT                   YYALGVVVGAPIIALFSSRYSLKHILLFLVALCVIGNAMFTLSSSYLMLAIGRLVSGFP
FT                   HGAFFGVGAIVLSKIIKPGKVTAAVAGMVSGMTVANLLGIPLGTYLSQEFSWRYTFLLI
FT                   AVFNIAVMASVYFWVPDIRDEAKGKLREQFHFLRSPAPWLIFAATMFGNAGVFAWFSYV
FT                   KPYMMFISGFSETAMTFIMMLVGLGMVLGNMLSGRISGRYSPLRIAAVTDFIIVLALLM
FT                   LFFCGGMKTTSLIFAFICCAGLFALSAPLQILLLQNAKGGELLGAAGGQIAFNLGSAVG
FT                   AYCGGMMLTLGLAYNYVALPAALLSFAAMSSLLLYGRYKRQQAADSPVLAKPLG"
FT   gene            complement(479769..482912)
FT                   /gene="sbcC"
FT                   /locus_tag="ECSP_0459"
FT   CDS_pept        complement(479769..482912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="ECSP_0459"
FT                   /product="exonuclease, dsDNA, ATP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70336"
FT                   /protein_id="ACT70336.1"
FT                   /translation="MKILSLRLKNLNSLKGEWKIDFTREPFASNGLFAITGPTGAGKTT
FT                   LLDAICLALYHETPRLSNVSQSQNDLMTRDTAECLAEVEFEVKGEAYRAFWSQNRARNQ
FT                   PDGNLQVPRVELARCADGKILADKVKDKLELTATLTGLDYGRFTRSMLLSQGQFAAFLN
FT                   AKPKERAELLEELTGTEIYGQISAMVFEQHKSARTELEKLQAQASGVALLTPEQVQSLT
FT                   ASLQVLTDEEKQLLTAQQQEQQSLNWLTRLDELQQEASRRQQALQQALAEEEKAQPQLA
FT                   ALSLAQPARNLRPHWERIAEHSAALAHTRQQIEEVNTRLQNTMALRASIRHHAAKQSAE
FT                   LQQQQQSLNTWLQEHDRFRQWNNELAGWRAQFSQQTSDREHLRQWQQQLTHAEQKLNAL
FT                   AAITLMLTADEVATALAQHAEQRPLRQRLVALHGQIVPQQKRLAQLMVTIQNVTLEQTQ
FT                   RNAALNEMRQRYKEKTQQLADVKTICEQEARIKTLEAQRAQLQAGQPCPLCGSTSHPAV
FT                   EAYQALEPGVNQSRLLALENEVKKLGEEGAALRGQLDALTKQLQRDENEAQSLRQDEQA
FT                   LTQQWQAVTASLNITLQPQDDIQPWLDAQDEHERQLRLLSQRHELQGQIAAHNQQIIQY
FT                   QQQIEQRQQQLLTALAGYALTLPQEDEEESWLATRQQEAQSWQQRQNELTALQNRIQQL
FT                   TPILETLPQSDDLPHSEETVALDNWRQVHEQCLALHSQQQTLQQQDVLAAQSLQKAQAQ
FT                   FDTALQASVFDDQQAFLAALMDEQTLTQLEQLKQNLENQRRQAQTLVTQTAETLAQHQQ
FT                   HRPDGLALTVTVEQIQQELAQTHQKLRENTTSQGEIRQQLKQDADNRQQQQTLLQQIAQ
FT                   MTQQVEDWGYLNSLIGSKEGDKFRKFAQGLTLDNLVHLANQQLTRLHGRYLLQRKASEA
FT                   LEVEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLD
FT                   SETLDTALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLESTFAVK"
FT   gene            complement(482909..484111)
FT                   /gene="sbcD"
FT                   /locus_tag="ECSP_0460"
FT   CDS_pept        complement(482909..484111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="ECSP_0460"
FT                   /product="exonuclease, dsDNA, ATP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70337"
FT                   /protein_id="ACT70337.1"
FT                   /translation="MRILHTSDWHLGQNFYSKSREAEHQAFLDWLLETAQTHQVDAIIV
FT                   AGDVFDTGSPPSYARTLYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDIMAFLNTTV
FT                   VASAGHAPQILPRRDGTPGAVLCPIPFLRPRDIITSQAGLNGIEKQQHLLAAITDYYQQ
FT                   HYADACKLRGDQPLPIIATGHLTTVGASKSDAVRDIYIGTLDAFPAQNFPPADYIALGH
FT                   IHRAQIIGGMEHVRYCGSPIPLSFDECGKSKYVHLVTFSNGKLESVENLNVPVTQPMAV
FT                   LKGDLASITAQLEQWRDVSQEPPVWLDIEITTDEYLHDIQRKIQALTESLPVEVLLVRR
FT                   SREQRERVLASQQRETLSELSVEEVFNRRLALEELDESQQQRLQHLFTTTLHTLAGEHE
FT                   A"
FT   gene            484301..484990
FT                   /gene="phoB"
FT                   /locus_tag="ECSP_0461"
FT   CDS_pept        484301..484990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="ECSP_0461"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system with PhoR (or CreC)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70338"
FT                   /protein_id="ACT70338.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEP
FT                   WPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTG
FT                   YRFSTRF"
FT   gene            485048..486343
FT                   /gene="phoR"
FT                   /locus_tag="ECSP_0462"
FT   CDS_pept        485048..486343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ECSP_0462"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70339"
FT                   /protein_id="ACT70339.1"
FT                   /translation="MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTQLLNEKVDVP
FT                   MMLRVVEREAQTLSQKKQTFTFEIDNGLKVSGNEDQLRSVISNLVYNAVNHTPEGTHIT
FT                   VRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHESRLNIESTVGKGTRFSFVIPERLIVKNSD"
FT   gene            complement(486354..486464)
FT                   /locus_tag="ECSP_0463"
FT   CDS_pept        complement(486354..486464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70340"
FT                   /protein_id="ACT70340.1"
FT                   /translation="MANHANKKSPTVVKSNARILTAKKISQHRLAYGNKR"
FT   gene            complement(486556..486705)
FT                   /locus_tag="ECSP_0464"
FT   CDS_pept        complement(486556..486705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70341"
FT                   /protein_id="ACT70341.1"
FT                   /translation="MPIPGDDTAVYLNNFSGKYSQPGAAKNSFSIYRVNAVSMTAPEAQ
FT                   FKRL"
FT   gene            486750..488069
FT                   /gene="brnQ"
FT                   /locus_tag="ECSP_0465"
FT   CDS_pept        486750..488069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="ECSP_0465"
FT                   /product="branched chain amino acid transporter (LIV-II)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70342"
FT                   /protein_id="ACT70342.1"
FT                   /translation="MTHQLRSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSALPLFIYSLVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIVWPAGSISTATEAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSASLVDQSANGAAILHAYVQHTFGGGGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRTLVFILGGFSMVVSNLGLSQLIQIS
FT                   VPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPPMFISLLFGILDGIKASAFSDILPSW
FT                   AQRLPLAEQGLAWLMPTVVMVVLAIIWDRAAGRQVTSSAH"
FT   gene            488145..489518
FT                   /gene="proY"
FT                   /locus_tag="ECSP_0466"
FT   CDS_pept        488145..489518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="ECSP_0466"
FT                   /product="predicted cryptic proline transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70343"
FT                   /protein_id="ACT70343.1"
FT                   /translation="MESKNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVL
FT                   LAYIIGGIAAYIIMRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAI
FT                   ADVTAFGIYMGVWFPTVPHWIWVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIM
FT                   IVAGFGIIIWGIGNGGQPTGIHNLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITA
FT                   GEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGITF
FT                   AASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTT
FT                   ALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKVP
FT                   GGVATTIGGLIFLLFIIGLIGYHPDTRISLYVGFAWIVVLLIGWMFKRRHDRQLAENQ"
FT   gene            489674..491491
FT                   /gene="malZ"
FT                   /locus_tag="ECSP_0467"
FT   CDS_pept        489674..491491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="ECSP_0467"
FT                   /product="maltodextrin glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70344"
FT                   /protein_id="ACT70344.1"
FT                   /translation="MMLNAWHLPVPPFVKQSKDQLLITLWLTGEDPPQRIMLRTEHDNE
FT                   EMSVPMHKQRSQPQPGVTAWRAAIDLSSGQPRRRYSFKLLWHDRQRWFTPQGFSRMPPA
FT                   RLEQFAVDVPDIGPQWAADQIFYQIFPDRFARSLPREAEQDHVYYHHAAGQEIILRDWD
FT                   EPVTAQAGGSTFYGGDLDGISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDP
FT                   QFGGDGALLRLRHNTQQLGMRLVLDGVFNHSGDSHAWFDRHNRGTGGACHNPESPWRDW
FT                   YSFSDDGTALDWLGYASLPKLDYQSESLVNEIYRGEDSIVRHWLKAPWNMDGWRLDVVH
FT                   MLGEAGGARNNLQHVAGITEAAKETQPEAYIVGEHFGDARQWLQADVEDAAMNYRGFTF
FT                   PLWGFLANTDISYDPQQIDAQTCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLG
FT                   REVARLPLAVVWLFTWPGVPCIYYGDEVGLDGKNDPFCRKPFPWQVEKQDMALFALYQR
FT                   MIALRKKSQALRRGGCQVLYAEDNVVVFVRVLNQQRVLVAINRGEACEVVLPASPFLNV
FT                   VQWQRKEGHGQLTDGILALPAISATVWMN"
FT   gene            491679..493124
FT                   /locus_tag="ECSP_0468"
FT   CDS_pept        491679..493124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0468"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70345"
FT                   /protein_id="ACT70345.1"
FT                   /translation="MTISNSNLLKPFITGTELPPFKEDVFSKTEEQFKKSTYGKSLFIS
FT                   GNENLVNISAEKIDEIKNSKNFFSNIVNIIILLIKHPDKILPILHGCPVESIEVIKNAK
FT                   RTGQWSYEMTDKNGQSIEVSYIFTDTIDDKSDGKLCLKICNSCNQNDSSTHEYKIDHQQ
FT                   LKNHIRQLEEWALLEKFYDNNAYYSKRTKQLEKKIADAGFITRKVKAENFNVKEFKDDI
FT                   ASMLCEQPPMRTHQISSSGYVSADKLHKLYKTNLEDAQRDLKTTPVDIDGVSLKSITRE
FT                   KIAEEIAKKTAEIIAKQNAKSIEEKNIEKNKKQTNSEDNFVLKFSPEEINEMLLDYSDE
FT                   EQKKLRPFFTSDHIYCLFDAFSQGLHNVARNGSPRYAGLLRQIASKSAILQDFDQQLFW
FT                   RTFTGGGLHRHISVKSEPEKTDVWRFSSQFDFPHINENGELSRTVLMFEGVAESNFKDI
FT                   ANHSSECFSYRCYAAPLDANAKK"
FT   gene            complement(493145..493726)
FT                   /gene="acpH"
FT                   /locus_tag="ECSP_0469"
FT   CDS_pept        complement(493145..493726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="ECSP_0469"
FT                   /product="ACP phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70346"
FT                   /protein_id="ACT70346.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSW
FT                   YDLDAHYAALETRFWQFYPRMMAQASRKAL"
FT   gene            493819..494889
FT                   /gene="queA"
FT                   /locus_tag="ECSP_0470"
FT   CDS_pept        493819..494889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="ECSP_0470"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70347"
FT                   /protein_id="ACT70347.1"
FT                   /translation="MRVTDFSFELPESLIAHYPMPERSSCRLLSLDGPTGALTHGTFTD
FT                   LLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   AELLLGDDESINATMTARHGALFEVEFNDERSVLDILNSIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYSEKPGAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIED
FT                   HIMHSEYAEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKNDLIEPFFDDTQ
FT                   IFIYPGFQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYGDA
FT                   MFITYNPQAINERVGE"
FT   gene            494944..496071
FT                   /gene="tgt"
FT                   /locus_tag="ECSP_0471"
FT   CDS_pept        494944..496071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="ECSP_0471"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70348"
FT                   /protein_id="ACT70348.1"
FT                   /translation="MKFELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRERFDSLGNKNALFGIIQGSVYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKA
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTDFYQRQGREVPPLNVD"
FT   gene            496094..496426
FT                   /gene="yajC"
FT                   /locus_tag="ECSP_0472"
FT   CDS_pept        496094..496426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="ECSP_0472"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70349"
FT                   /protein_id="ACT70349.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   gene            496454..498301
FT                   /gene="secD"
FT                   /locus_tag="ECSP_0473"
FT   CDS_pept        496454..498301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ECSP_0473"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70350"
FT                   /protein_id="ACT70350.1"
FT                   /translation="MLNRYPLWKYVMLIVVIVIGLLYALPNLFGEDPAVQITGARGVAA
FT                   SEQTLIQVQKTLQEEKITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALN
FT                   LAPATPRWLAAIHAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGI
FT                   PYTTVRKENNYGLSITFRDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEA
FT                   REYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDQAAAASGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQ
FT                   VNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQ
FT                   SRLGNSFRITGINNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACL
FT                   AGLLVSILFMIIFYKKFGLIATSALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELSNGRTVQQAIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIK
FT                   GFAITTGIGVATSMFTAIVGTRAIVNLLYGGKRVKKLSI"
FT   gene            498312..499283
FT                   /gene="secF"
FT                   /locus_tag="ECSP_0474"
FT   CDS_pept        498312..499283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ECSP_0474"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70351"
FT                   /protein_id="ACT70351.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDYWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEIDVMRDALQKAGFEEPMLQNFGSSHDIMVRMPPAEGE
FT                   TGGQVLGSQVLKVINESTNQNAAVKRIEFVGPSVGADLAQTGAMALMAALLSILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLMVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
FT   gene            499435..499677
FT                   /locus_tag="ECSP_0475"
FT   CDS_pept        499435..499677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70352"
FT                   /protein_id="ACT70352.1"
FT                   /translation="MRKITSVSVGEQLDSFITRMVQSGRYGSASEVMRSALRLLEQQES
FT                   RDEAVRNAVIEGLESGESSMTLRDIAAERKQKHRV"
FT   gene            499670..499951
FT                   /locus_tag="ECSP_0476"
FT   CDS_pept        499670..499951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70353"
FT                   /protein_id="ACT70353.1"
FT                   /translation="MYKLSGKAVEDFRGIYDYTLGKFGDEQADRYTDSLGTFLDTLSQM
FT                   PEIGQDYDAIPEVKKIAFRFHTVYYVIRVDDILIARILHQLMEPRRHW"
FT   gene            500039..500386
FT                   /gene="yajD"
FT                   /locus_tag="ECSP_0477"
FT   CDS_pept        500039..500386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="ECSP_0477"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70354"
FT                   /protein_id="ACT70354.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
FT   gene            complement(500563..501447)
FT                   /gene="tsx"
FT                   /locus_tag="ECSP_0478"
FT   CDS_pept        complement(500563..501447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="ECSP_0478"
FT                   /product="nucleoside channel, receptor of phage T6 and
FT                   colicin K"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70355"
FT                   /protein_id="ACT70355.1"
FT                   /translation="MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEP
FT                   RFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSM
FT                   NVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSG
FT                   NAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRS
FT                   TGWGGYLVVGYNF"
FT   gene            complement(501746..502285)
FT                   /gene="yajI"
FT                   /locus_tag="ECSP_0479"
FT   CDS_pept        complement(501746..502285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajI"
FT                   /locus_tag="ECSP_0479"
FT                   /product="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70356"
FT                   /protein_id="ACT70356.1"
FT                   /translation="MNINVFRLILLGSLFSLSACVQQSEVRQMKHSVSTLNQEMTQLNQ
FT                   ETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDTDGTTLTLRIQ
FT                   GESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISV
FT                   DQLGFVRIHDIQPVMQ"
FT   gene            502436..502885
FT                   /gene="nrdR"
FT                   /locus_tag="ECSP_0480"
FT   CDS_pept        502436..502885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="ECSP_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70357"
FT                   /protein_id="ACT70357.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
FT   gene            502889..503992
FT                   /gene="ribD"
FT                   /locus_tag="ECSP_0481"
FT   CDS_pept        502889..503992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="ECSP_0481"
FT                   /product="bifunctional
FT                   diaminohydroxyphosphoribosylaminopyrimidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70358"
FT                   /protein_id="ACT70358.1"
FT                   /translation="MQDEYYMARALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQR
FT                   AGEPHAEVHALRMAGEKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIDVSHGLMMSEAEQLNKGFLKRMRTGFPYIQLKLGASLDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWSELDVQTQALYPQH
FT                   HLRQPVRIVIDSQNRVTPEHHIVQQPGETWFARTQEDSREWPETVRTLLIPEHKGHLDL
FT                   VVLMMQLGKQQINSIWVEAGPTLAGALLQAGLVDELIVYIAPKLLGSDARGLCTLPGLE
FT                   KLADAPQFKFKEIRHVGPDVCLHLVGA"
FT   gene            504081..504551
FT                   /gene="ribE"
FT                   /locus_tag="ECSP_0482"
FT   CDS_pept        504081..504551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="ECSP_0482"
FT                   /product="riboflavin synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70359"
FT                   /protein_id="ACT70359.1"
FT                   /translation="MNIIEANVATPDARVAITIARFNNFINDSLLEGAIDALKRIGQVK
FT                   DENITVVWVPGAYELPLAAGALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHV
FT                   AQDSEIPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
FT   gene            504571..504990
FT                   /gene="nusB"
FT                   /locus_tag="ECSP_0483"
FT   CDS_pept        504571..504990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="ECSP_0483"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70360"
FT                   /protein_id="ACT70360.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAI
FT                   NEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK"
FT   gene            505068..506045
FT                   /gene="thiL"
FT                   /locus_tag="ECSP_0484"
FT   CDS_pept        505068..506045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ECSP_0484"
FT                   /product="thiamin-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70361"
FT                   /protein_id="ACT70361.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVELGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGFVPMGRALTRSGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADAKDADYLIKRHLRPSPRILQGQALRDLANSAIDLSDGLISDLG
FT                   HIVKASDCGARIDLALLPFSDALSRHVVPEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALGHLGVPFTCIGQMTADIEGLCFIRDGEPVTLDWKGYDHFATP"
FT   gene            506023..506538
FT                   /gene="pgpA"
FT                   /locus_tag="ECSP_0485"
FT   CDS_pept        506023..506538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="ECSP_0485"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70362"
FT                   /protein_id="ACT70362.1"
FT                   /translation="MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAA
FT                   IPFWYLMTFLPWQLYSLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMA
FT                   LPTNDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIG
FT                   HHWPLGIL"
FT   gene            complement(506716..508287)
FT                   /gene="espY3"
FT                   /locus_tag="ECSP_0486"
FT   CDS_pept        complement(506716..508287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY3"
FT                   /locus_tag="ECSP_0486"
FT                   /product="non-LEE-encoded type III secreted effector"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70363"
FT                   /protein_id="ACT70363.1"
FT                   /translation="MMKTITKQPILFTDVPVADLRNSMKQDLNQNLIERLWNKIRDFFL
FT                   DSDKQKAFKSIHKYINTLSVLNYNSALTPDPNFNIDATSDLDSYLKLDFDRLSPKQKQT
FT                   TLCCFWNKIASSLPEPYNSTIKHNIIFYKDGENLMIRGTISIVNEVVKTYSLPIEKDDN
FT                   GYYDFSGLYLAHSNISGKDPNKDPDIDFGIDMGNCNCSNVNFEHTYFYGVKFTNANCTN
FT                   ANFNNCRFKKCDLTNMNCTGAILDNAMIYGKEKEPEMQYPEADQIIQRITYQKSDGNET
FT                   KGMILTNCSCVKTTFNWADLSESDCQNVDFSEANLSNTILPDIVRMKGTKLYRTDLFNP
FT                   ILKTEAESTEEKDISPLAKIILDYIESDKNPESLNFEEKSTVIKIKQDIDNFIFYNQHL
FT                   KKIFNRAMNLQEKISRKKYNEFFKYIQAEAKQYFKDQYKLTKNDYLKKVPLTAQLIAKY
FT                   KMDDQLDQLLVTREIQDEIKSKIQDKIDELSKNLFNTMTETIENNFDDIFRQQSENMSN
FT                   YYEFVD"
FT   gene            complement(508518..509492)
FT                   /gene="yajO"
FT                   /locus_tag="ECSP_0487"
FT   CDS_pept        complement(508518..509492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="ECSP_0487"
FT                   /product="predicted oxidoreductase, NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70364"
FT                   /protein_id="ACT70364.1"
FT                   /translation="MQYNPLGKTDLRVSRLCLGCMTFGEPDRGNHAWTLPEESSRPIIK
FT                   RALEGGINFFDTANSYSDGSSEEIVGRALRDFSRREDVVVATKVFHRVGDLPEGLSRAQ
FT                   ILRSIDDSLRRLGMDYVDILQIHRWDYNTPIEETLEALNDVVKAGKARYIGASSMHASQ
FT                   FAQALELQKQHGWAQFVSMQDHYNLIYREEEREMLPLCYQEGVAVIPWSPLARGRLTRP
FT                   WGETTARLVSDEVGKNLYKESDENDAQIAERLTGVSEELGATRAQVALAWLLSKPGIAA
FT                   PIIGTSREEQLDELLNAVDITLKPEQIAELETPYKPHPVVGFK"
FT   gene            complement(509547..511409)
FT                   /gene="dxs"
FT                   /locus_tag="ECSP_0488"
FT   CDS_pept        complement(509547..511409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="ECSP_0488"
FT                   /product="1-deoxyxylulose-5-phosphate synthase,
FT                   thiamine-requiring, FAD-requiring"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70365"
FT                   /protein_id="ACT70365.1"
FT                   /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSR
FT                   SSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGL
FT                   HPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEA
FT                   MNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPI
FT                   KELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIM
FT                   TKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLM
FT                   AITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRA
FT                   YDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECR
FT                   QMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPE
FT                   AAKVAESLNATLVDMRFVKPLDETLILEMAASHEALVTVEENAIMGGAGSGVNEVLMAH
FT                   RKPVPVLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKAWLA"
FT   gene            complement(511434..512333)
FT                   /gene="ispA"
FT                   /locus_tag="ECSP_0489"
FT   CDS_pept        complement(511434..512333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="ECSP_0489"
FT                   /product="geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70366"
FT                   /protein_id="ACT70366.1"
FT                   /translation="MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGK
FT                   RLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVK
FT                   FGEANAILAGDALQTLAFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLD
FT                   AEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKAQDLIDDARQSLKQLAEQS
FT                   IDTSALEALADYIIQRNK"
FT   gene            complement(512333..512575)
FT                   /gene="xseB"
FT                   /locus_tag="ECSP_0490"
FT   CDS_pept        complement(512333..512575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="ECSP_0490"
FT                   /product="exonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70367"
FT                   /protein_id="ACT70367.1"
FT                   /translation="MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEDASLTPFTPDNE"
FT   gene            512781..514229
FT                   /gene="thiI"
FT                   /locus_tag="ECSP_0491"
FT   CDS_pept        512781..514229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="ECSP_0491"
FT                   /product="sulfur transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70368"
FT                   /protein_id="ACT70368.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRAKDENQRLTIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLDG
FT                   KTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VAHYLWNRFGSSHRVRFVAINFEPVVGEILEKIDDGQMGVILKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTM
FT                   PEYCGVISKSPTVKAVKSKIEAEEEKFDFSILDKVVEEANNVDIREIAQQTGQEVVEVE
FT                   TVNDFGPNDVILDIRSVDEQEDKPLKVEGIDVVSLPFYKLSTKFGDLDQNRTWLLWCER
FT                   GVMSRLQALYLREQGFKNVKVYRP"
FT   gene            complement(514283..514873)
FT                   /gene="yajL"
FT                   /locus_tag="ECSP_0492"
FT   CDS_pept        complement(514283..514873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajL"
FT                   /locus_tag="ECSP_0492"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70369"
FT                   /protein_id="ACT70369.1"
FT                   /translation="MSASALVCLAPGSEETEAVTTIDLLIRGGIKVTTASVASDGNLAI
FT                   TCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAA
FT                   ICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
FT   gene            complement(514836..515747)
FT                   /gene="panE"
FT                   /locus_tag="ECSP_0493"
FT   CDS_pept        complement(514836..515747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="ECSP_0493"
FT                   /product="2-dehydropantoate reductase, NADPH-specific"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70370"
FT                   /protein_id="ACT70370.1"
FT                   /translation="MKITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETD
FT                   GSIFNESLTANDPDFLATSDLLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIE
FT                   ELQNIQQPLLMGTTTHAACRDGNVIIHVANGITHIGPARQQDGDYSYLADILQTVLPDV
FT                   AWHNNIRAELWRKLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHT
FT                   SAEDLRDYVMQVIDATAENISSMLQDIRTLRHTEIDYINGFLLRRARAHGIAVPENTRL
FT                   FEMVKRKESEYERIGTGLPRPW"
FT   gene            515915..516406
FT                   /gene="yajQ"
FT                   /locus_tag="ECSP_0494"
FT   CDS_pept        515915..516406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="ECSP_0494"
FT                   /product="predicted nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70371"
FT                   /protein_id="ACT70371.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
FT   gene            complement(516534..517898)
FT                   /gene="yajR"
FT                   /locus_tag="ECSP_0495"
FT   CDS_pept        complement(516534..517898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="ECSP_0495"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70372"
FT                   /protein_id="ACT70372.1"
FT                   /translation="MNDYKMTPGERRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGA
FT                   SEALIGIAIGIYGLTQAVFQIPFGLLSDRIGRKPLIVGGLAVFAAGSVIAALSDSIWGI
FT                   ILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIITHKLG
FT                   LHALFWMIAILATTGIALTIWVVPNSSTHVLNRESGMVKGSFSKVLAEPRLLKLNFGIM
FT                   CLHILLMSTFVALPGQLADAGFPAAEHWKVYLATMLIAFGSVVPFIIYAEVKRKMKQVF
FT                   VFCVGLIVVAEIVLRNAQTQFWQLVVGVQLFFVAFNLMEALLPSLISKESPAGYKGTAM
FT                   GVYSTSQFLGVAIGGSLGGWIDGMFDGQGVFLAGAMLAAVWLAVASTMKEPPYVSSLRI
FT                   EIPANIAANEALKVRLLETEGIKEVLIAEEEHSAYVKIDSKVTNRFDVEQAIRQA"
FT   gene            complement(518047..518937)
FT                   /gene="cyoE"
FT                   /locus_tag="ECSP_0496"
FT   CDS_pept        complement(518047..518937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="ECSP_0496"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70373"
FT                   /protein_id="ACT70373.1"
FT                   /translation="MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVG
FT                   VSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPAVSLVYATLLGIAGFMLLWFG
FT                   ANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGEFDSGAA
FT                   ILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLM
FT                   LSLGGYAGYKYLVVAAAVSVWWLGMALRGYKVADDRIWARKLFGFSIIAITALSVMMSV
FT                   DFMVPDSHTLLAAVW"
FT   gene            complement(518949..519278)
FT                   /gene="cyoD"
FT                   /locus_tag="ECSP_0497"
FT   CDS_pept        complement(518949..519278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="ECSP_0497"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70374"
FT                   /protein_id="ACT70374.1"
FT                   /translation="MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAV
FT                   ILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
FT   gene            complement(519278..519892)
FT                   /gene="cyoC"
FT                   /locus_tag="ECSP_0498"
FT   CDS_pept        complement(519278..519892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="ECSP_0498"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70375"
FT                   /protein_id="ACT70375.1"
FT                   /translation="MATDTLTHATVHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
FT   gene            complement(519882..521873)
FT                   /gene="cyoB"
FT                   /locus_tag="ECSP_0499"
FT   CDS_pept        complement(519882..521873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="ECSP_0499"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70376"
FT                   /protein_id="ACT70376.1"
FT                   /translation="MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLW
FT                   KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTM
FT                   FKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFW
FT                   FWIIGFFVAFMPLYALGFMGMTRRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMY
FT                   VSIRDRDQNRDLTGDPWGGRTLEWATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKK
FT                   PDHYEEIHMPKNSGAGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVD
FT                   YYVPVAEIEKLENQHFDEITKAGLKNGN"
FT   gene            complement(521895..522842)
FT                   /gene="cyoA"
FT                   /locus_tag="ECSP_0500"
FT   CDS_pept        complement(521895..522842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="ECSP_0500"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70377"
FT                   /protein_id="ACT70377.1"
FT                   /translation="MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLIL
FT                   TAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLA
FT                   VLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGFATVNEIAFPANTPVYF
FT                   KVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKA
FT                   IATPDRAAFDQWVAKAKQSPNSMSDMAAFEKLAAPSEYNQVEYFSNVKPNLFADVINKF
FT                   MAHGKSMDMTQPEGEHSAHEGMEGMDMSHAESAH"
FT   gene            complement(523302..524777)
FT                   /gene="ampG"
FT                   /locus_tag="ECSP_0501"
FT   CDS_pept        complement(523302..524777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="ECSP_0501"
FT                   /product="muropeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70378"
FT                   /protein_id="ACT70378.1"
FT                   /translation="MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENID
FT                   LKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFFGRRRGWLLATQILLLVAIAAMGFLEPG
FT                   TQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLA
FT                   LWLADKWLGWQGMYWLMAALLIPCIIATLLAPEPTDTIPVPKTLEQAVVAPLRDFFGRN
FT                   NAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYGGI
FT                   LMQRLSLFRALLIFGILQGASNAGYWLLSITDKHLYSMGAAVFFENLCGGMGTSAFVAL
FT                   LMTLCNKSFSATQFALLSALSAVGRVYVGPVAGWFVEAHGWSTFYLFSVAAAVPGLILL
FT                   LVCRQTLEYTRVNDNFISRTAYPAGYAFAMWTLAAGVSLLAVWLLLLTMDALDLTHFSF
FT                   LPALLEVGVLVALSGVVLGGLLDYLALRKTHLT"
FT   gene            complement(524821..525399)
FT                   /gene="yajG"
FT                   /locus_tag="ECSP_0502"
FT   CDS_pept        complement(524821..525399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajG"
FT                   /locus_tag="ECSP_0502"
FT                   /product="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70379"
FT                   /protein_id="ACT70379.1"
FT                   /translation="MFKKILFPLVALFMLAGCARPPTTIEVSPTITLPQQDPSLMGVTV
FT                   SINGADQRTDQALAKVTRDNQIVTLTASRDLRFLLQEVLEKQMTARGYMVGPNGPVNLQ
FT                   IIVSQLYADVSQGNVRYNIATKADIAIIATAQNGNKMTKNYRASYNVEGAFQASNKNIA
FT                   DAVNSVLTDTIADMSQDTSIHEFIKQNAR"
FT   gene            525704..526021
FT                   /gene="bolA"
FT                   /locus_tag="ECSP_0503"
FT   CDS_pept        525704..526021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="ECSP_0503"
FT                   /product="regulator of penicillin binding proteins and beta
FT                   lactamase transcription (morphogene)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70380"
FT                   /protein_id="ACT70380.1"
FT                   /translation="MMIRERIEEKLRAAFQPVFLEVVDESYRHNVPAGSESHFKVVLVS
FT                   DRFTGERFLNRHRMIYSTLAEELSTTVHALALHTYTIKEWEGLQDTVFASPPCRGAGSI
FT                   A"
FT   gene            526365..527663
FT                   /gene="tig"
FT                   /locus_tag="ECSP_0504"
FT   CDS_pept        526365..527663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="ECSP_0504"
FT                   /product="peptidyl-prolyl cis/trans isomerase (trigger
FT                   factor)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70381"
FT                   /protein_id="ACT70381.1"
FT                   /translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFR
FT                   KGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFT
FT                   YSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGMLDTLRKQQATWKEKDGAVEAEDR
FT                   VTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYH
FT                   AENLKGKAAKFAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSA
FT                   IRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
FT                   AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMR
FT                   NVALEEQAVEAVLAKAKVTEKETTFNELMNQQA"
FT   gene            527908..528531
FT                   /gene="clpP"
FT                   /locus_tag="ECSP_0505"
FT   CDS_pept        527908..528531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="ECSP_0505"
FT                   /product="proteolytic subunit of ClpA-ClpP and ClpX-ClpP
FT                   ATP-dependent serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70382"
FT                   /protein_id="ACT70382.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
FT   gene            528657..529931
FT                   /gene="clpX"
FT                   /locus_tag="ECSP_0506"
FT   CDS_pept        528657..529931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="ECSP_0506"
FT                   /product="ATPase and specificity subunit of ClpX-ClpP
FT                   ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70383"
FT                   /protein_id="ACT70383.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKA
FT                   SEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIAKKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIDGQSKPLLIYGKPEAQQASGE"
FT   gene            530119..532473
FT                   /gene="lon"
FT                   /locus_tag="ECSP_0507"
FT   CDS_pept        530119..532473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="ECSP_0507"
FT                   /product="DNA-binding ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70384"
FT                   /protein_id="ACT70384.1"
FT                   /translation="MNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMD
FT                   HDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALS
FT                   DNGEHFSAKAEYLESPTIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPA
FT                   RLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQME
FT                   KSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKAEAELQKLKMM
FT                   SPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILNTDHYGLERVKDRILEYLAV
FT                   QSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALK
FT                   KGELTVDDSAIIGIIRYYTREAGVRGLEREISKLCRKAVKQLLLDKSLKHIEINGDNLH
FT                   DYLGVQRFDYGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQ
FT                   ESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTG
FT                   NPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIA
FT                   DLDIHPVKRIEEVLTLALQNEPSGMQVVTAK"
FT   gene            532682..532954
FT                   /gene="hupB"
FT                   /locus_tag="ECSP_0508"
FT   CDS_pept        532682..532954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="ECSP_0508"
FT                   /product="HU, DNA-binding transcriptional regulator, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70385"
FT                   /protein_id="ACT70385.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
FT   gene            533146..535017
FT                   /gene="ppiD"
FT                   /locus_tag="ECSP_0509"
FT   CDS_pept        533146..535017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="ECSP_0509"
FT                   /product="peptidyl-prolyl cis-trans isomerase D"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70386"
FT                   /protein_id="ACT70386.1"
FT                   /translation="MMDSLRTAANSLVLKIIFGIIIVSFILTGVSGYLIGGGNNYAAKV
FT                   NDQEISRGQFENAFNSERNRMQQQLGDQYSELAANEGYMKTLRQQVLNRLIDEALLDQY
FT                   ARELKLGISDEQVKQAIFATPAFQVDGKFDNSRYNGILNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVAQQRVVREATIDVNALAAKQPVTEQEIASYYEQNK
FT                   NNFMTPEQFRVSYIKLDAATMQQPVSDADLQSYYDQHQDQFTQPQRTRYSIIQTKTEDE
FT                   AKAVLDELNKGGDFAALAKEKSADIISARNGGDMGWLEDATIPDELKNAGLKEKGQLSG
FT                   VIKSSVGFLIVRLDDIQPAKVKSLDEVRDDVAAKVKHEKALDAYYALQQKVSDAASNDT
FT                   ESLAGAEQAAGVKATQTGWFSKENLPEELNFKPVADAIFNGGLVGENGAPGINSDIITV
FT                   DGDRAFVLRISEHKPEAVKPLADVQEQVKALVQHNKAEQQAKVDAEKLLVDLKAGKGAE
FT                   AMQAAGLKFGEPKTLSRSGRDPISQAAFALPLPAKDKPSYGMATDMQGNVVLLALDEVK
FT                   QGSMPEDQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
FT   gene            535168..535539
FT                   /gene="ybaV"
FT                   /locus_tag="ECSP_0510"
FT   CDS_pept        535168..535539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="ECSP_0510"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70387"
FT                   /protein_id="ACT70387.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQ
FT                   NKAAVPAKASDEEGSRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
FT   gene            535645..536043
FT                   /gene="ybaW"
FT                   /locus_tag="ECSP_0511"
FT   CDS_pept        535645..536043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="ECSP_0511"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70388"
FT                   /protein_id="ACT70388.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFHWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
FT   gene            complement(536095..536790)
FT                   /gene="queC"
FT                   /locus_tag="ECSP_0512"
FT   CDS_pept        complement(536095..536790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="ECSP_0512"
FT                   /product="enzyme in preQ0 biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70389"
FT                   /protein_id="ACT70389.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKVLNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGIKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AMKQKTGLK"
FT   gene            complement(536855..538555)
FT                   /gene="ybaE"
FT                   /locus_tag="ECSP_0513"
FT   CDS_pept        complement(536855..538555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="ECSP_0513"
FT                   /product="predicted transporter subunit:
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70390"
FT                   /protein_id="ACT70390.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGKPQTVTVSELAERCFCSERHVRTLLR
FT                   QAQEAGWLEWQAQSGRGKRGQLRFLVTPESLRNAMMEKALETGKQQDVLELAQLAPGEL
FT                   RTLLQPFMGGQWQNDTPTLRIPYYRPLEPLQPGFLPGRAEQHLAGQIFSGLTRFDNNTQ
FT                   RPIGDLAHHWETSADGLRWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALDQLFIS
FT                   VKRIEVTHPQCLTFFLHRPDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTAELVRL
FT                   ESHDYYHLRHPLLKAVEYWITPPLFEKDLGTSCRHPVQITIGKPEELQRVSQVSSGISL
FT                   GFCYLTLRKSPRLSLWQARKVISIIHQSGLLQTLEVGENLITASHALLPGWTIPHWQVP
FT                   DEVKLPKTLTLVYHLPIELHTMAERLQATLAAEGCELTIIFHNAKNWDDTTLLAHADLM
FT                   MGDRLIGEAPEYTLEQWLRCDPLWPHVFDAPAYAHLQSTLDAVQVMPDEENRFNALKAV
FT                   FSQLMTDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFTEAWLPAPSQ"
FT   gene            538655..539473
FT                   /gene="cof"
FT                   /locus_tag="ECSP_0514"
FT   CDS_pept        538655..539473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="ECSP_0514"
FT                   /product="thiamin pyrimidine pyrophosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70391"
FT                   /protein_id="ACT70391.1"
FT                   /translation="MARLAAFDMDGTLLMPDHHLGEKTLSTLARLRERDITLTFATGRH
FT                   ALEMQHILGAISLDAYLITGNGTRVHSLEGELLHRDDLPADVAELVLYQQWDTRASMHI
FT                   FNDDGWFTGKEIPALLQAFVYSGFRYQIIDVKKMPLGSVTKICFCGDHDDLTRLQIQLH
FT                   EALGERAHLCFSATDCLEVLPVGCNKGAALTVLTQHLGLSLRDCMAFGDAMNDREMLGS
FT                   VGSGFIMGNAMPQLRAELPHLPVIGHCRNQAVSHYLTHWLDYPHLPYSPE"
FT   gene            539625..540083
FT                   /gene="ybaO"
FT                   /locus_tag="ECSP_0515"
FT   CDS_pept        539625..540083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaO"
FT                   /locus_tag="ECSP_0515"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70392"
FT                   /protein_id="ACT70392.1"
FT                   /translation="MLDKIDRKLLALLQQDCTLSLQALAEAVNLTTTPCWKRLKRLEDD
FT                   GILIGKVALLDPEKIGLGLTAFVLIKTQHHSSEWYCRFVTVVTEMPEVLGFWRMAGEYD
FT                   YLMRVQVADMKRYDEFYKRLVNSVPGLSDVTSSFAMEQIKYTTSLPIE"
FT   gene            540113..541885
FT                   /gene="mdlA"
FT                   /locus_tag="ECSP_0516"
FT   CDS_pept        540113..541885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="ECSP_0516"
FT                   /product="predicted ATP-binding component of multidrug ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70393"
FT                   /protein_id="ACT70393.1"
FT                   /translation="MRLFAQLSWYFRREWRRYLGAVALLVIIAMLQLVPPKVVGIVVDG
FT                   VTEQHFTTGQILMWIATMVLIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQH
FT                   PEFYLRHRTGDLMARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIMMSTQISWQLTLF
FT                   ALLPMPVMAIMIKRNGDALHERFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSAL
FT                   FAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAIGGGSWMVVQGSLTLGQLTSFM
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVNDGSEPVPEGRGELDVNIH
FT                   QFTYPQTDHPALENVNFALKPGQMLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIP
FT                   LTKLQLDSWRSRLAVVSQTPFLFSDTVANNIALGCPNATQQEIEHVARLASVHDDILRL
FT                   PQGYDTEVGERGVMLSGGQKQRISIARALLVNAEILILDDALSAVDGRTEHQILHNLRQ
FT                   WGQGRTVIISAHRLSALTEASEIIVMQHGHIAQRGNHDVLAQQSGWYRDMYRYQQLEAA
FT                   LDDAPENREEAVDA"
FT   gene            541878..543659
FT                   /gene="mdlB"
FT                   /locus_tag="ECSP_0517"
FT   CDS_pept        541878..543659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="ECSP_0517"
FT                   /product="predicted ATP-binding component of multidrug ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70394"
FT                   /protein_id="ACT70394.1"
FT                   /translation="MRSFSQLWPTLKRLLAYGSPWRKPLGIAVLMMWVAAAAEVSGPLL
FT                   ISYFIDNMVAKNNLPLKVVAGLAAAYVGLQLFAAGLHYAQSLLFNRAAVGVVQQLRTDV
FT                   MDAALRQPLSEFDTQPVGQVISRVTNDTEVIRDLYVTVVATVLRSAALVGAMLVAMFSL
FT                   DWRMALVAIMIFPVVLVVMVIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQ
FT                   QARFGERMGEASRSHYMARMQTLRLDGFLLRPLLSLFSSLILCGLLMLFGFSASGTIEV
FT                   GVLYAFISYLGRLNEPLIELTTQQAMLQQAVVAGERVFELMDGPRQQYGNDDRPLQSGT
FT                   IEVDNVSFAYRDDNLVLKNINLSVPSRNFVALVGHTGSGKSTLASLLMGYYPLTEGEIR
FT                   LDGRPLSSLSHSALRQGVAMVQQDPVVLADTFLANVTLGRDISEERVWQALETVQLAEL
FT                   ARSMSDGIYTPLGEQGNNLSVGQKQLLALARVLVETPQILILDEATASIDSGTEQAIQH
FT                   ALAAVREHTTLVVIAHRLSTIVDADTILVLHRGQAVEQGTHQQLLAAQGRYWQMYQLQL
FT                   AGEELAASVREEESLSA"
FT   gene            543840..544178
FT                   /gene="glnK"
FT                   /locus_tag="ECSP_0518"
FT   CDS_pept        543840..544178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="ECSP_0518"
FT                   /product="nitrogen assimilation regulatory protein for
FT                   GlnL, GlnE, and AmtB"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70395"
FT                   /protein_id="ACT70395.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
FT   gene            544208..545494
FT                   /gene="amtB"
FT                   /locus_tag="ECSP_0519"
FT   CDS_pept        544208..545494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="ECSP_0519"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70396"
FT                   /protein_id="ACT70396.1"
FT                   /translation="MKIATIKTGLASLAMLPGLVMAAPAVADKADNAFMMICTALVLFM
FT                   TIPGIALFYGGLIRGKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLM
FT                   LKNIELTAVMGSIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYI
FT                   PIAHMVWGGGLLASHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPM
FT                   VFTGTAILYIGWFGFNAGSAGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLL
FT                   GACSGAIAGLVGVTPACGYIGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVH
FT                   GVCGIVGCIMTGIFAASSLGGVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLA
FT                   DLTVGLRVPEEQEREGLDVNSHGENAYNA"
FT   gene            complement(545543..546403)
FT                   /gene="tesB"
FT                   /locus_tag="ECSP_0520"
FT   CDS_pept        complement(545543..546403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="ECSP_0520"
FT                   /product="acyl-CoA thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70397"
FT                   /protein_id="ACT70397.1"
FT                   /translation="MSQALKNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALY
FT                   AAKETVPEERLVHSFHSYFLRPGDSKKPIIYDVETLRDGNSFSARRVAAIQNGKPIFYM
FT                   TASFQAPEAGFEHQKTMPSAPAPDGLPSETQIAQSLAHLLPPVLKDKFICDRPLEVRPV
FT                   EFHNPLKGHVAEPHRQVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEP
FT                   GIQIATIDHSMWFHRPFNLNEWLLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGV
FT                   MRNHN"
FT   gene            546621..547193
FT                   /gene="ybaY"
FT                   /locus_tag="ECSP_0521"
FT   CDS_pept        546621..547193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaY"
FT                   /locus_tag="ECSP_0521"
FT                   /product="predicted outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70398"
FT                   /protein_id="ACT70398.1"
FT                   /translation="MKLVHMASGLAVAIALAACADKSADIQTPAPAANTSISATQQPAI
FT                   QQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLAQKAVRTEGKQSPFSFVLP
FT                   FNPADVQPNARILLSAAITVNDKLVFITDTVQPVINQGGTKADLTLVPVQQTAVPVQAS
FT                   GGATTTVPSTSPTQVNPSSAVPAPTQY"
FT   gene            complement(547226..547615)
FT                   /gene="ybaZ"
FT                   /locus_tag="ECSP_0522"
FT   CDS_pept        complement(547226..547615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaZ"
FT                   /locus_tag="ECSP_0522"
FT                   /product="predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70399"
FT                   /protein_id="ACT70399.1"
FT                   /translation="MLVSCAMRLHSGVFPDYAEKLSQEEKMEKEDSFPQRVWQIVAAIP
FT                   EGYVTTYGDVAKLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQR
FT                   QALLAEGVMVSGSGQIDLQRYRWNY"
FT   gene            547916..548269
FT                   /gene="ybaA"
FT                   /locus_tag="ECSP_0523"
FT   CDS_pept        547916..548269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="ECSP_0523"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70400"
FT                   /protein_id="ACT70400.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
FT   gene            complement(548311..549861)
FT                   /gene="ylaB"
FT                   /locus_tag="ECSP_0524"
FT   CDS_pept        complement(548311..549861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="ECSP_0524"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70401"
FT                   /protein_id="ACT70401.1"
FT                   /translation="MRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDTYS
FT                   SRVAIRANKVATQGKDALQELERWQGADCSEAHLMEMRRVSYSYRYIQEVVYIDNNVPQ
FT                   CSSLEHESPPDTFPEPGKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASFID
FT                   VIPYSSWQIDAAIIGNAHNVVITSSDEIAQGIITRLQKTPGEHIENNGIIYDILPFPEM
FT                   NISIITWASSKMLQKGWHRQVFIWLPLGLVIGLLAAMFVLRILRRIQSPHHRLQDAIEN
FT                   RDICVHYQPIVSLANGKIVGAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLIIR
FT                   SVFEDMGDWLRQHPQQHISINLESTVLTSEKIPQLLREMINHYQVNPRQIALELTEREF
FT                   ADPKTSAPIISRYREAGHEIYLDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETSKQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQHL"
FT   gene            complement(550025..550495)
FT                   /gene="ylaC"
FT                   /locus_tag="ECSP_0525"
FT   CDS_pept        complement(550025..550495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="ECSP_0525"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70402"
FT                   /protein_id="ACT70402.1"
FT                   /translation="MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVA
FT                   FFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWY
FT                   NTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS"
FT   gene            complement(550611..551162)
FT                   /gene="maa"
FT                   /locus_tag="ECSP_0526"
FT   CDS_pept        complement(550611..551162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="ECSP_0526"
FT                   /product="maltose O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70403"
FT                   /protein_id="ACT70403.1"
FT                   /translation="MSTEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTL
FT                   RQQILADLFGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAL
FT                   GVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVT
FT                   KDVPDNVVVGGNPARIIKKL"
FT   gene            complement(551334..551552)
FT                   /gene="hha"
FT                   /locus_tag="ECSP_0527"
FT   CDS_pept        complement(551334..551552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="ECSP_0527"
FT                   /product="hemolysin expression modulating protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70404"
FT                   /protein_id="ACT70404.1"
FT                   /translation="MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
FT   gene            complement(551578..551952)
FT                   /gene="ybaJ"
FT                   /locus_tag="ECSP_0528"
FT   CDS_pept        complement(551578..551952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="ECSP_0528"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70405"
FT                   /protein_id="ACT70405.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAIN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYLDDTFMLFSSYGINMQDLQKWRKSG
FT                   NRLFRCFVNATKENPASLSC"
FT   gene            complement(552498..555647)
FT                   /gene="acrB"
FT                   /locus_tag="ECSP_0529"
FT   CDS_pept        complement(552498..555647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="ECSP_0529"
FT                   /product="multidrug efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70406"
FT                   /protein_id="ACT70406.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTI
FT                   SASYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGVSIEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMK
FT                   DAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
FT                   NGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPIAKGDHGEGKKGFFGWFN
FT                   RMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMTMV
FT                   QLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWA
FT                   DRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
FT                   LTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAA
FT                   WGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYG
FT                   SPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTGVGYDWTGMSYQERLSGN
FT                   QAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVG
FT                   LLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRPILMTSLAFILGVMPL
FT                   VISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRKNEDIEHNHTVDH
FT                   H"
FT   gene            complement(555670..556863)
FT                   /gene="acrA"
FT                   /locus_tag="ECSP_0530"
FT   CDS_pept        complement(555670..556863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="ECSP_0530"
FT                   /product="multidrug efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70407"
FT                   /protein_id="ACT70407.1"
FT                   /translation="MNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQGGQQMPAVGVVTV
FT                   KTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQAT
FT                   YDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAA
FT                   VETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSND
FT                   FLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFP
FT                   NPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVAS
FT                   QAIGDKWLVTEGLKAGDRVVISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS"
FT   gene            557005..557652
FT                   /gene="acrR"
FT                   /locus_tag="ECSP_0531"
FT   CDS_pept        557005..557652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="ECSP_0531"
FT                   /product="DNA-binding transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70408"
FT                   /protein_id="ACT70408.1"
FT                   /translation="MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTR
FT                   GAIYWHFKDKSDLFSEIWELSESNIGELELEYQAKFPGDPLSVLREILIHVLESTVTEE
FT                   RRRLLMEIIFHKCEFVGEMAVVQQAQRNLCLESYDRIEQTLKHCIEAKMLPADLMTRRA
FT                   AIIMRGYISGLMENWLFAPQSFDLKKEARDYVAILLEMYLLCPTLRNPATNE"
FT   gene            557780..561142
FT                   /gene="kefA"
FT                   /locus_tag="ECSP_0532"
FT   CDS_pept        557780..561142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefA"
FT                   /locus_tag="ECSP_0532"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70409"
FT                   /protein_id="ACT70409.1"
FT                   /translation="MTMFQYYKRSRHFVFSAFIAFVFVLLCQNTAFARASSNGDLPTKA
FT                   DLQAQLDSLNKQKDLSAQDKLVQQDLTDTLATLDKIDRVKEETVQLRQKVAEAPEKMRQ
FT                   ATAALTALSDVDNDEETRKILSTLSLRQLETRVAQALDDLQNAQNDLASYNSQLVSLQT
FT                   QPERVQNAMYNASQQLQQIRSRLDGTDVGETALRPSQKVLMQAQQALLNAEIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSARLEHQLQLLQEAVNSKRLTLTEKTAQEAVSPDEAARI
FT                   QANPLVKQELEINQQLSQRLITATENGNQLMQQNIKVKNWLERALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELENMTNRIADLRLEQFEVNQQRDALFQSDAFVNKLEEG
FT                   HTNEVNSEVHDALLQVVDMRRELLDQLNKQLGNQLMMAINLQINQQQLMSVSKNLKSIL
FT                   TQQIFWVNSNRPMDWDWIKAFPQSLKDEFKSMKITVNWEKAWPAVFIAFLAGLPLLLIA
FT                   GLIHWRLGWLKAYQQKLASAVGSLRNDSQLNTPKAILIDLIRALPVCLIILAVGLILLT
FT                   MQLNISELLWSFSKKLAIFWLVFGLCWKVLEKNGVAVRHFGMPEQQTSHWRRQIVRISL
FT                   ALLPIHFWSVVAELSPLHLMDDVLGQAMIFFNLLLIAFLVWPMCRESWRDKESHTMRLV
FT                   TITVLSIIPIALMVLTATGYFYTTLRLSGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPPEEPTIALEQVNQQTLRITMLLMFALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNGTEAGAAVVKNVTMGSLLFAIIASMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYIIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGSFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLTDTTTRLVIRLGVAYGSDLEKVRKVLLKAATEHPRVMHEPMPEVFFTAFGAS
FT                   TLDHELRLYVRELRDRSRTVDELNRTIDQLCRENDINIAFNQLEVHLHNEKGDEVTEVK
FT                   RDYKGDDPTPAVG"
FT   gene            complement(561181..561345)
FT                   /gene="ybaM"
FT                   /locus_tag="ECSP_0533"
FT   CDS_pept        complement(561181..561345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="ECSP_0533"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70410"
FT                   /protein_id="ACT70410.1"
FT                   /translation="MSLENAPDDVKLAVDLIVLLEENQIPARTVLRALDIVKRDYEKKL
FT                   QSDEASQSE"
FT   gene            complement(561359..561886)
FT                   /gene="priC"
FT                   /locus_tag="ECSP_0534"
FT   CDS_pept        complement(561359..561886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="ECSP_0534"
FT                   /product="primosomal replication protein N''"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70411"
FT                   /protein_id="ACT70411.1"
FT                   /translation="MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFNRHLFQTRATT
FT                   LQACLDKAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREATAWSLREWDSAPPQ
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
FT   gene            561956..562333
FT                   /gene="ybaN"
FT                   /locus_tag="ECSP_0535"
FT   CDS_pept        561956..562333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="ECSP_0535"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70412"
FT                   /protein_id="ACT70412.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPC
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
FT   gene            562486..563037
FT                   /gene="apt"
FT                   /locus_tag="ECSP_0536"
FT   CDS_pept        562486..563037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="ECSP_0536"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70413"
FT                   /protein_id="ACT70413.1"
FT                   /translation="MTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSI
FT                   DLLVERYKNAGINKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
FT                   GTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGG
FT                   EQRLEKQGITSYSLVPFPGH"
FT   gene            563166..565097
FT                   /gene="dnaX"
FT                   /locus_tag="ECSP_0537"
FT   CDS_pept        563166..565097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="ECSP_0537"
FT                   /product="DNA polymerase III/DNA elongation factor III, tau
FT                   and gamma subunits"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70414"
FT                   /protein_id="ACT70414.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLARAAEGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAMVEANGERVMALINEAAARGIEWEAL
FT                   LVEMLGLLHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELP
FT                   YAPDRRMGVEMTLLRALAFHPRMPLPEPEVPRQSFAPVAPTAVMTPTQVPPQPQSAPQQ
FT                   APTVPLPETTSQVLAARQQLQRVQGATKAKKSEPAAATRARPVNNAALERLASVTDRVQ
FT                   ARPVPSALEKAPAKKEAYRWKATTPVMQQKEVVATPKALKKALEHEKTPELAAKLAAEA
FT                   IERDAWAAQVSQLSLPKLVEQVALNAWKEESDNAVCLHLRSSQRHLNNRGAQQKLAEAL
FT                   SMLKGSTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAEL
FT                   DEDSIRPI"
FT   gene            565150..565479
FT                   /gene="ybaB"
FT                   /locus_tag="ECSP_0538"
FT   CDS_pept        565150..565479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="ECSP_0538"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70415"
FT                   /protein_id="ACT70415.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
FT   gene            565479..566084
FT                   /gene="recR"
FT                   /locus_tag="ECSP_0539"
FT   CDS_pept        565479..566084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="ECSP_0539"
FT                   /product="gap repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70416"
FT                   /protein_id="ACT70416.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
FT   gene            566194..568068
FT                   /gene="htpG"
FT                   /locus_tag="ECSP_0540"
FT   CDS_pept        566194..568068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="ECSP_0540"
FT                   /product="molecular chaperone HSP90 family"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70417"
FT                   /protein_id="ACT70417.1"
FT                   /translation="MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADK
FT                   LRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKS
FT                   FLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYT
FT                   VADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVI
FT                   SWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIP
FT                   SQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQ
FT                   DSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKL
FT                   LRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVL
FT                   LLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADEVDESAKEAEKALTPFIDRVKA
FT                   LLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVL
FT                   VKRAADTEDEAKFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS"
FT   gene            568249..568893
FT                   /gene="adk"
FT                   /locus_tag="ECSP_0541"
FT   CDS_pept        568249..568893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="ECSP_0541"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70418"
FT                   /protein_id="ACT70418.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
FT                   YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG"
FT   gene            569025..569987
FT                   /gene="hemH"
FT                   /locus_tag="ECSP_0542"
FT   CDS_pept        569025..569987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="ECSP_0542"
FT                   /product="ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70419"
FT                   /protein_id="ACT70419.1"
FT                   /translation="MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTSRLLW
FT                   WPLLRGVILPLRSPRVAKLYASVWMEGGSPLMVYSRQQQQALAQRLPETPVALGMSYGS
FT                   PSLESAVDELLAEHVDHIVVLPLYPQFSCSTVGAVWDELARILARKRSIPGISFIRDYA
FT                   DNHDYINALANSVRASFAKHGEPDLLLLSYHGIPQRYADEGDDYPQRCRTTTRELASAL
FT                   GMAPEKVMMTFQSRFGREPWLMPYTDETLKMLGEKGVGHIQVMCPGFAADCLETLEEIA
FT                   EQNREVFLGAGGKKYEYIPALNATPEHIEMMANLVAAYR"
FT   gene            complement(569984..570943)
FT                   /gene="aes"
FT                   /locus_tag="ECSP_0543"
FT   CDS_pept        complement(569984..570943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="ECSP_0543"
FT                   /product="acetyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70420"
FT                   /protein_id="ACT70420.1"
FT                   /translation="MKPENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYT
FT                   LERRFWNAGAPEMATKAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHD
FT                   RIMRLLASYSQCTVIGIDYTLSPEARFPQVIEEIVAACCYFHQQAEDYQINMSRIGFAG
FT                   DSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQ
FT                   MYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQP
FT                   CEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL"
FT   gene            571095..572399
FT                   /gene="gsk"
FT                   /locus_tag="ECSP_0544"
FT   CDS_pept        571095..572399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="ECSP_0544"
FT                   /product="inosine/guanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70421"
FT                   /protein_id="ACT70421.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQFQPENETSAAWVVGIDQTLVD
FT                   IEAKVDDEFIERYGLSAGHSLVIEDDVAEALYQELKQKNLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQGVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEDVIAGASALVLTSYLVRCKPGEPMPEATMKAIEYAKKYNVP
FT                   VVLTLGTKFVIAENPQWWQQFLKDHVSILAMNEDEAEALTGESDPLLASDKALDWVDLV
FT                   LCTAGPIGLYMAGFTEDEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCQNPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
FT   gene            complement(572532..574208)
FT                   /gene="ybaL"
FT                   /locus_tag="ECSP_0545"
FT   CDS_pept        complement(572532..574208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="ECSP_0545"
FT                   /product="predicted transporter with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70422"
FT                   /protein_id="ACT70422.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMLANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKAIAIPGAIAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMMEQGDVGFATLAVDMGITIGKVIAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLILIQQPLAVLATLAIILFGKSLAAFFLVRLFGHSQRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFALLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGYGRVGSLLGEKLLASDIPLVVIETSRTRVDELRE
FT                   RGVRAVLGNAANEEIMQLAHLECAKWLILTIPNGYEAGEIVASARAKNPDIEIIARAHY
FT                   DDEVAYITERGANQVVMGEREIARTMLELLETPPAGEVVTG"
FT   gene            complement(574445..575665)
FT                   /gene="fsr"
FT                   /locus_tag="ECSP_0546"
FT   CDS_pept        complement(574445..575665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="ECSP_0546"
FT                   /product="predicted fosmidomycin efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70423"
FT                   /protein_id="ACT70423.1"
FT                   /translation="MAMSEQTQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQSEFSLTFMQIGMITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGL
FT                   VLLALAGSFGAVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPR
FT                   NKVVLAVSILLILIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLILPYASLHWTGVLTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIELVYKICAFLPLLGMLTIFL
FT                   PDNRHKD"
FT   gene            575883..577535
FT                   /gene="ushA"
FT                   /locus_tag="ECSP_0547"
FT   CDS_pept        575883..577535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="ECSP_0547"
FT                   /product="bifunctional UDP-sugar hydrolase and
FT                   5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70424"
FT                   /protein_id="ACT70424.1"
FT                   /translation="MKLLQRGVALALLTTFTLASEAALAYEQDKTYKITVLHTNDHHGH
FT                   FWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGM
FT                   NLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDL
FT                   KIAVIGLTTDDTAKLGNPENFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYD
FT                   NGDHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQN
FT                   GIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIA
FT                   ENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGA
FT                   DFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSG
FT                   AYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVN
FT                   TGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ"
FT   gene            complement(577572..578051)
FT                   /gene="ybaK"
FT                   /locus_tag="ECSP_0548"
FT   CDS_pept        complement(577572..578051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="ECSP_0548"
FT                   /product="bifunctional cys-tRNA Pro deacetylase/cys-tRNA
FT                   Cys deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70425"
FT                   /protein_id="ACT70425.1"
FT                   /translation="MTPAVKSLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVY
FT                   KTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGIS
FT                   PLGQKKRLPTIIDAPAQEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD"
FT   gene            complement(578255..579049)
FT                   /gene="ybaP"
FT                   /locus_tag="ECSP_0549"
FT   CDS_pept        complement(578255..579049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="ECSP_0549"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70426"
FT                   /protein_id="ACT70426.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDISLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQKLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEN
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMSWWLNAPPQNNEITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRAMPPGRYVVAVGALHLYGEGNLPQMLR"
FT   gene            579187..579528
FT                   /gene="ybaQ"
FT                   /locus_tag="ECSP_0550"
FT   CDS_pept        579187..579528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaQ"
FT                   /locus_tag="ECSP_0550"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70427"
FT                   /protein_id="ACT70427.1"
FT                   /translation="MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALI
FT                   NNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLWEVENNMRTQEELGRIETVAEYLAR
FT                   REERAKKVA"
FT   gene            complement(579743..582247)
FT                   /gene="copA"
FT                   /locus_tag="ECSP_0551"
FT   CDS_pept        complement(579743..582247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="ECSP_0551"
FT                   /product="copper transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70428"
FT                   /protein_id="ACT70428.1"
FT                   /translation="MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSITEAHVTG
FT                   TASAEQLIETIKQAGYDASVSHPKAKPLAESSIPSEALTAVSEALPAATADDDDSQQLL
FT                   LSGMSCASCVTRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAVEKAGYGAEA
FT                   IEDDAKRRERQQETAVATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTADNRSLWLVI
FT                   GLITLAVMVFAGGHFYRSAWKSLLNGAATMDTLVALGTGVAWLYSMSVNLWPQWFPMEA
FT                   RHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPPTARLVTDEGEKSVPLAE
FT                   VQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSV
FT                   LFRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVVIALVSAAIWYFF
FT                   GPAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQRASTL
FT                   DTVVFDKTGTLTEGKPQVVAVKTFADFDEAQALRLAAALEQGSSHPLARAILDKASDMQ
FT                   LPQVNGFRTLRGLGVSGEAEGHALLLGNQALLNDQQVDTKAIEADISAQASQGATPVLL
FT                   AVDGKAVALLAVRDPLRSDSVAALQRLHKAGYRLVMLTGDNPTTANAIAKEAGIDEVIA
FT                   GVLPDGKAEAIKRLQSEGRQVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLM
FT                   RHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTGTLLNPVVAGAA
FT                   MALSSITVVSNANRLLRFKPKE"
FT   gene            582509..583441
FT                   /gene="ybaS"
FT                   /locus_tag="ECSP_0552"
FT   CDS_pept        582509..583441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaS"
FT                   /locus_tag="ECSP_0552"
FT                   /product="predicted glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70429"
FT                   /protein_id="ACT70429.1"
FT                   /translation="MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAI
FT                   VTSDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIAL
FT                   ELHGGKPLSPLVNAGAIATTSLINAENAEQRWQRILHIQQQLAGELVALSDEVNQSEQT
FT                   TNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLINTVELATLGATLAAGGVNPLTH
FT                   KRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSP
FT                   PLDEEGNSVRGQKMVASVAKQLGYNVFKG"
FT   gene            583444..584736
FT                   /gene="ybaT"
FT                   /locus_tag="ECSP_0553"
FT   CDS_pept        583444..584736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaT"
FT                   /locus_tag="ECSP_0553"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70430"
FT                   /protein_id="ACT70430.1"
FT                   /translation="MMNTEGNNGNKPLGLWNVVSIGIGAMVGAGIFALLGQAALLMEAS
FT                   TWVAFAFGGIVAMFSGYAYARLGASYPSNGGIIDFFRRGLGNGVFSLALSLLYLLTLAV
FT                   SIAMVARAFGAYAVQFLHEGSQEEHLILLYALGIIAVMTLFNSLSNHAVGRLEVILVGI
FT                   KMMILLLLIIAGVWSLQPAHISVSAPPSSGAFFSCIGITFLAYAGFGMMANAADKVKDP
FT                   QVIMPRAFLVAIGVTTLLYISLALVLLSDVSALELEKYADTAVAQAASPLLGHVGYVIV
FT                   VIGALLATASAINANLFAVFNIMDNMGSERELPKLMNKSLWRQSTWGNIIVVVLIMLMT
FT                   AALNLGSLASVASATFLICYLAVFVVAIRLRHDIHASLPILIVGTLVMLLVIVGFIYSL
FT                   WSQGSRALIWIIGAILLSLIVAMVMKRNKTV"
FT   gene            585074..586429
FT                   /locus_tag="ECSP_0554"
FT   CDS_pept        585074..586429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0554"
FT                   /product="putative outer membrane export protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70431"
FT                   /protein_id="ACT70431.1"
FT                   /translation="MARFQFKNRKNNGLIFFISFMVMGEAAIAAPLPQWANAPAVTPVA
FT                   QLSLQESILRAFARNPGVTQQAAQIGIGEAQIDEAKSAWYPHVGLTGNAGPSRQTDSSG
FT                   RLDNNVSYGITLTQLVYDFGKTNNDINLQTAARDSYRFKLMATLTDVAEKTATAYMEVS
FT                   RYQALCDAAQRNIHSLENVYNMAALRANAGLNSSSDELQAQTRIAGMRSTLEQYQAQMA
FT                   SAKAQLAVLTGVQPEAIAAPPAELAEQPVSLKNIDYQSIPLVLAAENLRQSAQYGVEKT
FT                   KAQYWPTLSIQGGKTRYQTSDRSYWDDQLQLNVNAPLYQGGAVSAQVQQAEGQQKISAS
FT                   QVEQAKLDVLQRASVAYANWTGARGREEAGLAQSESAHKTRDVYQNEYKLGKRSLNDLL
FT                   TVEQDVFQAQSAEINANYDGWVAAVNYAAAVNNLIPLAGIKQGLYNDLPDLK"
FT   gene            586532..590917
FT                   /locus_tag="ECSP_0555"
FT   CDS_pept        586532..590917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0555"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70432"
FT                   /protein_id="ACT70432.1"
FT                   /translation="MSLIIDVISRKTSVKQTLINPGDVTVVIYEPSVVQVHAQASAVAR
FT                   YVREGNDLLIYMRDGTVIRCNGYFLQAANTAEQSELVFADGQQLTHITFADTAAGGLAP
FT                   VELTAQTTAIESIAPFLDTVAQTSAFPWGWLAGAAVGGGALGALLASGGDGDSKTEVIN
FT                   NPTPPAEPGNATPSFLVTDNQGDQRGILATNDITDDTTPTFSGSGQAGATIQIKDSNGN
FT                   TIASTQVDNNGHWSVSLPTQSAGEHTWSVVQIVGSTITDAGSITLTIDNSQASVQVATT
FT                   AGDNIINASEQAAGFTLSGTSSHLAQGTELTVTLNGKTYTTSVGANGAWSVQVPTADAQ
FT                   ALGEGNQAVLVSGKDATGNTVTGAQLLTVDTQPPTLAINTIAQDNIISAAEHNVALVLS
FT                   GTSNAEAGQTVTLTVNGKSHTATVGSDGTWQVTLPATEVQALAEGNYAVNASVSDRAGN
FT                   TTSHSANFTVDTSAPVVSVNTVAGDDILNNAEQAVAQIISGQVSGASPGDTVTVKLGTH
FT                   VLTGIVLADGSWNVALDPAVTRTLDRGANTIFVTVTDAAGNTGAASRAITLVGVSPLIT
FT                   INTVSGDDIISGAEKGAPLTLTGSTQQAETGQTVTVTLAGQSFTTTVQADGSWSLTVPA
FT                   AAMGNLPDGAVAITASVTDLSGNTGNTSRTITVDSQAPALSIDPLTADNIINAAESGQD
FT                   LPITGTTDAQPGQTVTVTLNGQTYQGVVQPDGTWSVTVPAANVGALADGNATVTASVND
FT                   VAGNPSSVSRVALVDATPPVVTINPVATDNVINTPEHAQAQIISGTVTGAQAGDIVTVT
FT                   LNNVDYTTVVDGSGNWSLGVPASVVSGLADGSYPVSVSVTDKAGNTGSQSLTVTVNTAA
FT                   PLIGINSIAGDDVINASEKGADLQITGTSDQPVNTAITVTLNGQNYTTTTDASGNWSVT
FT                   VPASAVTALGQANYTVTAAVTSDIGNSATASHNVLVDSALPGVTINPVATDDIINAAEA
FT                   GVAQTISGQVTGAEDGDTVTITLGGNTYTATVGSNLTWSVDVPAADIQALGNGDLTVNA
FT                   SVTNQNGNTGSGTRDITIDANLPGLRVDTVAGDDVVNIIEHGQALVVTGSSSGLAESTP
FT                   LTVTINNVEYTTAVQADGSWSVGVTAAQVSAWPAGTVNIAVSGESSAGNSVSITHPVTV
FT                   DLTPAAITINTIATDDVINAAEKGADLTLSGTTTNVEPGQTVTVTFGGKNYTASVASDG
FT                   SWTATVPAADLASLPEGSASALASVSNINGNSASAVHNYSVDSSAPTIIINTVASDNIV
FT                   NASEADAGVTVSGSTTAEAGQIVTITLNSPTVQTYQATVQADGSWSINIPAADLEALTD
FT                   GSHTLTATVNDKAGNPASTTHNLAVDLTVPVLTINTIAGDDIINATEHGQALVISGSST
FT                   GGEAGDVVTVTLNSKTYTTTLDASGNWSVGVPAADVTALGSGPQTVTATVTDAAGNSDN
FT                   "
FT   gene            591125..604264
FT                   /locus_tag="ECSP_0556"
FT   CDS_pept        591125..604264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0556"
FT                   /product="putative RTX family exoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70433"
FT                   /protein_id="ACT70433.1"
FT                   /translation="MPASAVGALGEASYTVTANVTDSAGNSNSASHNVQVNTALPGVTI
FT                   NPVATDDIINAAESGNAQTISGQVTGAAAGDTVTVTLGGKTYTATVQGNLSWSVDVPAA
FT                   DIQAIGNGNLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVVNSIEHAQAL
FT                   VITGSSSGLAAGAALTVVINTVTYAATVLADGTWSVGVPAADVSNWPAGTVNITVSGTN
FT                   TAGTTSTITHPVTVDLAAVAISINTVSGDDVINAAEKGADLTLSGSTSGVEVGQTVTVT
FT                   FGGKTYTATVAGDGSWTTTVPAADLSVLRDGDATVQASVSTINGNTASATHAYSVDATA
FT                   PTLAINTIATDDILNAAEAGNPLTISGSSTAEAGQTVTVTLNGVTYSGSVQADGSWSVS
FT                   LPTADLSNLTASQYTVSASVSDKAGNPASANHGLAVDLTVPVLTINTVSGDDIINAAEH
FT                   GQALVISGSSTGGEAGDVITVTLNSKTYTTMLDASGNWSVGVPAADVTALGSGPQTITA
FT                   AITDAAGNSDDASRTVTVNLAAPTIGINTIATDDVIKATEKGADLQITGTSNQPAGTTI
FT                   TVTLNGQNYTATTDSNGNWSATVPASAVSALGEANYTVTANVTDTAGNSNSASHNVLVN
FT                   SALPAVTINAVATDDIINAAESGNAQTISGQVTGAAQGDTVTVTLGGNTYTATVQSNLS
FT                   WSVDVPAADIQALGNGDLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVIN
FT                   SIEHNQALVITGSSSGLTAGTALTVEINNVTYGATVLADGTWSLGVPAVDVSNWPAGTV
FT                   NITVSGTNSAGTTSTITHPVTVDLAGVAITINTLSGDDVINAVEKGETLVVSGSTSGVE
FT                   AGQTVTVTFGGKNYTTTVEANGSWTVNVPPADLAALPDGAGNVQASVSNINGNSAQADR
FT                   AYSVDATAPLVTINTIASDDILNVSEAGAGITISGTTTAQAGQTLTVTLNNNTYQTTVL
FT                   ADGTWSVNVPAADLSGLTASSYTVTATVSDKAGNPASADHALVVDITAPDLTINTVAGD
FT                   DIINAIEHDQALVVSGTSTGAAAGDVVTVTLNGKNYTTTLDASGNWSVGIPAADVTALA
FT                   TGSQTITASLSDRAGNSDSTTHDVTVDLSGPTLTINTVSGDDIINAAEIVVAQTISGQV
FT                   TGTAVAGNTVIVTIGGNQYNATVQSDLSWSVSVPANVLQALGNGELTISASLTNSANNT
FT                   GTATHDIVIDANLPGLRVDTVAGDDVINSIEHTQALVITGSSSGLAAGAALTVVINSVT
FT                   YGATVLADGSWSVGVPVADVTNWPAGTVNIAVSGTNTAGTTTSISHPVTVDLAAVAITI
FT                   NTLSTDDVINAAEKGSDLQLSGTTSGVEAGQTITVIFGGKSYTTTVAADNTWGLTIPAV
FT                   DVATLPDGAANVQASVSNVAGNSTQATHAYSVDATAPSVTINTIATDDILNAAEAGSAL
FT                   TISGTSTAEAGQTVTVTLNGVNYSGNVQADGSWSVSVPTGDLASLTASSYTVNASVSDK
FT                   ARNSASATHNLTVDLAAPVVTINTVAGDDIINATEHGQAQIISGSATGATTGNTVSVTI
FT                   GTTTYTTVLDANGNWSIGVPASVISALAQGDVTITATVTDSAGNSGTASHTVTVALGAP
FT                   VLAINTIAVDDIINAAEKGADLAITGTSNQPAGTQITVTLNGQNYTTTADASGNWSVTV
FT                   PASRVSALGEATYTVTAAATDADGNSGSASHNVQVNTALPGVTINVVATDDIINAAEAG
FT                   VEQTISGQVTGAAAGDTVTVTLGGATYTATVQANLSWSVDVPASALQELGNGELTISAS
FT                   VTNSVGNTGNGTREITIDANLPGLRVDTVAGDDVVNIIEHGQALVITGSSSGLAAGSNV
FT                   TLTINGQTYVAAVLADGTWSVGVPAVDVSAWPAGSVTIAASGSTSAGNPVSVTHPVTVD
FT                   LSAVAVSINAITADDVINAAEKGAALTLSGSTSGVEAGQTVTVTFGGKTYSATVAANGS
FT                   WSTSVPAADMAALRDGDASAQASVSNVNGNSATTTHAYSVDASAPTVTINTIAGDDILN
FT                   AAEAGAALTITGSSTAEAGQTVTVTLNGTNYTGTVQTDGSWSVSVPSADLSTLTASNYT
FT                   VNAAVSDKAGNPASVNHNLTVDTSVPVVTINTVAGDDVINATEHAQAQIISGSATGAAT
FT                   GSTVTVTIGTNTFTTVLDASGNWSVGVPASVVSALANGTVTINASVTDAGGNSGSATHQ
FT                   VTVNTGLPTITFNAISGDNILNADEKGQPLTISGGSTGLATGAQVTVTLNGHNYSATTD
FT                   ASGNWTLTVPVSDLAALGQANYTVSASATSAAGNTASSQANLLVDSGLPDVTINTVAGD
FT                   DIINAAEAGADQTISGVVTRAAAGDTVTVTLGGNTYTATVQSNLSWSVSVPTADLQALG
FT                   NGDLTITASVTNANGNTGSGTRDITIDANLPGLRVDTVAGDDIVNSIEHGQALVITGGS
FT                   SGLNAGAVLTVTINSVAYSATVQADGSWSVGIPAANVSAWPAGPLTVEVDGQSSANNPV
FT                   SVSHPFTVDLTAVAISINTVASDDVINAAEKGTNLTLSGSTSGIESGQTVTVTFGGKTY
FT                   TASVAANGSWSVNVPAADLATLPEGAANVQASVSSASGNSASATHAYSVDASAPTLTIN
FT                   TIASDDILNAAEAGSPLTISGTSTAETGQTVTVTLNGATYTGTVQADGSWSVSVPTSAL
FT                   GALNASNYTVSATVNDKAGNPGSASHNLAVDTTAPVLTINTVAGDDIINDAEHAQALVI
FT                   SGTSSGGEAGDVVSVVLNGKTYTTTLDASGNWSVGVPAADVTALGSGAQTITASVSDRA
FT                   GNSDDASRTVTVSLSAPVISINTIAGDDVINATEKGSDLALSGTSDQPAGTAITVTLNG
FT                   QNYSATTDASGNWSVTVPASAVSALGEATYSVTASVTNAQGNSSTASHNVQVNTALPGI
FT                   TINPVATDDIINASEAGSAQTISGQVTGAAAGSTVTVELGGKTYTATVQADLSWNVSVP
FT                   AADWQALGNGELTVNASVTNAVGNTGSGTRDITIDASLPGLRVDTVAGDDVVNIIEHAQ
FT                   AQVITGSSSGFAAGTALTVVINNQTYAATVLANGSWSVGVPATDVSNWPAGTLNITVSG
FT                   ANSAGTQTSITHPLTVDLTAVAISMNSITSDDAINAAEKGAALTLSGSTSGVEAGQTVT
FT                   VTFGGKTYTTTVAANGSWSTTVPAADLAALRDGDASAQVRVTNVNGNSATATHEYSVDS
FT                   AAPTVTINTIASDNIINASEAAAGVTVSGTSTAQTGQTLTVTLNGTNYQTTVQTDGSWS
FT                   LTLPASDLTALANNGYTLTATVSDLAGNLGSASKGVTVDTTAPVISFNTVAGDDVINNV
FT                   EHIQAQIISGTATGAVAGDRLVVTIAGQQYVTSTDASGNWSVGVPASVISGLADGTVTI
FT                   SATITDSAGNSSTQTHNVQVNTAAVSLSVSTISGDNLINAAEAGSALTLSGTGTNFATG
FT                   TVVTVLLNGKGYSATIQSNGSWSVNVPAADVAALSDGTSYTVSASAQDSAGNSATASRS
FT                   VAVDLTAPVISINTVSTDDRLNAAEQQQPLTLNGSTSAEVGQTVTVTFGGKTYTATVAA
FT                   NGTWALNVPAVDLAALGQGAQTITASVNDRAGNPGQATHALTVDTVAPTVTIATVAGDD
FT                   IINNAEQLAGQTISGTTTAEVGQTVTVTFNGQTWSATVGSGGSWSVFIPAQQFAGLSDG
FT                   SYTISATVSDQAGNPGSASRGVTLNGDVPTVTINTFAGDDVVNAAEHGSSLVISGTTTA
FT                   PVGQTLTLTLNGKTYTTTVQTGGSWSYTLGSADVTALADGNAYVINASVSNAIGNTGSS
FT                   NHTITVDLSAPAMGINIDSLQADTGLSASDFITSVSPVVVNGSLTAALASNETAQISID
FT                   GGTTWTTLTVTGTTWRYNDSRTLTDGNYLYQVRVIDAAGNVGATDSQNVVIDTTAPDPA
FT                   VKTIAISAITTDMGLITNDFVTSDTTLAVSGTLGATLSAGEFAQISLDGGVTWTTLTVV
FT                   GTSWSYADGHTLTDGTWNYTVRVVDLAGNVGQTATQNVVVDTTSPEAAKSITITGISDD
FT                   TGTSSSDFITSDTTLTVRGVLGAALGANEFAQISTDNGATWVNVTVAADSLNWSYVDGR
FT                   TLTNGTTTWQVRVVDLAGNVGATSSQSALIDTVNPAQVLTIASISTDTGSSATDFITSD
FT                   TMLTLTGSLGAGLASGEVAQISLDSGATWTTLTTNGTQWTYTDSRTLTDGSYVYQVRVL
FT                   ELAGNTGPVVSKTVVVDTINPTATPTIVSYTDDVGQRQGTLSSSQATDDTTPLLNGVLS
FT                   APLASGEVVYLYRNGLLLGAVTMVGALNWTYSDSGLVSGAYTYSARVVDLAGNITSSSD
FT                   FVLTVDTSIPTTLAQITSQTTRDTIAG"
FT   gene            604261..606678
FT                   /pseudo
FT                   /locus_tag="ECSP_0557"
FT                   /note="C-term fragment; Hemolysin"
FT   gene            606685..608847
FT                   /locus_tag="ECSP_0558"
FT   CDS_pept        606685..608847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0558"
FT                   /product="putative cytoplasmic membrane export protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70434"
FT                   /protein_id="ACT70434.1"
FT                   /translation="MKKNAQSVEAWLEAMIAVARYYRLDFSQENVRATVNWERDSKREE
FT                   LLTDMARQLGMGLRLVEFSADSLNPWRLPLIAVFDNQQIGVITRRDNHDNISVQFSGDE
FT                   GLETTLNVADIEDKIVELALLRPLSAIPDARVDDYIRPYQANWFWSLSLKDWRRYGDIM
FT                   LASLVANVLALAAMIFSMQVYDRVVPAQSYPTLWVLFAGVMMAILFEFCMRMVRTHLSD
FT                   VIGKRADLRISDRVFGHALRLKNNVRSKSTGSFISQIRELESVRELITSTTIGAVADLP
FT                   FFLLFVFILWMIGGWLVLVVLLALLLLVIPGLLVQRPLARLANEGMRESAVRNATLVEA
FT                   VQSIEDIKLLRAEQRFQNQWNHTNDVASSISMKQRFLTGLLLTWTQEVQSIVYVVVLLV
FT                   GCFMVMNGDMTTGALVGTTILASRTIAPLSQISGVLSRWQQAKVARNGLDELMKRPVDQ
FT                   PEHGKLVHKAVLHGNYQFSNAVFYYDEEEKIADVAIGKLNIQAGEKIAILGRNGAGKST
FT                   LLQMLAGMRIAQQGQVLLDNISIGQLDPADLRRDMGLLSQTGRLFFGSLRENLTMGMPE
FT                   ASDEDIERALTLSGALPFVQKQKNGLNYMIQEGGFGLSGGQRQTLLLARLLISQPNIVL
FT                   LDEPSASLDEMAEAYLIEQLKQWIGHRTLIIATHRTAMLQLVDRIIVMDQGRIVMDGAK
FT                   EAILREQGEPTARRVVLQEKNKGSAA"
FT   gene            608844..610019
FT                   /locus_tag="ECSP_0559"
FT   CDS_pept        608844..610019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0559"
FT                   /product="putative membrane spanning export protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70435"
FT                   /protein_id="ACT70435.1"
FT                   /translation="MNGQLQYNRGLTEPRLPRSALAVRVTAVMLLCFLGWAWYFQLDEV
FT                   TTGSGTVEPSGREQVVQSLEGGILYHLDVKVGDIVEQGQPLAQLNRTKTESDVQEAMSR
FT                   LYAALATSARLRAEVSNKPLVFPDELNKFPELIESETALYNTRRDGLNKATTGLTQGIS
FT                   LVNRELAMTQPLVKQGAASSVEVLRLQRQANELENKLSDVRTQYYVQAREELAKANAEV
FT                   ETQRSVIRGREDSLTRLNFTAPVRGIVQDIDVTTVGGVIAPGGKLMTIVPLDEQLLIEA
FT                   KISPRDVAFIHPGQKSLVKITAYDYSIYGGLPGEVAVISPDTVQDEVRRDVYYYRVYIR
FT                   TFSNHLENKSKQQFPIFPGMVATVDIRTGKKSVLDYLLKPFNKAQEALRER"
FT   gene            610016..610423
FT                   /gene="cueR"
FT                   /locus_tag="ECSP_0560"
FT   CDS_pept        610016..610423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="ECSP_0560"
FT                   /product="copper responsive transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70436"
FT                   /protein_id="ACT70436.1"
FT                   /translation="MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLN
FT                   ELTLLRQARQVGFNLEESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQSMRNQ
FT                   LLALANACPGDDSADCPIIENLSGCCHHRAG"
FT   gene            complement(610627..611049)
FT                   /locus_tag="ECSP_0561"
FT   CDS_pept        complement(610627..611049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0561"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70437"
FT                   /protein_id="ACT70437.1"
FT                   /translation="MMNSSIKSFSLLAVILLAGCSSPTSRIADCQAQGVSHDTCYLAEQ
FT                   QRQAAILSASEAQAFKNAEAAQHAQAAKKAIYKGFGMTFRMSSKNFAYLNDSLCAIDED
FT                   NKDATVYQSGLYNVIVYHHTGKVALMKEGQFVGYLK"
FT   gene            complement(611134..612150)
FT                   /locus_tag="ECSP_0562"
FT   CDS_pept        complement(611134..612150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0562"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70438"
FT                   /protein_id="ACT70438.1"
FT                   /translation="MKTVNVALLALIISATSSPVVLAGDTIEAAATELSAINSGMSQSE
FT                   IEQKITRFLERTDNSPAAYTYLTEHHYIPSETPDTTQTPTVQTDPDAGQKTVAATGDVQ
FT                   TTARYQSMINARQSAVTDAQQTQITEQQAQIVATQKTLAATGDTQNTAHYQEMINARLA
FT                   AQNEANQRTATEQGQKMNALTTDVAVQQQNERTQYDKQMQSLAQESAQAHEQIDSLSQD
FT                   VTQTHQQLTNTQKRVADNSQQINTLNNHFSSLKNEVDDNRKEANAGTASAIAIASQPQV
FT                   KTGDVMMVSAGAGTFNGESAVSVGTSFNAGTHTVLKAGISADTQSDFGAGVGVGYSF"
FT   gene            complement(612248..612370)
FT                   /locus_tag="ECSP_0563"
FT   CDS_pept        complement(612248..612370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70439"
FT                   /protein_id="ACT70439.1"
FT                   /translation="MKEHEMISFFIYIRNHFCFLLMVFTLTTDKNALYITQMAA"
FT   gene            612517..612879
FT                   /locus_tag="ECSP_0564"
FT   CDS_pept        612517..612879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0564"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70440"
FT                   /protein_id="ACT70440.1"
FT                   /translation="MNEFEKIFNEMNLDRALLPILFRSNRSTVWKYLSGDSTAPASAMS
FT                   LIMLLQLIQKRNPDLLAEWLTLSDFTIPPEVYLDQPDYWKGWVYTQHKVNKNVLEYLKK
FT                   HYPDEDQKSMSKGREE"
FT   gene            complement(613058..613516)
FT                   /gene="ybbJ"
FT                   /locus_tag="ECSP_0565"
FT   CDS_pept        complement(613058..613516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="ECSP_0565"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70441"
FT                   /protein_id="ACT70441.1"
FT                   /translation="MMELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLV
FT                   VWLVPLGWEWQGVMFAVLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLE
FT                   SPLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLIIRAVIA"
FT   gene            complement(613513..614430)
FT                   /gene="ybbK"
FT                   /locus_tag="ECSP_0566"
FT   CDS_pept        complement(613513..614430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="ECSP_0566"
FT                   /product="predicted protease, membrane anchored"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70442"
FT                   /protein_id="ACT70442.1"
FT                   /translation="MLIFIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGL
FT                   SLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNL
FT                   ELAIINLTMTNIRTVLGSMELDEMLSQRDSINSRLLRIVDEATNPWGIKVTRIEIRDVR
FT                   PPAELISSMNAQMKAERTKRAYILEAEGIRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATKMVSEAIASGDIQAVNYFVAQKYTEALQQIGSSSNSKVVMMPLEA
FT                   SSLMGSIAGIAELVKDSANKRTQP"
FT   gene            614576..615253
FT                   /gene="ybbL"
FT                   /locus_tag="ECSP_0567"
FT   CDS_pept        614576..615253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="ECSP_0567"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70443"
FT                   /protein_id="ACT70443.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
FT   gene            615240..616019
FT                   /gene="ybbM"
FT                   /locus_tag="ECSP_0568"
FT   CDS_pept        615240..616019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="ECSP_0568"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70444"
FT                   /protein_id="ACT70444.1"
FT                   /translation="MNSHNITNESLALALMLVVVAILISHKEKLALEKDILWSVGRAII
FT                   QLIIVGYVLKYIFSVDDASLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAG
FT                   ITLAVLILSGSIEFIPMQVIPIAGMIAGNAMVAVGLCYNNLGQRVISEQQQIQEKLSLG
FT                   ATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK"
FT   gene            complement(616082..616936)
FT                   /gene="ybbN"
FT                   /locus_tag="ECSP_0569"
FT   CDS_pept        complement(616082..616936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="ECSP_0569"
FT                   /product="predicted thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70445"
FT                   /protein_id="ACT70445.1"
FT                   /translation="MSVENIVNINESNLQQVLEQSMTTPVLFYFWSERSQHCLQLTPIL
FT                   ESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRA
FT                   LLDKVLPREEELKAQQAMQLMQEGNYTDALPLLKDAWQLSNQNGEIGLLLAETLIALNR
FT                   SEDAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENPEDAALATQL
FT                   ALQLHQVGRNEEALELLFGHLRKDLTAADGQTRKTFQEILAALGTGDALASKYRRQLYA
FT                   LLY"
FT   gene            complement(616997..617806)
FT                   /gene="ybbO"
FT                   /locus_tag="ECSP_0570"
FT   CDS_pept        complement(616997..617806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbO"
FT                   /locus_tag="ECSP_0570"
FT                   /product="predicted oxidoreductase with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70446"
FT                   /protein_id="ACT70446.1"
FT                   /translation="MTHKATEILTGKVMQKSVLITGCSSGIGLESALELKRQGFHVLAG
FT                   CRKPDDVERMNSMGFTGVLIDLDSPESVDRAADEVIALTDNCLYGIFNNAGFGMYGPLS
FT                   TISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASK
FT                   YALEAWSDALRMELRRSGIKVSLIEPGPIRTRFTDNVNQTQSDKPVENPGIAARFTLGP
FT                   EAVVDKVRHAFISEKPKMRYPVTLVTWAVMVLKRLLPGRVMDKILQG"
FT   gene            complement(617796..618422)
FT                   /gene="tesA"
FT                   /locus_tag="ECSP_0571"
FT   CDS_pept        complement(617796..618422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /locus_tag="ECSP_0571"
FT                   /product="multifunctional acyl-CoA thioesterase I and
FT                   protease I and lysophospholipase L1"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70447"
FT                   /protein_id="ACT70447.1"
FT                   /translation="MMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSA
FT                   SAAWPALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRG
FT                   FQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLL
FT                   PFLMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLVNHDS"
FT   gene            618390..619076
FT                   /gene="ybbA"
FT                   /locus_tag="ECSP_0572"
FT   CDS_pept        618390..619076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="ECSP_0572"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70448"
FT                   /protein_id="ACT70448.1"
FT                   /translation="MPAENIVEVHHLKKSVGQGEHELSILTGVELVVKRGETIALVGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGQPLHNMDEEARAKLRAKHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGESSAESRNGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLIMVTHDLQLAARCDRCLRLVNG
FT                   QLQEEA"
FT   gene            619073..621487
FT                   /gene="ybbP"
FT                   /locus_tag="ECSP_0573"
FT   CDS_pept        619073..621487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="ECSP_0573"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70449"
FT                   /protein_id="ACT70449.1"
FT                   /translation="MIARWFWREWRSPSLLIVWLALSLAVACVLALGNISDRMEKGLSQ
FT                   QSREFMAGDRALRSSREVPQAWLEEAQKRGLKVGKQLTFATMTFAGDTPQLANVKAVDD
FT                   IYPMYGDLQTNPPGLKPQAGSVLLAPRLMALLNLKTGDTIDVGDATLRIAGEVIQEPDS
FT                   GFNPFQMAPRLMMNLADVDKTGAVQPGSRVTWRYKFGGSENQLDSYEKWLLPQLKPEQR
FT                   WYGLEQDEGALGRSMERSQQFLLLSALLTLLLAVAAVAVAMNHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIVGQWLMVLTLSAVTGGAIGLLFENVLMVLLKPVLPAALPPASLWPWLWA
FT                   LGTMTVISLLVGLRPYRLLLATQPLRVLRNYVVANVWPLKFYLPIVSVVVVLLLAGLMG
FT                   GSMLLWAVLAGAVVLALLCGVLGWMLLNVLRRMTLKSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIATEQVTPLKAFLAEHQIVPE
FT                   SFYPVVRARLTAINGKPTEGNEDEALNRELNLTWQNTRPDHNPIVAGNWPPKADEVSME
FT                   EGLAKRLNVTLGDTVTFMGDTQEFRAKVTSLRKVDWESLRPNFYFIFPEGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNRQFPTISLLDIGAILKQVGQVLEQVSRALEVMVVLVTACGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGFVSGLVAAIGAETALAV
FT                   LQAKVFDFPWEPDWRLWIVLPCSGALLLSLFGGWLGARLVKGKALFRQFAG"
FT   gene            621917..626113
FT                   /locus_tag="ECSP_0574"
FT   CDS_pept        621917..626113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0574"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70450"
FT                   /protein_id="ACT70450.1"
FT                   /translation="MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTS
FT                   GNPVNPLLGAKVLPGETDLALPGPLPFILSRTYSSYRTRTPAPVGIFGPGWKAPSDIRL
FT                   QLRDDALVLNDNGGRSIHFEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWGALP
FT                   PDIRLSPHLYLATNSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGMADRFGRTLTY
FT                   RREAAGDLAGEITGVTDGAGREFRLVLTTQAQRAEEARKQHTASLSSPDTPRPLSDSAF
FT                   PDTLPGTEYGPDRGIRLSAVWLTHDPAYPESLPAAPLVRYTYTEAGELLAVYDRSNTQV
FT                   RAFTYDAQHPGRMVGHRYAGRPEMRYRYDDAGRVVEQLNPAGLSYHYQYEQDRITVTDS
FT                   LNRREVLHTEGGAGLKRVVKKELADGSVTHSGYDAAGRLTAQTDAAGRRTEYGLNVVSG
FT                   DVTDITTPDGRETKFYYNDGNQLTAVVSPDGLESRRAYDEPGRLVSETSRSGETVRYRY
FT                   DDAYSELPATTTDATGSTRQMTWSRYGQLLAFTDCSGYQTRYEYDRFGQMTAVHREEGI
FT                   SLYRRYDNRGRLISVKDAQGHETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQ
FT                   GGLTRSMEYDLAGRITTLTNENGSRSEFTYDALDRLVQQRGFDGRTQRYHYDLTGKLTQ
FT                   SEDEGLVTLWHYDESDRLTHRTVNGEPAEQWQYDEHGWLTEISHLSEGHQVAVHYGYDD
FT                   KGRLAGERQTVHNPETGELLWQHETEHAYNEQGLANRVTPDSLPRVEWLTYGSGYLAGM
FT                   KLGGTPLVEFTRDRLHRETVRSFGNNAYELTSTYTPAGHLQSQRLNSQVYDRDYDWNDN
FT                   GDLVRISGPRQTREYGYSATGRLESVRTLASDLDIRIPYATDPAGNRLPDPELHPDSTL
FT                   TAWPDNRIAEDAHYVYRHDEYGRLTEKTDRIPAGVIRTDDERTHHYHYDSQHRLVFYTR
FT                   IQHGEPLVESRYLYDPLGRRTGKRVWRRGRDLTGWMSLSRKPEVTWYGWDGDRLTTVQT
FT                   DTTRIQTVYEPGSFAPLIRIETDNGEREKAQRRSLAEKLQQEGSEDGHGVVFPAELVRL
FT                   LDRLEEEIRADRVSSESRAWLAQCGLTVEQLARQVEPEYTPARKVHLYHCDHRGLPLAL
FT                   ISEDGNTAWSGEYDEWGNQLNEENPHHLHQPYRLPGQQYDKESGLYYNRNRYYDPLQGR
FT                   YITQDPIGLEGGWSLYAYPLNPVNGIDPLGLSPADVALIRRKDQLNHQRAWDILSDTYE
FT                   DMKRLNLGGTDQFFHCMAFCRVSKLNDAGVSRSAKGLGYEKEIRDYGLNLFGMYGRKVK
FT                   LSHSEMIEDNKKDLAVNDHGLTCPSTTDCSDRCSDYINPEHKETIKALQDAGYLK"
FT   gene            626094..626354
FT                   /gene="ybbD"
FT                   /locus_tag="ECSP_0575"
FT   CDS_pept        626094..626354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbD"
FT                   /locus_tag="ECSP_0575"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70451"
FT                   /protein_id="ACT70451.1"
FT                   /translation="MLAISSNLSKMIIFIIAIIIIVVLCVITYLYLYKDESLVSKHYIN
FT                   YMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDYFFLIFP"
FT   gene            complement(626537..626689)
FT                   /locus_tag="ECSP_0576"
FT   CDS_pept        complement(626537..626689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0576"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70452"
FT                   /protein_id="ACT70452.1"
FT                   /translation="MALHNSRHVFSQSGILLFLTTKLTTSIWDRLLIQAITLHKHQAIQ
FT                   LQYLL"
FT   gene            complement(627098..627505)
FT                   /gene="ylbG"
FT                   /locus_tag="ECSP_0577"
FT   CDS_pept        complement(627098..627505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbG"
FT                   /locus_tag="ECSP_0577"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70453"
FT                   /protein_id="ACT70453.1"
FT                   /translation="MSNPYPKQEVTLMLHTANPVIKHKAGLLNLAEELSNVSKACKIMG
FT                   VSRDTFYRYRELVAEGGVDAQINRSRRAPNLKNRTDEATEQAVVDYAVAFPTHGQHRAS
FT                   NELRKQGVFISDSGVRSVWLLHNLENLKRRY"
FT   gene            complement(627585..628679)
FT                   /gene="ybbB"
FT                   /locus_tag="ECSP_0578"
FT   CDS_pept        complement(627585..628679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="ECSP_0578"
FT                   /product="tRNA 2-selenouridine synthase,
FT                   selenophosphate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70454"
FT                   /protein_id="ACT70454.1"
FT                   /translation="MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNN
FT                   DERAAVGTCYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPQGILCCARGGQRS
FT                   HIVQSWLHAAGIDYPLVEGGYKALRQTAIQATIELAQKPIVLIGGCTGSGKTLLVQQQP
FT                   NGVDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDARQNLRLWVLEDESRMIG
FT                   SNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYGDEQGWQEYCEY
FT                   LHHGLSAIKRRLGLQRYNELAARLDAALTTQLTTGSTDGHLAWLVPLLEEYYDPMYRYQ
FT                   LEKKAEKVVFRGEWAEVAEWVKAQ"
FT   gene            complement(628748..629674)
FT                   /gene="ybbS"
FT                   /locus_tag="ECSP_0579"
FT   CDS_pept        complement(628748..629674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbS"
FT                   /locus_tag="ECSP_0579"
FT                   /product="DNA-binding transcriptional activator of the allD
FT                   operon"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70455"
FT                   /protein_id="ACT70455.1"
FT                   /translation="MFDPETLRTFIAVAETGSFSKAAERLCKTTATISYRIKLLEENTG
FT                   VALFFRTTRSVTLTAAGEHLLSQARDWLSWLESMPSELQQVNDGVERQVNIVINNLLYN
FT                   PQAVAQLLAWLNERYPFTQFHISRQIYMGVWDSLLYEGFSLAIGVTGTEALANTFSLDP
FT                   LGSVQWRFVMAADHPLANVEEPLTEAQLRRFPAVNIEDSARTLTKRVAWRLPGQKEIIV
FT                   PDMETKIAAHLAGVGIGFLPKSLCQSMIDNQQLVSRVIPTMRPPSPLSLAWRKFGSGKA
FT                   VEDIVTLFTQRRPEISGFLEIFGNPRS"
FT   gene            629904..630386
FT                   /gene="allA"
FT                   /locus_tag="ECSP_0580"
FT   CDS_pept        629904..630386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="ECSP_0580"
FT                   /product="ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70456"
FT                   /protein_id="ACT70456.1"
FT                   /translation="MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVE
FT                   ILEQDRTLISINRAQPANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLST
FT                   LRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA"
FT   gene            630464..631279
FT                   /gene="allR"
FT                   /locus_tag="ECSP_0581"
FT   CDS_pept        630464..631279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allR"
FT                   /locus_tag="ECSP_0581"
FT                   /product="DNA-binding transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70457"
FT                   /protein_id="ACT70457.1"
FT                   /translation="MTEVRRRGRPGQAEPVAQKGAQALERGIAILQYLEKSGGSSSVSD
FT                   ISLNLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGLGVFNVGAAYIHNRDVLSVAGP
FT                   FMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHASGAGKALLYP
FT                   LAEEELMSIILQTGLQQFTPTTLVDMPTLLKDLEQARELGYTVDKEEHVVGLNCIASAI
FT                   YDDVGSVVAAISISGPSSRLTEDRFVSQGELVRDTARDISTALGLKAHP"
FT   gene            631369..633150
FT                   /gene="gcl"
FT                   /locus_tag="ECSP_0582"
FT   CDS_pept        631369..633150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcl"
FT                   /locus_tag="ECSP_0582"
FT                   /product="glyoxylate carboligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70458"
FT                   /protein_id="ACT70458.1"
FT                   /translation="MAKMRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRKHGGIRH
FT                   ILARHVEGASHMAEGYTRATAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITGQA
FT                   PRARLHKEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAFHLMRSGRPGPVLVDLP
FT                   FDVQVAEIEFDPDMYEPLPVYKPAASRMQIEKAVEMLIQAERPVIVAGGGVINADAAAL
FT                   LQQFAELTSVPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLLASDMVFGIGNRF
FT                   ANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVSDAKAALTLLVEVAQEMQKAG
FT                   RLPCRKEWVADCQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAFGRDVCYVTTIGLSQIA
FT                   AAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPKRNVVAISGDFDFQFLIEELAV
FT                   GAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSSEVNGYGVDHVKVAEG
FT                   LGCKAIRVFKPEDIAPAFEQAKALMAQYRVPVVVEVILERVTNISMGSELDNVMEFEDI
FT                   ADNAADAPTETCFMHYE"
FT   gene            633163..633939
FT                   /gene="hyi"
FT                   /locus_tag="ECSP_0583"
FT   CDS_pept        633163..633939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyi"
FT                   /locus_tag="ECSP_0583"
FT                   /product="hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70459"
FT                   /protein_id="ACT70459.1"
FT                   /translation="MLRFSANLSMLFGEYDFLARFEKAAQCGFRGVEFMFPYDYDIEEL
FT                   KQVLASNKLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKNINC
FT                   LVGKTPAGFSSEQIHATLVENLRYAANMLMKEDILLLIEPINHFDIPGFHLTGTRQALK
FT                   LIDDVGCCNLKIQYDIYHMQRMEGELTNTMTQWADKIGHLQIADNPHRGEPGTGEINYD
FT                   YLFKVIENSDYNGWVGCEYKPQTTTEAGLRWMDPYR"
FT   gene            634040..634918
FT                   /gene="glxR"
FT                   /locus_tag="ECSP_0584"
FT   CDS_pept        634040..634918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxR"
FT                   /locus_tag="ECSP_0584"
FT                   /product="tartronate semialdehyde reductase,
FT                   NADH-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70460"
FT                   /protein_id="ACT70460.1"
FT                   /translation="MKLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSLGAVN
FT                   VDTARQVTEAADIIFIMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFA
FT                   RQVNELGGDYLDAPVSGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNG
FT                   DGQTCKVANQIIVALNIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMI
FT                   KRTFNPGFKIALHQKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQ
FT                   ALELMANHKLA"
FT   gene            635087..636478
FT                   /gene="ybbW"
FT                   /locus_tag="ECSP_0585"
FT   CDS_pept        635087..636478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbW"
FT                   /locus_tag="ECSP_0585"
FT                   /product="predicted allantoin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70461"
FT                   /protein_id="ACT70461.1"
FT                   /translation="MEHQRKLFQQRGYSEDLLPKTQSQRTWKTFNYFTLWMGSVHNVPN
FT                   YVMVGGFFILGLSTFSIMLAIILSAFFIAAVMVLNGAAGSKYGVPFAMILRASYGVRGA
FT                   LFPGLLRGGIAAIMWFGLQCYAGSLACLILIGKIWPGFLTLGGDFTLLGLSLPGLITFL
FT                   LFWLVNVGIGFGGGKVLNKFTAILNPCIYIVFGGMAIWAISLVGLGPIFDYIPSGIQKA
FT                   ENSGFLFLVVINAVVAVWAAPAVSASDFTQNAHSFREQALGQTLGLVVAYILFAVAGVC
FT                   IIAGASIHYGADTWNVLDIVQRWDSLFASFFAVLVILMTTISTNATGNIIPAGYQIAAI
FT                   APTKLTYKNGVLIASIISLLICPWKLMENQDSIYLFLDIIGGMLGPVIGVMMAHYFVVM
FT                   RGQINLDELYTAPGDYKYYDNGFNLTAFSVTLVAVILSLGGKFIPLMEPLSRVSWFVGV
FT                   IVAFA"
FT   gene            636515..637873
FT                   /pseudo
FT                   /locus_tag="ECSP_0586"
FT                   /note="gene disrupted by in-frame stop codon; allantoinase"
FT   gene            637933..639234
FT                   /gene="ybbY"
FT                   /locus_tag="ECSP_0587"
FT   CDS_pept        637933..639234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbY"
FT                   /locus_tag="ECSP_0587"
FT                   /product="predicted uracil/xanthine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70462"
FT                   /protein_id="ACT70462.1"
FT                   /translation="MFNFAVSRESLLSGFQWFFFIFCNTVVVPPTLLSAFQLPQSSLLT
FT                   LTQYAFLATALACFAQAFCGHRRAIMEGPGGLWWGTILTITLGEASRGTPINDIATSLA
FT                   VGIALSGVLTMLIGFSGLGHRLARLFTPSVMVLFMLMLGAQLTTIFFKGMLGLPFGIAD
FT                   PNFKIQLPPFALSVAVMCLVLAMIIFLPQRFARYGLLVGTITGWLLWYFCFPSSHSLSG
FT                   ELHWQWFPLGSGGALSPGIILTEVITGLVNISNTYGAIRGTDVFYPQQGAGNTRYRRSF
FT                   VATGFMTLITVPLAVIPFSPFVSSIGLLTQTGDYTRRSFIYGSVICLLVALVPALTRLF
FT                   CSIPLPVSSAVMLVSYLPLLFSALVFSQQITFTARNIYRLALPLFVGIFLMALPPVYLQ
FT                   DLPLTLRPLLSNGLLVGILLAVLMDNLIPWERIE"
FT   gene            639256..640401
FT                   /gene="glxK"
FT                   /locus_tag="ECSP_0588"
FT   CDS_pept        639256..640401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="ECSP_0588"
FT                   /product="glycerate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70463"
FT                   /protein_id="ACT70463.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGEKVNAFYGITGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQVLVA
FT                   NGGNLARVASIEMEECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLRAVNLEQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
FT   gene            complement(640629..641414)
FT                   /gene="ylbA"
FT                   /locus_tag="ECSP_0589"
FT   CDS_pept        complement(640629..641414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="ECSP_0589"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70464"
FT                   /protein_id="ACT70464.1"
FT                   /translation="MGYLNNVTGYRDDLLANRAIVKHGNFALLTPDGLVKNIIPGFENC
FT                   DATILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFSLS
FT                   EGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYVPVEGYAPWLVSGNASELERIHYEGMD
FT                   DVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI"
FT   gene            complement(641425..642660)
FT                   /gene="allC"
FT                   /locus_tag="ECSP_0590"
FT   CDS_pept        complement(641425..642660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allC"
FT                   /locus_tag="ECSP_0590"
FT                   /product="allantoate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70465"
FT                   /protein_id="ACT70465.1"
FT                   /translation="MITHFRQTIEEALPWLSSFGADPAGGMTRLLYSPEWLETQQQLKK
FT                   RMAASGLETRFDEVGNLYGRLSGTEYPQEVILSGSHIDTVVNGGNLDGQFGALAARLAI
FT                   DWLKTQYGAPLRTVEVVAMAEEEGSRFPYVFWGSKNIFGLANPDDVRNICDAKGNSFVD
FT                   AMKACGFTLPDAPLTPRQDIKAFVELHIEQGCVLESNGQSIGVVNAIVGQRRYTVTLNG
FT                   ESNHAGTTPMGYRRDTVYAFSRICHQSIEKAKKMGDPLVLTFGKVEPRPNTVNVVPGKT
FT                   TFTIDCRHTDAAVLRDFTQQLENDMRAICDEMDIRIDIDLWMDEEPVPMNKDLVATLTE
FT                   LCESEKLNYRVMHSGAGHDAQIFAPRVPTCMIFIPSINGISHNPAERTNITDLAEGVKT
FT                   LALMLYQLAWQK"
FT   gene            complement(642682..643731)
FT                   /gene="allD"
FT                   /locus_tag="ECSP_0591"
FT   CDS_pept        complement(642682..643731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allD"
FT                   /locus_tag="ECSP_0591"
FT                   /product="ureidoglycolate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70466"
FT                   /protein_id="ACT70466.1"
FT                   /translation="MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHG
FT                   AVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQN
FT                   GVAVVGISRMGHSGAISYFVQQAARAGLIGISMCQSDPMVVPFGGAEIYYGTNPLAFAA
FT                   PGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGAPTTDPFAVHALLPAAG
FT                   PKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHVVINPNFFSSSELFRQ
FT                   HLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRQAAVEGIEIVDDIYQYLISDALYNTS
FT                   YETKNPFAQ"
FT   gene            644048..645715
FT                   /gene="fdrA"
FT                   /locus_tag="ECSP_0592"
FT   CDS_pept        644048..645715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdrA"
FT                   /locus_tag="ECSP_0592"
FT                   /product="predicted acyl-CoA synthetase with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70467"
FT                   /protein_id="ACT70467.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKAL
FT                   LDTTGFWHDDFNNATPNDICVAIRSEAADAGIAQAIMQQLEEALKQLAQGSGSSQALTQ
FT                   VRRWDSACQKLPDANLALISVAGEYAAELANQALDRNLNVMMFSDNVTLEDEIQLKTRA
FT                   REKGLLVMGPDCGTSMIAGTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSREVGGISALTALEMLSADEKSEVLAFVSKPPAEAVRLKIVNAMKATGKP
FT                   TVALFLGYTPAVARDENVWFASSLDEAARLACLLSRVTARRNAIMPASSGFICGLYTGG
FT                   TLAAEAAGLLAGHLGVEADDAHHHGMMLDADGHQIIDLGDDFYTVGRPHPMIDPTLRNQ
FT                   LITDLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARSDNQPLYAIATVTGTE
FT                   RDPQCRSQQIATLEDAGIAVVSSLPEATLLAAALIHPLSPAAQQHTPSLLENVAVINIG
FT                   LRSFALELQSASKPVVHYQWSPVAGGNKKLARLLERLQ"
FT   gene            645725..646984
FT                   /gene="ylbE"
FT                   /locus_tag="ECSP_0593"
FT   CDS_pept        645725..646984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbE"
FT                   /locus_tag="ECSP_0593"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70468"
FT                   /protein_id="ACT70468.1"
FT                   /translation="MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNEGKTLLHA
FT                   GPPMRWQEMTGPMKGACVGACLFEGWAKDEAQALAILEQGEVNFIPCHHVNAVGPMGGI
FT                   TSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAAL
FT                   GRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRALAPQIARLDHDKQHIAEVMDFL
FT                   SVTDQFFLNLAMAYCKAAMDAGAMIRAGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNT
FT                   PQGLFFTGFSQEQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGASGMEAARAVSEEM
FT                   AEIYLERNMQLQIPSWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVR
FT                   APLACFEQALEALAESMGIG"
FT   gene            646995..647810
FT                   /gene="ylbF"
FT                   /locus_tag="ECSP_0594"
FT   CDS_pept        646995..647810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="ECSP_0594"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70469"
FT                   /protein_id="ACT70469.1"
FT                   /translation="MTIIHPLLASSSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPAH
FT                   PQPLAAAWMQRAEETGLFGPLALAASDPLPAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
FT   gene            647807..648700
FT                   /gene="ybcF"
FT                   /locus_tag="ECSP_0595"
FT   CDS_pept        647807..648700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="ECSP_0595"
FT                   /product="predicted carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70470"
FT                   /protein_id="ACT70470.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   RTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTDDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGMPQQRAIRHATPDELAPFAKADGSMGPKVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
FT   gene            complement(648839..649906)
FT                   /gene="purK"
FT                   /locus_tag="ECSP_0596"
FT   CDS_pept        complement(648839..649906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="ECSP_0596"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70471"
FT                   /protein_id="ACT70471.1"
FT                   /translation="MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSV
FT                   ITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERS
FT                   EWPAVFERLGELAIVKRRTGGYDGRGQWRLRADETEQLPAECYGECIVEQGINFSGEVS
FT                   LVGARCFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQAQAEEMLSAIMQELGYVGV
FT                   MAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSV
FT                   MINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLSATLEALIPLLP
FT                   PEYASGVMWAQSKFC"
FT   gene            complement(649903..650412)
FT                   /gene="purE"
FT                   /locus_tag="ECSP_0597"
FT   CDS_pept        complement(649903..650412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="ECSP_0597"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide mutase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70472"
FT                   /protein_id="ACT70472.1"
FT                   /translation="MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAH
FT                   RTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSL
FT                   YSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENP
FT                   DPRGAA"
FT   gene            complement(650530..651252)
FT                   /gene="lpxH"
FT                   /locus_tag="ECSP_0598"
FT   CDS_pept        complement(650530..651252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="ECSP_0598"
FT                   /product="UDP-2,3-diacylglucosamine pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70473"
FT                   /protein_id="ACT70473.1"
FT                   /translation="MATLFIADLHLCVEEPAITAGFLRFLAGEARKADALYILGDLFEA
FT                   WIGDDDPNPLHRQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLE
FT                   LYGRRVLIMHGDTLCTDDAGYQAFRTKVHKPWLQTLFLALPLFVRKRIAVRMRANSKEA
FT                   NSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQPAFRVVLGAWHTE
FT                   GSMVKVTADDVELIHFPF"
FT   gene            complement(651255..651749)
FT                   /gene="ppiB"
FT                   /locus_tag="ECSP_0599"
FT   CDS_pept        complement(651255..651749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="ECSP_0599"
FT                   /product="peptidyl-prolyl cis-trans isomerase B (rotamase
FT                   B)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70474"
FT                   /protein_id="ACT70474.1"
FT                   /translation="MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVI
FT                   NGFMIQGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVD
FT                   NDFLNFSGESLQGWGYCVFAEVVEGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTVS
FT                   E"
FT   gene            651923..653308
FT                   /gene="cysS"
FT                   /locus_tag="ECSP_0600"
FT   CDS_pept        651923..653308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="ECSP_0600"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70475"
FT                   /protein_id="ACT70475.1"
FT                   /translation="MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFV
FT                   AFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHKDFDALN
FT                   ILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQL
FT                   QAGARVDVVDDKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFD
FT                   IHGGGSDLMFPHHENEIAQSTCAHDGQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVL
FT                   KYYDAETVRYFLMSGHYRSQLNYSEENLKQARAALERLYTALRGTDKTVAPAGGEAFEA
FT                   RFIEAMDDDFNTPEAYSVLFDMAREVNRLKVEDMAAANAMASHLRKLSAVLGLLEQEPE
FT                   AFLQSGAQADDSEVAEIEALIQQRLDARKAKDWAAADAARDRLNEMGIVLEDGPQGTTW
FT                   RRK"
FT   gene            complement(653344..653865)
FT                   /gene="ybcI"
FT                   /locus_tag="ECSP_0601"
FT   CDS_pept        complement(653344..653865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="ECSP_0601"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70476"
FT                   /protein_id="ACT70476.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSF
FT                   NFGVAYGNVFGHRGFTHSLVFAFVVPLLCVLIGRRWFRAGLIRCWLFLTVSLLSHSLLD
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTAYGHQVIISELMWVWLPGML
FT                   LMGMLWWRRR"
FT   gene            complement(653973..654185)
FT                   /gene="ybcJ"
FT                   /locus_tag="ECSP_0602"
FT   CDS_pept        complement(653973..654185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="ECSP_0602"
FT                   /product="predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70477"
FT                   /protein_id="ACT70477.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAV
FT                   ETRKRCKIVAGQTVSFAGHSVQVVA"
FT   gene            complement(654187..655053)
FT                   /gene="folD"
FT                   /locus_tag="ECSP_0603"
FT   CDS_pept        complement(654187..655053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="ECSP_0603"
FT                   /product="bifunctional 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70478"
FT                   /protein_id="ACT70478.1"
FT                   /translation="MAAKIIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNP
FT                   ASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDALNADNTIDGILVQLPLPAG
FT                   IDNVKVLERIHPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAV
FT                   VIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIK
FT                   EGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVE
FT                   YHDPQGE"
FT   gene            655533..656075
FT                   /gene="sfmA"
FT                   /locus_tag="ECSP_0604"
FT   CDS_pept        655533..656075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmA"
FT                   /locus_tag="ECSP_0604"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70479"
FT                   /protein_id="ACT70479.1"
FT                   /translation="MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNT
FT                   DSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNL
FT                   LAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTS
FT                   ASAGQANADATFIMRYE"
FT   gene            656295..656987
FT                   /gene="sfmC"
FT                   /locus_tag="ECSP_0605"
FT   CDS_pept        656295..656987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmC"
FT                   /locus_tag="ECSP_0605"
FT                   /product="pilin chaperone, periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70480"
FT                   /protein_id="ACT70480.1"
FT                   /translation="MMTKIKLLMLIIFYLIISASVHAAGGIALGATRIIYPADAKQTAV
FT                   WIRNSHTNERFLVNSWIENSSGVKEKSFIITPPLFVSEPKSENTLRIIYTGPPLAADRE
FT                   SLFWMNVKTIPSVDKNALNGRNVLQLAILSRMKLFLRPIQLQELPAEAPDTLKFSRSGN
FT                   YINVHNPSPFYVTLVNLQVGSQKLGNAMAAPRVNSQIPLPSGVQGKLKFQTVNDYGSVT
FT                   PVREVNLN"
FT   gene            657018..659627
FT                   /gene="sfmD"
FT                   /locus_tag="ECSP_0606"
FT   CDS_pept        657018..659627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmD"
FT                   /locus_tag="ECSP_0606"
FT                   /product="predicted outer membrane export usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70481"
FT                   /protein_id="ACT70481.1"
FT                   /translation="MKIPTTTDIPQRYTWCLAGICYSSLAILPSFLSYAESYFNPAFLL
FT                   ENGTFVADLSRFERGNHQPAGVYRVDLWRNDEFIGSQDIVFESTTENTGDKSGGLMPCF
FT                   NQVLLERIGLNSSAFPELAQQQNNKCINLLKAVPDATINFDFAAMRLNITIPQIALLSS
FT                   AHGYIPPEEWDEGIPALLLNYNFTGNRGNGNDSYFFSELSGINIGPWRLRNNGSWNYFR
FT                   GNGYHSEQWNNIGTWVQRAIIPLKSELVMGDGNTGSDIFDGVGFRGVRLYSSDNMYPDS
FT                   QQGFAPTVRGIARTAAQLTIRQNGFIIYQSYVSPGAFEITDLHPTSSNGDLDVTIDERD
FT                   GNQQNYTIPYSTVPILQREGRFKFDLTAGDFRSGNSQQSSPFFFQGTALGGLPQEFTAY
FT                   GGTQLSANYTAFLLGLGRNLGNWGAVSLDVTHARSQLADDSRHEGDSIRFLYAKSMNTF
FT                   GTNFQLMGYRYSTQGFYTLDDVAYRRMEGYEYDYDYDGEHRDEPIIVNYHNLRFSRKDR
FT                   LQLNISQSLNDFGSLYISGTHQKYWNTSDSDTWYQVGYTSSWVGISYSLSFSWNESVGI
FT                   PDNERIVGLNVSVPFNVLTKRRYTRENALDRAYASFNANRNSNGQNSWLAGVGGTLLEG
FT                   HNLSYHVSQGDTSNNGYTGSATANWQAAYGTLGVGYNYDRDQHDVNWQLSGGVVGHENG
FT                   ITLSQPLGDTNVLIKAPGAGGVRIENQTGILTDWRGYAVMPYATVYRYNRIALDTNTMG
FT                   NSIDVEKNISSVVPTQGALVRANFDTRIGVRALITVTQGGKPVPFGSLVRENSTGITSM
FT                   VGDDGQVYLSGAPLSGELLVQWGDGANSRCIAHYVLPKQSLQQAVTVISAVCTHPGS"
FT   gene            659640..660647
FT                   /gene="sfmH"
FT                   /locus_tag="ECSP_0607"
FT   CDS_pept        659640..660647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmH"
FT                   /locus_tag="ECSP_0607"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70482"
FT                   /protein_id="ACT70482.1"
FT                   /translation="MKIICRLLLAMACLCLANISWATVCANSTGVAEDEHYDLSNVFNS
FT                   TNNQPGQIVVLPEKSGWVGVSAICPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLNDYL
FT                   LGAMSLVDSVMDIQFPPQNYIRMGTDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIP
FT                   RQVMFTVYVTSTPYDPLVTPVYTISFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAA
FT                   GPGNRPAGVMPQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQND
FT                   TPITPNDLNSVIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ"
FT   gene            660658..661173
FT                   /gene="sfmF"
FT                   /locus_tag="ECSP_0608"
FT   CDS_pept        660658..661173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="ECSP_0608"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70483"
FT                   /protein_id="ACT70483.1"
FT                   /translation="MRRVFFSCFCGLLWSSSGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALLPFSLRLEGCPPGSVAILFTGTPASDANLLALDD
FT                   PAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
FT   gene            complement(661176..661808)
FT                   /gene="fimZ"
FT                   /locus_tag="ECSP_0609"
FT   CDS_pept        complement(661176..661808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimZ"
FT                   /locus_tag="ECSP_0609"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70484"
FT                   /protein_id="ACT70484.1"
FT                   /translation="MKPTSVIIMDTHPIIRMSIEVLLQKNSELQIVLKTDDYRITIDYL
FT                   RTRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFLSSKSECFYAGRAIQAGANGFV
FT                   SKCNDQNDIFHAVQMILSGYTFFPSETLNYIKSNKCSTNSSTVTVLSNREVTILRYLVS
FT                   GLSNKEIADKLLLSNKTVSAHKSNIYGKLGLHSIVELIDYAKLYELI"
FT   gene            662051..662127
FT                   /locus_tag="ECSP_0610"
FT   tRNA            662051..662127
FT                   /locus_tag="ECSP_0610"
FT                   /product="tRNA-Arg"
FT                   /note="anticodon: TCT"
FT   gene            complement(662173..662934)
FT                   /gene="envY"
FT                   /locus_tag="ECSP_0611"
FT   CDS_pept        complement(662173..662934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envY"
FT                   /locus_tag="ECSP_0611"
FT                   /product="DNA-binding transcriptional activator of porin
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70485"
FT                   /protein_id="ACT70485.1"
FT                   /translation="MQLSSSEPCVVILTEKEVEVSVNNHATFTLPKNYLAAFACNNNVI
FT                   ELSTLNHVLITHINRNIINDYLLFLNKNLTCVKPWSRLATPVIACHSRTPEVFRLAANH
FT                   SKQQPSKPCEAELTRALLFTVLSNFLEQSRFIALLMYILRSSVRDSVCRIIQSDIQHYW
FT                   NLRIVASSLCLSPSLLKKKLKNENTSYSQIVTECRMRYAVQMLLMDNKNITQVAQLCGY
FT                   SSTSYFISVFKAFYGLTPLNYLAKQRQKVMW"
FT   gene            complement(663117..664007)
FT                   /gene="ybcH"
FT                   /locus_tag="ECSP_0612"
FT   CDS_pept        complement(663117..664007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="ECSP_0612"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70486"
FT                   /protein_id="ACT70486.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRLQGFDTLVLQWTRYGDAFTQPEQRALLFKRAAAAQQAGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAVPGVTPDGWYFSAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEHVKATGVNVWVQDGSGVDKLTAEQ
FT                   RERYLQASADCQSSAPASGIVYELFVAGKGKTFTAKPKPDAEIASLLAKRSSCGKDTLY
FT                   FSLRYLPVAHGILEY"
FT   gene            complement(664008..666980)
FT                   /gene="nfrA"
FT                   /locus_tag="ECSP_0613"
FT   CDS_pept        complement(664008..666980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrA"
FT                   /locus_tag="ECSP_0613"
FT                   /product="bacteriophage N4 receptor, outer membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70487"
FT                   /protein_id="ACT70487.1"
FT                   /translation="MKENNLNRVIGWSGLLLTSLLSTSALADNIGTSAEELGLSDYRHF
FT                   VIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEAYRHFGHDDRARLLL
FT                   EDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTLRCRSEVGQNALRL
FT                   AQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNEARQQNTLSAAER
FT                   RQWFDVLLAGQLDDRILALQSQGIFTDPQSYITYATALAYRGEKARLQHYLIENKPLFT
FT                   TDAQEKSWLYLLSKYSANPVQALANYTVQFADNRQYVVGATLPVLLKEGQYDAAQKLLA
FT                   TLPANEMLEERYAVSVATRNKAEALRLARLLYQQESANLTRLDQLTWQLMQNEQSREAA
FT                   DLLLQRYPFQGDARISQTLMARLASLLESHPYLATPAKVAILSKPLPLAEQRQWQSQLP
FT                   GIADNCPAIVRLLGDMSPSYDAAAWNRLAKCYRDTLPGVALYAWLQAEQRQPNAWQHRA
FT                   VAYQAYQVEDYATALAARQKISLHDMSNEDLLAAANTAQAAGNGAARDRWLQQAEQRGL
FT                   GSNALYWWLHAQRYIPGQPELALNDLTRSINIAPSANAYVARATIYRQRHNVPAAVSDL
FT                   RAALELEPNNSNTQAALGYALWDSGDIAQSREMLEQAHKGLPDDPALIRQLAYVNQRLD
FT                   DMPATQHYARLVIDDIDNQALITPLTPEQNQQRFNFRRLHEEVGRRWTFSFDSSIGLRS
FT                   GAMSTANNNVGGAAPGKSYRSYGQLEAEYRIGRNMLLEGDLLSVYSRFFADTGENGVMM
FT                   PVKNPMSGTGLRWKPLRDQIFFLAVEQQLPLNGQNGASDTMLRASASFFNGGKYSDEWH
FT                   PNGSGWFAQNLYLDAAQYIRQDIQAWTADYRVSWHQKVANGQTIEPYAHVQDNGYRDKG
FT                   TQGAQLGGVGVRWNIWTGETHYDAWPHKVSLGVEYQHTFKAINQRNGERNNAFLTIGVH
FT                   W"
FT   gene            complement(666967..669204)
FT                   /gene="nfrB"
FT                   /locus_tag="ECSP_0614"
FT   CDS_pept        complement(666967..669204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrB"
FT                   /locus_tag="ECSP_0614"
FT                   /product="bacteriophage N4 receptor, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70488"
FT                   /protein_id="ACT70488.1"
FT                   /translation="MDWLLDVFATWLYGLKVIAITLAVIMFISGLDDFFIDVVYWVRRI
FT                   KRKLSVYRRYPRMSYRELYKPDEKPLAIMVPAWNETGVIGNMAELAATTLDYENYHIFV
FT                   GTYPNDPDTQRDVDEVCARFPNVHKVVCARPGPTSKADCLNNVLDAITQFERSANFAFA
FT                   GFILHDAEDVISPMELRLFNYLVERKDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKD
FT                   VPVREALAGQVPSAGVGTCFSRRAVTALLADGDGIAFDVQSLTEDYDIGFRLKEKGMTE
FT                   IFVRFPVVDEAKEREQRKFLQHARTSNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFK
FT                   THKWTSSLTLNYFLWRDRKGAISNFVSFLAMLVMIQLLLLLAYESLWPDAWHFLSIFSG
FT                   SAWLMTLLWLNFGLMVNRIVQRVIFVTGYYGLTQGLLSVLRLFWGNLINFMANWRALKQ
FT                   VLQHGDPRRVAWDKTTHDFPSVTGDTRSLRPLGQILLENQVITEEQLDTALRNRVEGLR
FT                   LGGSMLMQGLISAEQLAQALAEQNGVAWESIDAWQIPSSLIAEMPASVALHYAVLPLRL
FT                   ENDELIVGSEDGIDPVSLAALTRKVGRKVRYVIVLRGQIVTGLRHWYARRRGHDPRAML
FT                   YNAVQHQWLTEQQAGEIWRQYVPHQFLFAEILTTLGHINRSAINVLLLRHERSSLPLGK
FT                   FLVTEGVISQETLDRVLTIQRELQVSMQSLLLKAGLNTEQVAQLESENEGE"
FT   mobile_element  complement(669460..670725)
FT                   /mobile_element_type="insertion sequence:ISEc1"
FT   gene            complement(669470..670606)
FT                   /locus_tag="ECSP_0615"
FT   CDS_pept        complement(669470..670606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0615"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70489"
FT                   /protein_id="ACT70489.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDLGETHLNFLKQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRRRAIHVISAFSTMHSLVIGQIKTDEKSNEITAIPELLNMLD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAMSEKSHGREEIRLHIVCDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKESEMTV
FT                   RYYISSADLTAEKFATAIRNHWHVENKLHWRLDVVVNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVFAGSGLS"
FT   gene            complement(670821..671042)
FT                   /locus_tag="ECSP_0616"
FT   CDS_pept        complement(670821..671042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0616"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70490"
FT                   /protein_id="ACT70490.1"
FT                   /translation="MALDLARRELELREIPYIKNSLHANYSYKSISIGSKQGWLISAKL
FT                   KVPETFEPDMIFIEISDPEGFINIPDVL"
FT   gene            complement(671069..672403)
FT                   /locus_tag="ECSP_0617"
FT   CDS_pept        complement(671069..672403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0617"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70491"
FT                   /protein_id="ACT70491.1"
FT                   /translation="MTASGTGLGYGEGDESYGYDSCGYLKAQSAGGHRISEETDQYAGG
FT                   HRLKQAGNTQYDYDAAGRMVSRTRHRDGYRPETERFRWDSRDQLTGYCSAQGEQWEYRH
FT                   DASGRRTEKRCDRKKIRFTYLWDGDSIAEIREYRDDELYSVRHLVFNGFELISQQCSRV
FT                   RQPHPSVAPQWVTRTNHAVNDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTDYP
FT                   DPRGERDAEADPGLLYAGQWQDAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRY
FT                   VPNPCGWVDPLGLAASSKISSLMDYIGDGRRVSGHTGFLDGVRLSRSQINNIAKEMEKL
FT                   GIKVIRKADKYLPPNARAAFDYGLRNIYLRKNATLYEVYHEVIHAKQFAKIGREAYEAL
FT                   GRLSREEHVLNEILKSKNLFNEAEIAHAIKYVEGLREKFMMGLIN"
FT   gene            complement(672572..672832)
FT                   /locus_tag="ECSP_0618"
FT   CDS_pept        complement(672572..672832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70492"
FT                   /protein_id="ACT70492.1"
FT                   /translation="MIFNDVDGKQKATCTIRVLILKTFHDGRYRFVIESVIYDLINNYS
FT                   GFILTGRLFWQGEGFGHELFPVTNKYNAWRWKNKKIIDISW"
FT   gene            complement(672996..677846)
FT                   /locus_tag="ECSP_0619"
FT   CDS_pept        complement(672996..677846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0619"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70493"
FT                   /protein_id="ACT70493.1"
FT                   /translation="MSEGPGGPQGATAGGTLAMRMLSQRAMAASQMKRAANDKAIAQML
FT                   ASKKSGPPAARLGDEIQHKSFLGALAGAVLGAIVTIAEGCLIMAACATGPYALVLVPAL
FT                   MYASYKASDYVEEKQNQLESWINSFCDTDGAINTGSKNVKINGKPAARAAVTLPPPPPP
FT                   GAIPEVPQGEPSWGDIATDLLESAAEKAVPLAKAWGNAVITLTDSNAGFMDRVSAGASL
FT                   LFPAGPVLMEFATMVGGRGEIKKDVDFPEAGEDTALCDKENKPPRIAQGSSNVFINNQP
FT                   AARKGDKLECSAAIVEGSPDVFIGGEQVTYLDIQPEFPPWQRMILGGITIASYLLPPAG
FT                   LLGKLGNLAKLGKLGNLLGKSGKLLGAKLGALLGKTGNSLKSIANKVIRWVTDPVDPVT
FT                   GAYCDERTDFTLGQTLPLSFTRFHSSVLPLHGLTGVGWSDSWSEYAWVREQGNRVDVIS
FT                   LGATLNFAFDGESDTAVNPYHAQYILRRRDDYLELFDRDALSSRFFYDAFPGMRLRHPV
FT                   TDDTSDDRLAHSPADRMYMLGGMSDTASNRITFERDTQYRITGVSHTDGIRLKLTYHAS
FT                   GYLKAIHRTDNGIQTLATYEQDARLDYHLFYEYDAADRIIRWSDNDQTWSRFTYDAQGR
FT                   CVTVTGAEGYYNATLDYGDGCTTVTDGKGIHRYYYDPDGNILREEAPDGSTTTYEWDEF
FT                   HHLLARHSPAGRVEKFEYNAAHGQLSRYTAADGADWQYCYDERGLLSNITAPAGQTWTQ
FT                   QCDERGLPVSLVSPQGEETRLAYTPQGLLSGIFRQDERRLGIEYDHHNWPETLTDVMGR
FT                   EHHTEYSGHDLPVKMRGPGGQSVRLQWQQHHKLSGLERAGTGAEGFRYDRHGNLLAYTD
FT                   GNGVVWTMEYGPFDLPVARTDGEGHRWQYRYDKDTLQLTEVINPQGESYLYILDNCGRV
FT                   TEERDWGGVVCRYRYDADGLCTARVNGLEETILYSRDAAGRLAEVITPEGKTQYAYDKS
FT                   GRLTGIFSPDGTSQRTGYDERGRVNVTTQGRRAIEYHYPDEHTVIRCILPPEDERDRHP
FT                   DGSLLKTTYRYNAAGELTEVILPGDETLTFSRDEAGREVLRHSNRGFACEQGWNAAGQP
FT                   VSQRAGLFPAEATWGGLLPSLLREYRYDSAGNVSGVTSREDYGRETHREYRLDRNGQVT
FT                   AVTASGTGLGYGEGDETYGYDSCGYLKAQSAGRHRISGETDQYAAGHRLKQAGNTQYDY
FT                   DAAGRMVSRTKHRDGYRPETERFRWDSRDQLTGYRSAQGEQWEYRHDASGRRTEKRCDR
FT                   KKIRFTYLWDGDSIAEIREYRDDKLYSVRHLVFNGFELISQQFSRVRQPHPSVAPQWVT
FT                   RTNHAVSDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTDYPAPRGERDPEADPG
FT                   LLYAGQWQDAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRYVPNPCGYIDPLGL
FT                   AICQLARWTKWGSEQSNISDVLNSLGNRALKYANGDWIKSEAAFNKYINMINKRLELTG
FT                   SKFRVEIQPAIKNGERVPATTNGPFKVNGKWTSGTHYTGGSKRLDAGIIDITSPTNQYG
FT                   LHPVIEGFDITLNKTKPSAVDIYSDVFGGIDINDFRL"
FT   gene            complement(677866..678327)
FT                   /locus_tag="ECSP_0620"
FT   CDS_pept        complement(677866..678327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0620"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70494"
FT                   /protein_id="ACT70494.1"
FT                   /translation="MQFTFNEGHIQLPSQWQDQSMQVLVSTDNSGINLVITRDPVSQGT
FT                   LTPELYQETLALYQGKLDGYTEHACREITLAEAPAWLLDYSWNGPEDEGNQGRISQIAV
FT                   FQRRGDTLLTFTFSTSLSLKNSQKTMLLEVIKSFTPLPPENDIQKDQPR"
FT   gene            complement(678355..680256)
FT                   /locus_tag="ECSP_0621"
FT   CDS_pept        complement(678355..680256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0621"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70495"
FT                   /protein_id="ACT70495.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLTQSLSSLFSLDLSLVSQQF
FT                   LSLEFAQVLDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQMLYSMKVHPPLWRAGL
FT                   RQNFRIFQNEDIKSILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAYKSTDQSLVLCDTVRHLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMEGWR
FT                   NNAETARGMSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGAGTA
FT                   LENHFAVIPADRTWRPQPRLKPLVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNP
FT                   ADQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYMGSGFNELKFDDATGREQVYIHAQKNMDTEVLNDRTTTVKHDH
FT                   RETVKNDQTVTIQEGNRLLTVEKGHKITGVLKGSLSEDVFQDRGTIAGSVHVDAVNNGG
FT                   EGNGIQAYTAIKEIMLAVEESKIALTPDGIQLQVGESTVIRLSKDGITIVGGSVFIN"
FT   gene            complement(680850..682298)
FT                   /gene="cusS"
FT                   /locus_tag="ECSP_0622"
FT   CDS_pept        complement(680850..682298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="ECSP_0622"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CusR, senses copper ions"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70496"
FT                   /protein_id="ACT70496.1"
FT                   /translation="MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAE
FT                   QDINDLKEISATLERVLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGA
FT                   PDIREFARDAIPDKDARGGEVFLLSGPTMMMPGHGHGHMEHSNWRMISLPVGPLVDGKP
FT                   IYTLYIALSIDFHLHYINDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQN
FT                   ITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLI
FT                   TQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLAD
FT                   EVGKVFDFFEALAEDRGVELQFVGDECQVAGDPLMLRRALSNLLSNALRYTPPGEAIVV
FT                   RCQTVDHLVQVIVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVA
FT                   HKGTVAVTSNARGTRFVIVLPERG"
FT   gene            complement(682288..682971)
FT                   /gene="cusR"
FT                   /locus_tag="ECSP_0623"
FT   CDS_pept        complement(682288..682971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusR"
FT                   /locus_tag="ECSP_0623"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system with CusS"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70497"
FT                   /protein_id="ACT70497.1"
FT                   /translation="MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDY
FT                   DLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPFA
FT                   FAELLARVRTLLRRGAAVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLEFFL
FT                   RHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLE
FT                   VPDGQ"
FT   gene            683128..684510
FT                   /gene="cusC"
FT                   /locus_tag="ECSP_0624"
FT   CDS_pept        683128..684510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusC"
FT                   /locus_tag="ECSP_0624"
FT                   /product="copper/silver efflux system, outer membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70498"
FT                   /protein_id="ACT70498.1"
FT                   /translation="MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLSQNGLVNA
FT                   ADNYQNAGWRTFFVDNQVKTLISEALENNRDLRMATLKVQEARAQYRLTDADRYPQLNG
FT                   EGSGSWSGNLKGDSATTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHI
FT                   LLVSNVAQSYFNQQLAYAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIE
FT                   STRSDIAKRQGELAQANNALQLLLGSYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRP
FT                   DIMEAEHALMAANANIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEI
FT                   PIFNAGRNQANLDIAEIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLA
FT                   SLQITLQRARALYQHGAVSYLEVLDAERSLFATRQTVLDLNYARQVNEISLYTALGGGW
FT                   QQ"
FT   gene            684534..684866
FT                   /gene="cusF"
FT                   /locus_tag="ECSP_0625"
FT   CDS_pept        684534..684866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="ECSP_0625"
FT                   /product="periplasmic copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70499"
FT                   /protein_id="ACT70499.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVK
FT                   GFDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSGIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
FT   gene            684882..686105
FT                   /gene="cusB"
FT                   /locus_tag="ECSP_0626"
FT   CDS_pept        684882..686105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="ECSP_0626"
FT                   /product="copper/silver efflux system, membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70500"
FT                   /protein_id="ACT70500.1"
FT                   /translation="MKKIALIIGSMIAGGIISAAGFTWFAKAEPPAEKTSTAERKILFW
FT                   YDPMYPNTRFDKPGKSPFMDMDLVPKYADEESSASGVRIDPTQTQNLGVKTATVTRGPL
FT                   TFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGAPLLDLTIPDWVEAQS
FT                   EYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFD
FT                   LRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKW
FT                   TLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQR
FT                   VITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMR
FT                   SESATHAH"
FT   gene            686117..689254
FT                   /gene="cusA"
FT                   /locus_tag="ECSP_0627"
FT   CDS_pept        686117..689254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="ECSP_0627"
FT                   /product="copper/silver efflux system, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70501"
FT                   /protein_id="ACT70501.1"
FT                   /translation="MIEWIIRRSVANRFLVLMGALFLSIWGTWTIINTPVDALPDLSDV
FT                   QVIIKTSYPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTDPY
FT                   WARSRVLEYLNQVQGKLPAGVSAELGPDATGVGWIYEYALVDRSGKHDLADLRSLQDWF
FT                   LKYELKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISLAEVKSALDASNQEAGGSSI
FT                   ELAEAEYMVRASGYLQTLDDFNHIVLKASENGVPVYLRDVAKIQVGPEMRRGIAELNGE
FT                   VVGGVVILRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSGKL
FT                   LEEFIVVAVVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGGIAIAVG
FT                   AMVDAAIVMIENAHKRLEEWQHQHPDATLDNKTRWQVITNASVEVGPALFISLLIITLS
FT                   FIPIFTLEGQEGRLFGPLAFTKTYAMAGAALLAIVVIPILMGYWIRGKIPPESSNPLNR
FT                   FLIRVYHPLLLKVLHWPKTTLLVAALSVLTVLWPLNKVGGEFLPQINEGDLLYMPSTLP
FT                   GISAAEAASMLQKTDKLIMSVPEVARVFGKTGKAETATDSAPLEMVETTIQLKPQEQWR
FT                   PGMTMDKIIEELDNTVRLPGLANLWVPPIRNRIDMLSTGIKSPIGIKVSGTVLADIDAM
FT                   AEQIEEVARTVPGVASALAERLEGGRYINVEINREKAARYGMTVADVQLFVTSAVGGAM
FT                   VGETVEGIARYPINLRYPQSWRDSPQALRQLPILTPMKQQITLADVADVKVSTGPSMLK
FT                   TENARPTSWIYIDARDRDMVSVVHDLQKAIAEKVQLKPGTSVAFSGQFELLERANHKLK
FT                   LMVPMTLMIIFVLLYLAFRRVGEALLIISSVPFALVGGIWLLWWMGFHLSVATGTGFIA
FT                   LAGVAAEFGVVMLMYLRHAIEAEPSLNNPQTFSEQKLDEALHHGAVLRVRPKAMTVAVI
FT                   IAGLLPILWGTGAGSEVMSRIAAPMIGGMITAPLLSLFIIPAAYKLMWLHRHRVRK"
FT   gene            689356..690732
FT                   /gene="pheP"
FT                   /locus_tag="ECSP_0628"
FT   CDS_pept        689356..690732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheP"
FT                   /locus_tag="ECSP_0628"
FT                   /product="phenylalanine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70502"
FT                   /protein_id="ACT70502.1"
FT                   /translation="MKNASNVSEDTASNQEPTLHRGLHNRHIQLIALGGAIGTGLFLGI
FT                   GPAIQMAGPAVLLGYGVAGIIAFLIMRQLGEMVVEEPVSGSFAHFAYKYWGPFAGFLSG
FT                   WNYWVMFVLVGMAELTAAGIYMQYWFPDVPTWIWAAAFFIIINAVNLVNVRLYGETEFW
FT                   FALIKVLAIIGMIGFGLWLLFSGHGGEKASIDNLWRYGGFFATGWNGLILSLAVIMFSF
FT                   GGLELIGITAAEARDPEKSIPKAVNQVVYRILLFYIGSLVVLLALYPWVEVKSNSSPFV
FT                   MIFHNLDSNVVASALNFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLTRVSRRGV
FT                   PINSLMLSGAITSLVVLINYLLPQKAFGLLMALVVATLLLNWIMICLAHLRFRAAMRRQ
FT                   GRETQFKALLYPFGNYLCIAFLAMILLLMCTMDDMRLSAILLPVWIVFLFVAFKTLRRK
FT                   "
FT   gene            complement(690800..692047)
FT                   /gene="ybdG"
FT                   /locus_tag="ECSP_0629"
FT   CDS_pept        complement(690800..692047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="ECSP_0629"
FT                   /product="predicted mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70503"
FT                   /protein_id="ACT70503.1"
FT                   /translation="MQDLISHVEDLAGIEIDHTTSMVMIFGIIFLTAVVVHIILHWVVL
FT                   RTFEKRAIASSRLWLQIITQNKLFHRLAFTLQGIIVNIQAVFWLQKGTEAADILTTCAQ
FT                   LWIMMYALLSVFSLLDVILNLAQKFPAASQLPLKGIFQGIKLIGAILVGILMISLLIGQ
FT                   SPAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDI
FT                   GLTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSISIDVTSIRFLDEDE
FT                   MQRLNKAHLLKPYLTSRHQEINEWNRQQGSTESVLNLRRMTNIGTFRAYLNEYLRNHPR
FT                   IRKDMTLMVRQLAPGDNGLPLEIYAFTNTVVWLEYESIQADIFDHIFAIVEEFGLRLHQ
FT                   SPTGNDIRSLAGAFKQ"
FT   gene            complement(692155..692808)
FT                   /gene="nfnB"
FT                   /locus_tag="ECSP_0630"
FT   CDS_pept        complement(692155..692808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfnB"
FT                   /locus_tag="ECSP_0630"
FT                   /product="dihydropteridine reductase, NAD(P)H-dependent,
FT                   oxygen-insensitive"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70504"
FT                   /protein_id="ACT70504.1"
FT                   /translation="MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQP
FT                   WHFIVASTEEGKARVAKSAAGNYVFNERKILDASHVVVFCAKTAMDDAWLKLVVDQEDA
FT                   DGRFATPEAKAANDKGRKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVP
FT                   IEGFDAAILDAEFGLKEKGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV"
FT   gene            complement(692902..693270)
FT                   /gene="ybdF"
FT                   /locus_tag="ECSP_0631"
FT   CDS_pept        complement(692902..693270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="ECSP_0631"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70505"
FT                   /protein_id="ACT70505.1"
FT                   /translation="MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSE
FT                   LRGVPFINLKSDPQKSLLNQQIYPSIKPGYHMNKKHWISVYPGEEISEALLRDLINDSW
FT                   NLVVDGLAKRDQKRVRPG"
FT   gene            complement(693335..693583)
FT                   /gene="ybdJ"
FT                   /locus_tag="ECSP_0632"
FT   CDS_pept        complement(693335..693583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="ECSP_0632"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70506"
FT                   /protein_id="ACT70506.1"
FT                   /translation="MKHPLETLTTAAGILLMAFLSCLLLPAPALGLTLAQKLVTTFHLM
FT                   DLSQLYTLLFCLWFLVLGAIEYFVLRFIWRRWFSLAD"
FT   gene            complement(693649..694767)
FT                   /gene="ybdK"
FT                   /locus_tag="ECSP_0633"
FT   CDS_pept        complement(693649..694767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="ECSP_0633"
FT                   /product="gamma-glutamyl:cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70507"
FT                   /protein_id="ACT70507.1"
FT                   /translation="MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLIDAVKNKI
FT                   TAGEVKHDITESMLELATDVCRDINQAAGQFSAMQKVVLQAAADHHLEICGGGTHPFQK
FT                   WQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIA
FT                   LSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPWVSNWQQFEALFRCLSYTTMIDSIKD
FT                   LHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLIQATAHWLLTERPFKHKEKDYLLYK
FT                   FNRFQACRYGLEGVITDPYTGDRRPLTEDTLRLLEKIAPSAHKIGASSAIEALHRQVVS
FT                   GLNEAQLMRDFVADGGSLIGLVKKHCEIWAGD"
FT   gene            695062..695358
FT                   /locus_tag="ECSP_0634"
FT   CDS_pept        695062..695358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0634"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70508"
FT                   /protein_id="ACT70508.1"
FT                   /translation="MPEAFRFQVYSEVWKDEAPGDISINPGAATPNQTIWMVVPSSHGG
FT                   NINMLTKYALVAVIVLCLTVPGFTLLVGDSLCEFTVKERNIEFRAVLAYEPKK"
FT   gene            695709..695861
FT                   /gene="hokE"
FT                   /locus_tag="ECSP_0635"
FT   CDS_pept        695709..695861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokE"
FT                   /locus_tag="ECSP_0635"
FT                   /product="toxic polypeptide, small"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70509"
FT                   /protein_id="ACT70509.1"
FT                   /translation="MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA
FT                   YEPKK"
FT   gene            complement(695983..696612)
FT                   /gene="entD"
FT                   /locus_tag="ECSP_0636"
FT   CDS_pept        complement(695983..696612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entD"
FT                   /locus_tag="ECSP_0636"
FT                   /product="phosphopantetheinyltransferase component of
FT                   enterobactin synthase multienzyme complex"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70510"
FT                   /protein_id="ACT70510.1"
FT                   /translation="MVDMKTTHTSLPFAGHTLHFVEFDPANFCEQDLLWLPHYAQLQHA
FT                   GRKRKTEHLAGRIAAVYALREYGYKCVPAIGELRQPVWPAEVYGSISHCGATALAVVSR
FT                   QPIGVDIEEIFSAQTATELTDNIITPAEHERLADCGLAFSLALTLAFSAKESAFKASEI
FT                   QTDAGFLDYQIISWNKQQVIIHRENEMFAVHWQIKEKIVITLCQHD"
FT   gene            complement(696778..699018)
FT                   /gene="fepA"
FT                   /locus_tag="ECSP_0637"
FT   CDS_pept        complement(696778..699018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepA"
FT                   /locus_tag="ECSP_0637"
FT                   /product="iron-enterobactin outer membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70511"
FT                   /protein_id="ACT70511.1"
FT                   /translation="MNKKIHSLALLVNLGIYGVAQAQEPTDTPVSHDDTIVVTAAEQNL
FT                   QAPGVSTITADEIRKNPVARDVSEIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMGPENT
FT                   LILIDGKPVSSRNSVRQGWRGERDTRGDTSWVPPEMIERIEVLRGPAAARYGNGAAGGV
FT                   VNIITKKGSGEWHGSWDAYFNAPEHKEEGATKRTNFSLTGPLGDEFSFRLYGNLDKTQA
FT                   DAWDINQGHQSARAGTYATTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSRQGNL
FT                   YAGDTQNTNSDAYTRSKYGDETNRLYRQNYSLTWNGGWDNGVTTSNWVQYEHTRNSRIP
FT                   EGLAGGTEGKFNEKATQDFVDNDLDDVMLHSEVNLPIDFLVNQTLTLGTEWNQQRMKDL
FT                   SSNTQALTGTNTGGAIDGVSATDRSPYSKAEIFSLFAENNMELTDSTIVTPGLRFDHHS
FT                   IVGNNWSPALNISQGLGDDFTLKMGIARAYKAPSLYQTNPNYILYSKGQGCYASAGGCY
FT                   LQGNDDLKAETSINKEIGLEFKRDGWLAGITWFRNDYRNKIEAGYVAVGQNAVGTDLYQ
FT                   WDNVPKAVVEGLEGSLNVPVSETVMWTNNITYMLKSENKTTGDRLSIIPEYTLNSTLSW
FT                   QAREDLSMQTTFTWYGKQQPKKYNYKGQPAVGPETKEISPYSIVGLSATWDVTKNVSLT
FT                   GGVDNLFDKRLWRAGNAQTTGDLAGANYIAGAGAYTYNEPGRTWYMSVNTHF"
FT   gene            699339..700463
FT                   /gene="fes"
FT                   /locus_tag="ECSP_0638"
FT   CDS_pept        699339..700463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fes"
FT                   /locus_tag="ECSP_0638"
FT                   /product="enterobactin/ferric enterobactin esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70512"
FT                   /protein_id="ACT70512.1"
FT                   /translation="MFEVTFWWRDPQGSEEYSTIKRVWIYITGVTDHHQNSQPQSMQRI
FT                   AGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPSPDRLELREGWRKLLPQAIADPLNP
FT                   QSWKGGRGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDV
FT                   TAEERPLAVLLDGEFWAQSMPVWPVLISLTHRQQLPPAVYVLIDAIDTTHRAHELPCNA
FT                   DFWLAVQQELLPLVKAIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGS
FT                   YWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESI
FT                   FWRQVDGGHDALCWRGGLMQGLIDLWQPLFHDRS"
FT   gene            700466..700684
FT                   /gene="ybdZ"
FT                   /locus_tag="ECSP_0639"
FT   CDS_pept        700466..700684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="ECSP_0639"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70513"
FT                   /protein_id="ACT70513.1"
FT                   /translation="MAFSNPFDDPQGVFYILRNAQGQFSLWPQQCALPAGWDIVCQPQS
FT                   QESCQQWLEVHWRTLTPANFTQLQEAQ"
FT   gene            700681..704562
FT                   /gene="entF"
FT                   /locus_tag="ECSP_0640"
FT   CDS_pept        700681..704562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entF"
FT                   /locus_tag="ECSP_0640"
FT                   /product="ATP-dependent serine activating enzyme (may be
FT                   part of enterobactin synthase as component F)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70514"
FT                   /protein_id="ACT70514.1"
FT                   /translation="MSQHLPLVAAQPGIWMAEKLSELPSAWSVAHYVELTGEVDAPLLA
FT                   RAVVAGLAQADTLRMRFTEDNGEVWQWVDDALIFELPEIIDLRTNIDPHGTAQALMQAD
FT                   LQQDLRVDSGKPLVFHQLIQVADNRWYWYQRYHHLLVDGFSFPAITRQIANIYCALLRG
FT                   EQTPASPFTPFADVVEEYQQYRESEAWQRDAAFWAEQRRQLPPPASLSPAPLAGRSASA
FT                   DILRLKLEFTDGEFRQLATQLSGVQRTDLALALAAFWLGRLCNRMDYAAGFIFMRRLGS
FT                   AALTATGPVLNVLPLGIHIAAQETLPELATRLAAQLKKMRRHQRYDAEQIVRDSGRAAG
FT                   DEPLFGPVLNIKVFDYQLDIPGVQAQTHTLATGPVNDLELALFPDEHGDLSIEILANKQ
FT                   HYDEPTLIQHAERLKMLIAQFAADPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLS
FT                   ALVAEQAAKTPDAPALADARYQFSYREMREQVVALANLLREHGVKPGDSVAVALPRSVF
FT                   LTLALHAIVEAGAAWLPLDTGYPDDRLKMMLEDARPSLLITTDDQLPRFADVPDLTNLC
FT                   YNAPLTPQGSAPLQLSQPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQNHYPLTG
FT                   EDVVAQKTPCSFDVSVWEFFWPFIAGAKLVMAEPEAHRDPLAMQQFFAEYGVTTTHFVP
FT                   SMLAAFVASLTPQTARQNCATLKQVFCSGEALPADLCREWQQLTGAPLHNLYGPTEAAV
FT                   DVSWYPAFGEELAQVRGSSVPIGYPVWNTGLRILDAMMHPVPPGVAGDLYLTGIQLAQG
FT                   YLGRPDLTASRFIADPFVPGERMYRTGDVARWLDNGAVEYLGRSDDQLKIRGQRIELGE
FT                   IDRVMQALPDVEQAVTHACVINQAAATGGDARQLVGYLVSQSGLPLDTSALQAQLRETL
FT                   PPHMAPVVLLQLPQLPLSANGKLDRKALPLPELKAQTPGRAPKAGSETIIAAAFASLLG
FT                   CDVQDADADFFALGGHSLLAMKLAAQLSRQFARQVTPGQVMVASTVAKLATIIDGEEDS
FT                   SRRMGFETILPLREGNGPTLFCFHPASGFAWQFSVLSRYLDPLWSIIGIQSPRPHGPMQ
FT                   TATNLDEVCEAHLATLLEQQPHGPYYLLGYSLGGTLAQGIAARLRARGEQVAFLGLLDT
FT                   WPPETQNWQEKEANGLDPEVLAEINREREAFLAAQQGSTSTELFTTIEGNYADAVRLLT
FT                   TAHSVPFDGKATLFVAERTLQEGMSPERAWSPWIAELDIYRQDCAHVDIISPGAFEKIG
FT                   PIIRATLNR"
FT   gene            704778..705911
FT                   /gene="fepE"
FT                   /locus_tag="ECSP_0641"
FT   CDS_pept        704778..705911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepE"
FT                   /locus_tag="ECSP_0641"
FT                   /product="regulator of length of O-antigen component of
FT                   lipopolysaccharide chains"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70515"
FT                   /protein_id="ACT70515.1"
FT                   /translation="MSSLNIKQGSDAHFPDYPLASPSNNEIDLLNLISVLWRAKKTVMA
FT                   VVFAFACAGLLISFILPQKWTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAF
FT                   NLFIKKFQSVSLLEEYLRSSPYVMDQLKEAKIDELDLHRAIVALSEKMKAVDDNASKKK
FT                   DEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKL
FT                   AQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVYSNGQAVKDDPDFSISLGADGIERK
FT                   LEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLPVKKDGPGKAI
FT                   IVILSALIGGMVACGSVLLRYAMASRKQDAMMADHLV"
FT   gene            complement(705908..706723)
FT                   /gene="fepC"
FT                   /locus_tag="ECSP_0642"
FT   CDS_pept        complement(705908..706723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="ECSP_0642"
FT                   /product="ATP-binding component of ferric enterobactin
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70516"
FT                   /protein_id="ACT70516.1"
FT                   /translation="MTESVARLRGEQLTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCG
FT                   KSTLLRTLSRLMTPAHGHVWLDGEHIQHYASKEVARRIGLLAQNATTLGDITVQELVAR
FT                   GRYPHQPLFTRWRKEDEEAVTKAMQATGITHLADQSVDTLSGGQRQRAWIAMVLAQETA
FT                   IMLLDEPTTWLDISHQIDLLELLSELNREKGYTLAAVLHDLNQACRYASHLIALREGKI
FT                   VAQGAPKEIVTAELIERIYGLRCMIIDDPVAGTPLVVPLGRTAPSTANS"
FT   gene            complement(706720..707712)
FT                   /gene="fepG"
FT                   /locus_tag="ECSP_0643"
FT   CDS_pept        complement(706720..707712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="ECSP_0643"
FT                   /product="iron-enterobactin transporter subunit, membrane
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70517"
FT                   /protein_id="ACT70517.1"
FT                   /translation="MIYVSRRLLITCLLLISACVVAGIWGLRSGAVTLEISQVFAALMG
FT                   DAPRSMTMVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGV
FT                   LVAMVLFGQDLTAIALAAMVGGIITSLLVWLLAWRNGIDTFRLIIIGIGVRAMLVAFNT
FT                   WLLLKASLETALTAGLWNAGSLNGLTWAKTSPSAPIIILMLIAAALLVRRMRLLEMGDD
FT                   TACALGVSVERSRLLMMLVAVVLTAAATALAGPISFIALVAPHIARRISGTARWGLTQA
FT                   ALCGALLLLAADLCAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
FT   gene            complement(707709..708713)
FT                   /gene="fepD"
FT                   /locus_tag="ECSP_0644"
FT   CDS_pept        complement(707709..708713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="ECSP_0644"
FT                   /product="ferric enterobactin (enterochelin) transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70518"
FT                   /protein_id="ACT70518.1"
FT                   /translation="MSGSVAVTRAIAVPGLLLLLIIATALSLLIGAKSLPASVVLEAFS
FT                   GTCQSADCTIVLDARLPRTLAGLLAGGALGLAGALMQTLTRNPLADPGLLGVNAGASFA
FT                   IVLGAALFGYSSAQEQLAMAFAGALVASLIVAFTGSQGGGQLSPVRLTLAGVALAAVLE
FT                   GLTSGIALLNPDVYDQLRFWQAGSLDIRNLHTLKVVLIPVLIAGATALLLSRALNSLSL
FT                   GSDTATALGSRVARTQLIGLLAITVLCGSATAVVGPIAFIGLMMPHMARWLVGADHRWS
FT                   LPVTLLATPALLLFADIIGRVIVPGELRVSVVSAFIGAPVLIFLVRRKTRGGA"
FT   gene            708824..710074
FT                   /gene="ybdA"
FT                   /locus_tag="ECSP_0645"
FT   CDS_pept        708824..710074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdA"
FT                   /locus_tag="ECSP_0645"
FT                   /product="major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70519"
FT                   /protein_id="ACT70519.1"
FT                   /translation="MNKQSWLLNLSLLKTHPAFRAVFLARFISIVSLGLLGVAVPVQIQ
FT                   MMTHSTWQVGLSVTLTGGAMFVGLMVGGVLADRYERKKVILLARGTCGIGFIGLCLNAL
FT                   LPEPSLLAIYLLGLWDGFFASLGVTALLAATPALVGRENLMQAGAITMLTVRLGSVISP
FT                   MIGGLLLATGGVAWNYGLAAAGTFITLLPLLSLPALPPPPQPREHPLKSLLAGFRFLLA
FT                   SPLVGGIALLGGLLTMASAVRVLYPALADNWQMSAAQIGFLYAAIPLGAAIGALTSGKL
FT                   AHSARPGLLMLLSTLGSFLAIGLFGLMPMWILGVVCLALFGWLSAVSSLLQYTMLQTQT
FT                   PEAMLGRINGLWTAQNVTGDAIGAALLGGLGAMMTPVASASASGFGLLIIGVLLLLVLV
FT                   ELRRFRQTPPQVTASDG"
FT   gene            complement(710078..711034)
FT                   /gene="fepB"
FT                   /locus_tag="ECSP_0646"
FT   CDS_pept        complement(710078..711034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="ECSP_0646"
FT                   /product="iron-enterobactin transporter subunit,
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70520"
FT                   /protein_id="ACT70520.1"
FT                   /translation="MRLAPLYRNALLLTGLLFSGIAAVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSTEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQALLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSAMQVLERLKALF"
FT   gene            711223..712398
FT                   /gene="entC"
FT                   /locus_tag="ECSP_0647"
FT   CDS_pept        711223..712398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entC"
FT                   /locus_tag="ECSP_0647"
FT                   /product="isochorismate synthase 1"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70521"
FT                   /protein_id="ACT70521.1"
FT                   /translation="MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVN
FT                   GDSPDSPFQQKLAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQA
FT                   SARRFTRSQSLNVVERQAIPEQTTFEQMVARAAALTATPQVDKVVLSRLIDITTDAAID
FT                   SGVLLERLIAQNPVSYNFHVPLADGGVLLGASPELLLRKDGERFSSIPLAGSARRQPDE
FT                   VLDREAGNRLLASEKDRHEHELVTQAMKEVLRERSSELHVPSSPQLITTPTLWHLATPF
FT                   EGKANSQENALTLACLLHPTPALSGFPHQAATQVIAELEPFDRELFGGIVGWCDSEGNG
FT                   EWVVTIRCAKLRENQVRLFAGAGIVPASSPLGEWRETGVKLSTMLNVFGLH"
FT   gene            712408..714018
FT                   /gene="entE"
FT                   /locus_tag="ECSP_0648"
FT   CDS_pept        712408..714018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entE"
FT                   /locus_tag="ECSP_0648"
FT                   /product="Enterobactin synthetase component E"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70522"
FT                   /protein_id="ACT70522.1"
FT                   /translation="MSIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDG
FT                   ERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLAL
FT                   FSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVAEHSSIRVVQLLNDSGEHNL
FT                   QDAINHPADGFTATPSPADEVVYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQ
FT                   QTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQINVTALVPP
FT                   AVSLWLQALTEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVN
FT                   YTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQ
FT                   HNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVI
FT                   YAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTA
FT                   VGKVDKKQLRQWLASRASA"
FT   gene            714032..714889
FT                   /gene="entB"
FT                   /locus_tag="ECSP_0649"
FT   CDS_pept        714032..714889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entB"
FT                   /locus_tag="ECSP_0649"
FT                   /product="2,3-dihydro-2,3-dihydroxybenzoate synthetase,
FT                   isochroismatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70523"
FT                   /protein_id="ACT70523.1"
FT                   /translation="MAIPKLQAYALPESHDIPQNKVDWAFEPQRAALLIHDMQDYFVSF
FT                   WGENCPMMEQVIANIAALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPE
FT                   QQKVVDRLTPDADDTVLVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATD
FT                   AFMRDIKPFMVADALADFSRDEHLMSLKYVAGRSGRVVMTEELLPAPIPASKAALREVI
FT                   LPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLS
FT                   REVK"
FT   gene            714889..715635
FT                   /gene="entA"
FT                   /locus_tag="ECSP_0650"
FT   CDS_pept        714889..715635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entA"
FT                   /locus_tag="ECSP_0650"
FT                   /product="2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70524"
FT                   /protein_id="ACT70524.1"
FT                   /translation="MDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFAQEQYP
FT                   FATEVMDVADAAQVAQVCQRLLAETERLDVLVNAAGILRMGATDQLSKEDWQQTFAVNV
FT                   GGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELA
FT                   GSGVRCNVVSPGSTDTDMQRTLWVSDDAEEQRIRGFGEQFKLGIPLGKIARPQEIANTI
FT                   LFLASDLASHITLQDIVVDGGSTLGA"
FT   gene            715638..716051
FT                   /gene="ybdB"
FT                   /locus_tag="ECSP_0651"
FT   CDS_pept        715638..716051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdB"
FT                   /locus_tag="ECSP_0651"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70525"
FT                   /protein_id="ACT70525.1"
FT                   /translation="MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDIR
FT                   THQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP
FT                   LHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG"
FT   gene            716232..718337
FT                   /gene="cstA"
FT                   /locus_tag="ECSP_0652"
FT   CDS_pept        716232..718337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="ECSP_0652"
FT                   /product="carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70526"
FT                   /protein_id="ACT70526.1"
FT                   /translation="MNKSGKYLVWTVLSVMGAFALGYIALNRGEQINALWIVVASVCIY
FT                   LIAYRFYGLYIAKNVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGPTAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLALFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAESPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGNLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFAITPDTLNQIASEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTAGWQKAFSPDAKVGFLAIANKFQAMIDSGNIPSQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLALFSIKTALAALKEPKPTAKETPYEPMPENVEEIV
FT                   VQAKGAH"
FT   gene            718519..718716
FT                   /gene="ybdD"
FT                   /locus_tag="ECSP_0653"
FT   CDS_pept        718519..718716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="ECSP_0653"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70527"
FT                   /protein_id="ACT70527.1"
FT                   /translation="MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
FT   gene            complement(718726..719814)
FT                   /gene="ybdH"
FT                   /locus_tag="ECSP_0654"
FT   CDS_pept        complement(718726..719814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdH"
FT                   /locus_tag="ECSP_0654"
FT                   /product="predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70528"
FT                   /protein_id="ACT70528.1"
FT                   /translation="MPHNPIRVVVGPANYFSHPGSFNHLHDFFTDEQLSRAVWIYGVRA
FT                   IAAAQTKLPPAFGLPGAKHILFRGHCSESDVQQLAAESGDDRSVVIGVGGGALLDTAKA
FT                   LARRLGLPFVAAPTIAATCAAWTPLSVWYNDAGQALHYEIFDDANFMVLVEPEIILNAP
FT                   QQYLLAGIGDTLAKWYEAVVLAPQPETLPLTVRLGINNAQAIRDVLLNSSEQALADQQN
FT                   QQLTQSFCDVVDAIIAGGGMVGGLGDRFTRVAAAHAVHNGLTVLPQTEKFLHGTKVAYG
FT                   ILVQSALLGQDDVLAQLTGAYQRFHLPTTLAELEVDINNQAEIDKVIAHTLRPVESIHY
FT                   LPVTLTPDTLRAAFEKVESFKA"
FT   gene            719923..721083
FT                   /gene="ybdL"
FT                   /locus_tag="ECSP_0655"
FT   CDS_pept        719923..721083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdL"
FT                   /locus_tag="ECSP_0655"
FT                   /product="methionine aminotransferase, PLP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70529"
FT                   /protein_id="ACT70529.1"
FT                   /translation="MTNNPLIPQSKLPQLGTTIFTQMSALAQQHQAINLSQGFPDFDGP
FT                   RYLQERLAYHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADSDITVTAGATEAL
FT                   YAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQEFAALLSER
FT                   TRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHP
FT                   QLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLAIADML
FT                   RAEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSAVSTLDDVEFCQW
FT                   LTREHGVAAIPLSVFCADPFPHKLIRLCFAKKESTLLAAAERLRQL"
FT   gene            complement(721084..721713)
FT                   /gene="ybdM"
FT                   /locus_tag="ECSP_0656"
FT   CDS_pept        complement(721084..721713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="ECSP_0656"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70530"
FT                   /protein_id="ACT70530.1"
FT                   /translation="MGDTMQQRLTQDLTQFLASLPEDDRINAINEIRMAIHQVSPFREE
FT                   PVDCVLWVKNSQLMPNDYNPNNVAPPEKKLLKKSIEIDGFTQPIVVTHTDKNALEIVDG
FT                   FHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGRHQITAMSEIVREL
FT                   SQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQYSRAWTVK"
FT   gene            complement(721686..722906)
FT                   /gene="ybdN"
FT                   /locus_tag="ECSP_0657"
FT   CDS_pept        complement(721686..722906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="ECSP_0657"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70531"
FT                   /protein_id="ACT70531.1"
FT                   /translation="MSIYKIPLPLNILEAARERITWTLNTLPRVCVSFSGGKDSGLMLH
FT                   LTAELARQMGKKICVLFIDWEAQFSCTINYVQSLRELYTDVIEEFYWVALPLTTQNSLS
FT                   QYQPEWQCWEPDVEWVRQPPQDAITDPDFFCFYQPGMTFEQFVREFAEWFSQKRPAAMM
FT                   IGIRADESYNRFVAIASLNKQRFADDKPWTTAAPGGHSWYIYPIYDWKVADIWTWYANH
FT                   QSLCNPLYNLMYQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARVSGVKSG
FT                   GIYAGHDNHFYGHRKILKPEHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHWYQKKGI
FT                   EVPQTQQGDIGAKDIPSWRRICKVLLNNDYWCRALSFSPTKAKNYQRYNERIKGKRQEW
FT                   GILCNND"
FT   gene            complement(723053..723955)
FT                   /gene="ybdO"
FT                   /locus_tag="ECSP_0658"
FT   CDS_pept        complement(723053..723955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /locus_tag="ECSP_0658"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70532"
FT                   /protein_id="ACT70532.1"
FT                   /translation="MTNLYDLKKFDLNLLVIFECIYQHLSISKAAESLYITPSAVSQSL
FT                   QRLRAQFNDPLFIRSGKGIAPTTTGLNLHHHLEKNLRGLEQTINIVNKSELKKNFIIHG
FT                   PQLISCSNNSMLIRCLRQDSSVEIECHDILMSAENAEELLVHRKADLVITQMPVISRSV
FT                   ICMPLHTIRNTLICSNRHPRITDNSTYEQIMAEEFTQLISKSAGVDDIQMEIDERFMNR
FT                   KISFRGSSLLTIINSIAVTDLLGIVPYELYNSHRDFLNLKEIKLEHPLPSIKLYISYNK
FT                   SSLNNLVFSRFIDRLNECF"
FT   gene            complement(724165..724911)
FT                   /gene="dsbG"
FT                   /locus_tag="ECSP_0659"
FT   CDS_pept        complement(724165..724911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="ECSP_0659"
FT                   /product="periplasmic disulfide isomerase/thiol-disulphide
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70533"
FT                   /protein_id="ACT70533.1"
FT                   /translation="MLKKILLLALLPAIAFAEELPAPVKAIEKQGITIIKTFDAPGGMK
FT                   GYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQS
FT                   HWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATA
FT                   AAILASKDPAKTWQEYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYY
FT                   MSKENTLQQAVGLPDQKTLNIIMGNK"
FT   gene            725283..725846
FT                   /gene="ahpC"
FT                   /locus_tag="ECSP_0660"
FT   CDS_pept        725283..725846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="ECSP_0660"
FT                   /product="alkyl hydroperoxide reductase, C22 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70534"
FT                   /protein_id="ACT70534.1"
FT                   /translation="MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTF
FT                   VCPTELGDVADHYEELQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGAL
FT                   TRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVASHPG
FT                   EVCPAKWKEGEATLAPSLDLVGKI"
FT   gene            725975..727540
FT                   /gene="ahpF"
FT                   /locus_tag="ECSP_0661"
FT   CDS_pept        725975..727540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="ECSP_0661"
FT                   /product="alkyl hydroperoxide reductase, F52a subunit, FAD"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70535"
FT                   /protein_id="ACT70535.1"
FT                   /translation="MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAE
FT                   LSDKVTFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKE
FT                   AQSLLEQIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEI
FT                   TDRNVMGVPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGP
FT                   AGAAAAIYSARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYD
FT                   VDVIDSQSASKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTK
FT                   GVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDK
FT                   LRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWL
FT                   EGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIR
FT                   TKTA"
FT   gene            complement(727661..728089)
FT                   /gene="uspG"
FT                   /locus_tag="ECSP_0662"
FT   CDS_pept        complement(727661..728089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspG"
FT                   /locus_tag="ECSP_0662"
FT                   /product="universal stress protein UP12"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70536"
FT                   /protein_id="ACT70536.1"
FT                   /translation="MYKTIIMPVDVFEMELSDKAVRHAEFLAQDDGVIHLLHVLPGSAS
FT                   LSLHRFAADVRRFEEHLQHEAEERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEEL
FT                   GADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR"
FT   gene            728310..729548
FT                   /gene="ybdR"
FT                   /locus_tag="ECSP_0663"
FT   CDS_pept        728310..729548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdR"
FT                   /locus_tag="ECSP_0663"
FT                   /product="predicted oxidoreductase, Zn-dependent and
FT                   NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70537"
FT                   /protein_id="ACT70537.1"
FT                   /translation="MKALTYHGPHHVQVENVPDPGIEQADDIILRITATAICGSDLHLY
FT                   RGKIPQVKHGDIFGHEFMGEVVETGKDVKNLQKGDRVVIPFVIACGDCFFCRLQQYAAC
FT                   ENTNAGKGAALNKKQIPAPAALFGYSHLYGGVPGGQAEYVRVPKGNVGPFKVPPLLSDD
FT                   KALFLSDILPTAWQAAKNAQIQQGSSVAVYGAGPVGLLTIACARLLGAEQIFVVDHHPY
FT                   RLRFAADRYGAIPINFDEDSDPAQSIIEQTAGHRGVDAVIDAVGFEAKGSTTETVLTNL
FT                   KLEGSSGKALRQCIAAVRRGGIVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQTHVHAWL
FT                   GELLPLIEKGLLKPEEIVTHYMPFEEAARGYEIFEKREEECRKVILVPGAQSAEAAQKA
FT                   VSGLVNAMPGGTI"
FT   gene            complement(729779..730189)
FT                   /gene="rnk"
FT                   /locus_tag="ECSP_0664"
FT   CDS_pept        complement(729779..730189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="ECSP_0664"
FT                   /product="regulator of nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70538"
FT                   /protein_id="ACT70538.1"
FT                   /translation="MSRPTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQMCS
FT                   PEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVG
FT                   DSIHWELPGGVATHLEVLELEYQPEAAGDYLL"
FT   gene            complement(730419..731225)
FT                   /gene="rna"
FT                   /locus_tag="ECSP_0665"
FT   CDS_pept        complement(730419..731225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rna"
FT                   /locus_tag="ECSP_0665"
FT                   /product="ribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70539"
FT                   /protein_id="ACT70539.1"
FT                   /translation="MKAFWRNAALLAVSLLPFSSANAVALQAKQYGDFDRYVLALSWQT
FT                   GFCQSQHDRNRNERDECRLQTETTNKADFLTVHGLWPGLPKSVAARGVDERRWMRFGCA
FT                   TRPIPNLPEARASRMCSSPETGLSLETAAKLSEVMPGAGGRSCLERYEYAKHGACFGFD
FT                   PDAYFGTMVRLNQEIKESEAGKFLADNYGKTVSRRDFDAAFAKSWGKENVKAVKLTCQG
FT                   NPAYLTEIQVSIKADAINAPLSANSFLPQPHPGNCGKTFVIDKAGY"
FT   gene            complement(731339..732802)
FT                   /gene="citT"
FT                   /locus_tag="ECSP_0666"
FT   CDS_pept        complement(731339..732802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="ECSP_0666"
FT                   /product="citrate:succinate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70540"
FT                   /protein_id="ACT70540.1"
FT                   /translation="MSLAKDNIWKLLAPLVVMGVMFLIPVPDGMPPQAWHYFAVFVAMI
FT                   VGMILEPIPATAISFIAVTICVIGSNYLLFDAKELADPAFNAQKQALKWGLAGFSSTTV
FT                   WLVFGAFIFALGYEVSGLGRRIALFLVKFMGKRTLTLGYAIVIIDILLAPFTPSNTART
FT                   GGTVFPVIKNLPPLFKSFPNDPSARRIGGYLMWMMVISTSLSSSMFVTGAAPNVLGLEF
FT                   VSKIAGIQISWLQWFLCFLPVGVILLIIAPWLSYVLYKPEITHSEEVATWAGDELKTMG
FT                   ALTRREWTLIGLVLLSLGLWVFGSEVINATAVGLLAVSLMLALHVVPWKDITRYNSAWN
FT                   TLVNLATLVVMANGLTRSGFIDWFAGTMSTHLEGFSPNATVIVLVLVFYFAHYLFASLS
FT                   AHTATMLPVILAVGKGIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVIIYGCGYVKSK
FT                   DYWRLGAIFGVIYISMLLLVGWPILAMWN"
FT   gene            complement(732853..733731)
FT                   /gene="citG"
FT                   /locus_tag="ECSP_0667"
FT   CDS_pept        complement(732853..733731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="ECSP_0667"
FT                   /product="triphosphoribosyl-dephospho-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70541"
FT                   /protein_id="ACT70541.1"
FT                   /translation="MSMPATLTKTTKLATSLIDEYALLGWRAMLTEVNLSPKPGLVDRI
FT                   NCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHGLRPIGMACEGDMFR
FT                   ATAGVNTHKGSIFSLGLLCAAIGRLLQLNQLLTPTTVCSTAASFCRGLTDRELRTNNSQ
FT                   LTAGQRLYQQLGLTGARGEAEAGYPLVINHALPHYLTLLDQGLDPELALLDTLLLLMAI
FT                   NGDTNVASRGGEGGLRWLQREAQTLLQKGGIRTPADLDYLRQFDRECIERNLSPGGSAD
FT                   LLILTWFLAQI"
FT   gene            complement(733706..734257)
FT                   /gene="citX"
FT                   /locus_tag="ECSP_0668"
FT   CDS_pept        complement(733706..734257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX"
FT                   /locus_tag="ECSP_0668"
FT                   /product="apo-citrate lyase phosphoribosyl-dephospho-CoA
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70542"
FT                   /protein_id="ACT70542.1"
FT                   /translation="MHLLPELASHHAVSIPELLVSRDERQARQHVWLKRHPVPLVSFTV
FT                   VAPGPIKDSEVTRRIFNHGVTALRALAAKQGWQIQEQAALVSASGPEGMLSIAAPARDL
FT                   KLATIELEHSHPLGRLWDIDVLTPEGEILSRRDYSLPPRRCLLCEQSAAVCARGKTHQL
FT                   TDLLNRMEALLNDVDACNVN"
FT   gene            complement(734261..735793)
FT                   /gene="citF"
FT                   /locus_tag="ECSP_0669"
FT   CDS_pept        complement(734261..735793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="ECSP_0669"
FT                   /product="citrate lyase, citrate-ACP transferase (alpha)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70543"
FT                   /protein_id="ACT70543.1"
FT                   /translation="MTQKIEQSQRQERVAAWNRRAECDLAAFQNSPKQTYQAEKARDRK
FT                   LCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLILASSSLSDCH
FT                   APLVEHIRQGVVTRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVA
FT                   FLGVPSCDEFGNANGYTGKACCGSLGYAMVDADNAKQVVMLTEELLPYPHNPASIEQDQ
FT                   VDLIVKVDRVGDAAKIGAGATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGA
FT                   SLAVTLFLEDKMRSRDIRADFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARN
FT                   PNHIEISANQYANWGSKGASVDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCD
FT                   TAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVTDHGIAVNPARPELAERLQ
FT                   EAGIKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVIDVVHQVKE"
FT   gene            complement(735804..736712)
FT                   /gene="citE"
FT                   /locus_tag="ECSP_0670"
FT   CDS_pept        complement(735804..736712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="ECSP_0670"
FT                   /product="citrate lyase, citryl-ACP lyase (beta) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70544"
FT                   /protein_id="ACT70544.1"
FT                   /translation="MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLED
FT                   SVALREKDTARRMVYHALQHPLYRDIETIVRVNALDSEWGVNDLEAVVRGGADVVRLPK
FT                   TDTAQDVLDIEKEILRIEKACGREPGSTGLLAAIESPLGITRAVEIAHASERLIGIALG
FT                   AEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIK
FT                   QLGFDGKSLINPRQIDLLHNLYAPTQKEVDHARRVVEAAEAAAREGLGVVSLNGKMVDG
FT                   PVIDRARLVLSRAELSGIREE"
FT   gene            complement(736709..737005)
FT                   /gene="citD"
FT                   /locus_tag="ECSP_0671"
FT   CDS_pept        complement(736709..737005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="ECSP_0671"
FT                   /product="citrate lyase, acyl carrier (gamma) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70545"
FT                   /protein_id="ACT70545.1"
FT                   /translation="MKINQPAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGDAI
FT                   RTTILDVLARYNVRGVQLNVDDKGALDCILRARLEALLARASGIPALPWEDCQ"
FT   gene            complement(737020..738078)
FT                   /gene="citC"
FT                   /locus_tag="ECSP_0672"
FT   CDS_pept        complement(737020..738078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="ECSP_0672"
FT                   /product="citrate lyase synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70546"
FT                   /protein_id="ACT70546.1"
FT                   /translation="MFGNDIFTRVKRSENKKMAEIAQFLHENDLSVDTTVEVFITVTRD
FT                   EKLIACGGIAGNIIKCVAISESVRGEGLALTLATELINLAYERHSTHLFIYTKTEYEAL
FT                   FRQCGFSTLTSVPGVMVLMENSATRLKRYAESLKKFRHPGNKIGCIAMNANPFTNGHRY
FT                   LIQQAAAQCDWLHLFLVKEDSSRFPYEDRLDLVLKGTADIPRLTVHRGSEYIISRATFP
FT                   CYFIKEQSVINHCYTEIDLKIFRQYLAPALGVTHRFVGTEPFCRVTAQYNQDMRYWLET
FT                   PTISAAPIELVEIERLRYQEMPISASRVRQLLAKNDLTAIAPLVPAVTLHYLQNLLEHS
FT                   RQDAAARQKTPA"
FT   gene            738458..740116
FT                   /gene="citA"
FT                   /locus_tag="ECSP_0673"
FT   CDS_pept        738458..740116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="ECSP_0673"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with citB"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70547"
FT                   /protein_id="ACT70547.1"
FT                   /translation="MLQLNENKQFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASF
FT                   EDYLTLHVRDMAMNQAKIIASNDSVISEVKTRDYKRLATIANKLQRDTDFDYVVIGDRH
FT                   SIRLYHPNPEKIGYPMQFTKQGALEKGESYFITGKGSMGMAMRAKTPIFDDDGKVIGVV
FT                   SIGYLVSKIDSWRAEFLLPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVR
FT                   QQEALFSSVYEGLIAVDPHGYITAINRNARKMLGLSSPGRQWLGKPIAEVVRPADFFTE
FT                   QIDEKRQDVVANFNGLSVIANREAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVE
FT                   SLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQGESQAQQQLIDSLREAFADRQVAGLL
FT                   FGKVQRARELGLKMIIVPGSQLSQLPPGLDSTEFAAIVGNLLDNAFEASLRSDEGNKIV
FT                   ELFLSDEGDDVVIEVADQGCGVPESLRDKIFEQGVSTRADEPGEHGIGLYLIASYVTRC
FT                   GGVITLEDNDPCGTLFSIYIPKVKPNDSSINPIDR"
FT   gene            740085..740765
FT                   /gene="citB"
FT                   /locus_tag="ECSP_0674"
FT   CDS_pept        740085..740765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citB"
FT                   /locus_tag="ECSP_0674"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system with citA"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70548"
FT                   /protein_id="ACT70548.1"
FT                   /translation="MTAPLTLLIVEDETPLAEMHAEYIRHIPGFSQILLAGNLAQARMM
FT                   IERFKPGLILLDNYLPDGRGINLLHELVQAHYPGDVVFTTAASDMETVSEAVRCGVFDY
FT                   LIKPIAYERLGQTLTRFRQRKHMLESIDSASQKQIDEMFNAYARGEPKDELPTGIDPLT
FT                   LNAVRKLFKEPGVQHTAETVAQALTISRTTARRYLEYCASRHLIIAEIVHGKVGRPQRI
FT                   YHSG"
FT   gene            complement(740806..742191)
FT                   /gene="dcuC"
FT                   /locus_tag="ECSP_0675"
FT   CDS_pept        complement(740806..742191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuC"
FT                   /locus_tag="ECSP_0675"
FT                   /product="anaerobic C4-dicarboxylate transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70549"
FT                   /protein_id="ACT70549.1"
FT                   /translation="MLTFIELLIGVVVIVGVARYIIKGYSATGVLFVGGLLLLIISAIM
FT                   GHKVLPSSQASTGYSATDIIEYVKILLMSRGGDLGMMIMMLCGFAAYMTHIGANDMVVK
FT                   LASKPLQYINSPYLLMIAAYFVACLMSLAVSSATGLGVLLMATLFPVMVNVGISRGAAA
FT                   AICASPAAIILAPTSGDVVLAAQASEMSLIDFAFKTTLPISIAAIIGMAIAHFFWQRYL
FT                   DKKEHISHEMLDVSEITTTAPAFYAILPFTPIIGVLIFDGKWGPQLHIITILVICMLIA
FT                   SILEFLRSFNTQKVFSGLEVAYRGMADAFANVVMLLVAAGVFAQGLSTIGFIQSLISIA
FT                   TSFGSASIILMLVLVILTMLAAVTTGSGNAPFYAFVEMIPKLAHSSGINPAYLTIPMLQ
FT                   ASNLGRTLSPVSGVVVAVAGMAKISPFEVVKRTSVPVLVGLVIVIVATELMVPGTAAAV
FT                   TGK"
FT   gene            742780..743340
FT                   /gene="crcA"
FT                   /locus_tag="ECSP_0676"
FT   CDS_pept        742780..743340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcA"
FT                   /locus_tag="ECSP_0676"
FT                   /product="palmitoyl transferase for Lipid A"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70550"
FT                   /protein_id="ACT70550.1"
FT                   /translation="MNVSKYVAIFSFVFIQLISVGKVFANADEWMTTFRENIVQTWQQP
FT                   EHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWN
FT                   KWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTF
FT                   QMTYIPGTYNNGNVYFAWMRFQF"
FT   gene            743515..743724
FT                   /gene="cspE"
FT                   /locus_tag="ECSP_0677"
FT   CDS_pept        743515..743724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspE"
FT                   /locus_tag="ECSP_0677"
FT                   /product="DNA-binding transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70551"
FT                   /protein_id="ACT70551.1"
FT                   /translation="MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLA
FT                   EGQRVEFEITNGAKGPSAANVIAL"
FT   gene            complement(743778..744161)
FT                   /gene="crcB"
FT                   /locus_tag="ECSP_0678"
FT   CDS_pept        complement(743778..744161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="ECSP_0678"
FT                   /product="predicted inner membrane protein associated with
FT                   chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70552"
FT                   /protein_id="ACT70552.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGA
FT                   FIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
FT   gene            744254..745042
FT                   /gene="ybeM"
FT                   /locus_tag="ECSP_0679"
FT   CDS_pept        744254..745042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeM"
FT                   /locus_tag="ECSP_0679"
FT                   /product="carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70553"
FT                   /protein_id="ACT70553.1"
FT                   /translation="MLVAAGQFAVTSVWEKNAEICASLMAQAAENDVSLFVLPEALLAR
FT                   DDHDADLSVKSAQLLEGEFLGRLRRESKRNMMTTILTIHVPSTPGRAWNMLVALQAGNI
FT                   VARYAKLHLYDAFAIQESRRVDAGNEIAPLLEVEGMKVGLMTCYDLRFPELALAQALQG
FT                   AEILVLPAAWVRGPLKEHHWSTLLAARALDTTCYMVAAGECGNKNIGQSRIIDPFGVTI
FT                   AAASEMPALIMAEVTPERVRQVRAQLPVLNNRRFAPPQLL"
FT   gene            745171..745374
FT                   /gene="tatE"
FT                   /locus_tag="ECSP_0680"
FT   CDS_pept        745171..745374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatE"
FT                   /locus_tag="ECSP_0680"
FT                   /product="component of Sec-independent translocase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70554"
FT                   /protein_id="ACT70554.1"
FT                   /translation="MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMND
FT                   DDAAAKKGADVDLQAEKLSHKE"
FT   gene            complement(745475..746440)
FT                   /gene="lipA"
FT                   /locus_tag="ECSP_0681"
FT   CDS_pept        complement(745475..746440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="ECSP_0681"
FT                   /product="lipoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70555"
FT                   /protein_id="ACT70555.1"
FT                   /translation="MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKL
FT                   PADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVA
FT                   HGRPVAPDANEPVKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQI
FT                   KIETLVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFK
FT                   EAHPEIPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSP
FT                   DEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK"
FT   gene            complement(746649..747602)
FT                   /gene="ybeF"
FT                   /locus_tag="ECSP_0682"
FT   CDS_pept        complement(746649..747602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeF"
FT                   /locus_tag="ECSP_0682"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70556"
FT                   /protein_id="ACT70556.1"
FT                   /translation="MDSNNQIESCLSRKSSEGKPQIFTTLRNIDLNLLTIFEAVYVHKG
FT                   IVNAAKVLNLTPSAISQSIQKLRVIFPDPLFIRKGQGVTPTAFAMHLHEYISQGLESIL
FT                   GALDIEGSYDKQRTITIATTPSVGALVLPVIYRAIKTHYPQLLLRNPPISDAENQLSQF
FT                   QTDLIIDNMFCTNRTVQHHVLFTDNMVLICREGNPLLSLEDDRETIDNAAHVLLLPEGQ
FT                   NFSGLRQRIQEMFPDRQISFTSYNILTIAALVANSDMLAIIPSRFYNLFSRCWPLEKLP
FT                   FPSLNEEQIDFSIHYNKFSLRDPILHGVIDVIRNAF"
FT   gene            complement(747862..748503)
FT                   /gene="lipB"
FT                   /locus_tag="ECSP_0683"
FT   CDS_pept        complement(747862..748503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="ECSP_0683"
FT                   /product="lipoyl-protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70557"
FT                   /protein_id="ACT70557.1"
FT                   /translation="MYQDKILVRQLGLQPYEPISQAMHEFTDTRDDSTLDEIWLVEHYP
FT                   VFTQGQAGKAEHILMPGDIPVIQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRELVTL
FT                   LEQTVVNTLAELGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPF
FT                   LRINPCGYAGMEMAKISQWKPEATTNNIAPRLLENILALLNNPDFEYITA"
FT   gene            complement(748604..748867)
FT                   /gene="ybeD"
FT                   /locus_tag="ECSP_0684"
FT   CDS_pept        complement(748604..748867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeD"
FT                   /locus_tag="ECSP_0684"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70558"
FT                   /protein_id="ACT70558.1"
FT                   /translation="MKTKLNELLEFPTPFTYKVMGQALPELVDQVVEVVQRHAPGDYTP
FT                   TVKPSSKGNYHSVSITINATHIEQVETLYEELGKIDIVRMVL"
FT   gene            complement(748977..750188)
FT                   /gene="dacA"
FT                   /locus_tag="ECSP_0685"
FT   CDS_pept        complement(748977..750188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="ECSP_0685"
FT                   /product="D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 5)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70559"
FT                   /protein_id="ACT70559.1"
FT                   /translation="MNTIFSARIMKRLALTTALCTAFISAAHADDLNIKTMIPGVPQID
FT                   AESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDA
FT                   WATGNPVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMN
FT                   SYVNALGLKNTHFQTVHGLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGI
FT                   RQLNRNGLLWDNSLNVDGIKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAES
FT                   KKLLTWGFRFFETVNPLKVGKEFASEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKAS
FT                   YVLNSSELHAPLQKNQVVGTINFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFH
FT                   HWFG"
FT   gene            complement(750328..751416)
FT                   /gene="rlpA"
FT                   /locus_tag="ECSP_0686"
FT   CDS_pept        complement(750328..751416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="ECSP_0686"
FT                   /product="minor lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70560"
FT                   /protein_id="ACT70560.1"
FT                   /translation="MRKQWLGICIAAGMLAACTSDDGQQQTVSVPQPAVCNGPIVEISG
FT                   ADPRFEPLNATANQDYQRDGKSYKIVQDPSRFIQAGLAAIYDAEPGSNLTASGEAFDPT
FT                   QLTAAHPTLPIPSYARITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNNTK
FT                   VRIDPIIVAQDGSLSGPGMACTTVAKQTYALPAPPDLSGGAGTSSVSGPQGDILPVSNS
FT                   TLKSEDPTGAPVTSSGFLGAPTTLAPGVLEGSEPTPAPQPVVTAPSTTPATSPAMVTPQ
FT                   AASQSASGNFMVQVGAVSDQARAQQYQQQLGQKFGVPGRVTQNGAVWRIQLGPFANKAE
FT                   ASTLQQRLQTEAQLQSFITTAQ"
FT   gene            complement(751427..752539)
FT                   /gene="mrdB"
FT                   /locus_tag="ECSP_0687"
FT   CDS_pept        complement(751427..752539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="ECSP_0687"
FT                   /product="cell wall shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70561"
FT                   /protein_id="ACT70561.1"
FT                   /translation="MTDNPNKKTFWDKVHLDPTMLLILLALLVYSALVIWSASGQDIGM
FT                   MERKIGQIAMGLVIMVVMAQIPPRVYEGWAPYLYIICIILLVAVDAFGAISKGAQRWLD
FT                   LGIVRFQPSEIAKIAVPLMVARFINRDVCPPSLKNTGIALVLIFMPTLLVAAQPDLGTS
FT                   ILVALSGLFVLFLSGLSWRLIGVAVVLVAAFIPILWFFLMHDYQRQRVMMLLDPESDPL
FT                   GAGYHIIQSKIAIGSGGLRGKGWLHGTQSQLEFLPERHTDFIFAVLAEELGLVGILILL
FT                   ALYILLIMRGLWIAARAQTTFGRVMAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVS
FT                   YGGSALIVLMAGFGIVMSIHTHRKMLSKSV"
FT   gene            complement(752542..754443)
FT                   /gene="mrdA"
FT                   /locus_tag="ECSP_0688"
FT   CDS_pept        complement(752542..754443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="ECSP_0688"
FT                   /product="transpeptidase involved in peptidoglycan
FT                   synthesis (penicillin-binding protein 2)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70562"
FT                   /protein_id="ACT70562.1"
FT                   /translation="MKLQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIV
FT                   RFTDYQTRSNENRIKLVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDA
FT                   LRSVVDLTDDDIAAFRKERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKR
FT                   RYYPYGSALTHVIGYVSKINDKDVERLNNDGKLANYAATHDIGKLGIERYYEDVLHGQT
FT                   GYEEVEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVVVTDPRTG
FT                   GVLALVSTPSYDPNLFVDGISSKDYSALLNDPNTPLVNRATQGVYPPASTVKPYVAVSA
FT                   LSAGVITRNTTLFDPGWWQLPGSEKRYRDWKKWGHGRLNVTRSLEESADTFFYQVAYDM
FT                   GIDRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYW
FT                   TATPIQMSKALMILINDGIVKVPHLLMSTAEDGKQVPWVQPHEPPVGDIHSGYWELAKD
FT                   GMYGVANRPNGTAHKYFASAPYKIAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTA
FT                   FAPYNNPQVAVAMILENGGAGPAVGTLMRQILDHIMLGDNNTDLPAENPAVAAAEDH"
FT   gene            complement(754474..754941)
FT                   /gene="ybeA"
FT                   /locus_tag="ECSP_0689"
FT   CDS_pept        complement(754474..754941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeA"
FT                   /locus_tag="ECSP_0689"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70563"
FT                   /protein_id="ACT70563.1"
FT                   /translation="MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGG
FT                   PEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE"
FT   gene            complement(754945..755262)
FT                   /gene="ybeB"
FT                   /locus_tag="ECSP_0690"
FT   CDS_pept        complement(754945..755262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeB"
FT                   /locus_tag="ECSP_0690"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70564"
FT                   /protein_id="ACT70564.1"
FT                   /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSS
FT                   RHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLW
FT                   S"
FT   gene            complement(755522..756133)
FT                   /gene="cobC"
FT                   /locus_tag="ECSP_0691"
FT   CDS_pept        complement(755522..756133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobC"
FT                   /locus_tag="ECSP_0691"
FT                   /product="predicted alpha-ribazole-5'-P phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70565"
FT                   /protein_id="ACT70565.1"
FT                   /translation="MRLWLIRHGETQANVDGLYSGHAPTPLTARGIEQAQNLHTLLDDV
FT                   SFDLVLCSELERAQHTARLVLSDRQLPVHIIPELNEMFFGDWEMRHHRDLMQEDAENYS
FT                   AWCNDWQHAIPTNGEGFQAFSQRVERFIARLSEYQHYQNILIVSHQGVLSLLIARLIGM
FT                   PAESMWHFRVDQGCWSAIDINQKFATLRVLNSRAIGVENA"
FT   gene            complement(756157..756798)
FT                   /gene="nadD"
FT                   /locus_tag="ECSP_0692"
FT   CDS_pept        complement(756157..756798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="ECSP_0692"
FT                   /product="nicotinic acid mononucleotide
FT                   adenylyltransferase, NAD(P)-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70566"
FT                   /protein_id="ACT70566.1"
FT                   /translation="MKSLQALFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPH
FT                   RPQPEANSVQRKHMLELAIADKPLFTLDERELKRNAPSYTAQTLKEWRQEQGPDVPLAF
FT                   IIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPLEMAQPQYQQWLEDHLTHNPEDLHL
FT                   QPAGKIYLAETPWFNISATIIRERLQNGESCDDLLPEPVLTYINQQGLYR"
FT   gene            complement(756800..757831)
FT                   /gene="holA"
FT                   /locus_tag="ECSP_0693"
FT   CDS_pept        complement(756800..757831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="ECSP_0693"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70567"
FT                   /protein_id="ACT70567.1"
FT                   /translation="MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQ
FT                   GFEEHHTFSIDPNTDWNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTLTGLL
FT                   HDDLLLIVRGNKLSKAQENAAWFTALANRSVQVTCQTPEQAQLPRWVAARAKQLNLELD
FT                   DAANQVLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALL
FT                   MGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQN
FT                   RRGMMGEALNRLSQPQLRQAVQLLTRTELTLKQDYSQSVWAELEGLSLLLCHKPLADVF
FT                   IDG"
FT   gene            complement(757831..758412)
FT                   /gene="rlpB"
FT                   /locus_tag="ECSP_0694"
FT   CDS_pept        complement(757831..758412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpB"
FT                   /locus_tag="ECSP_0694"
FT                   /product="minor lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70568"
FT                   /protein_id="ACT70568.1"
FT                   /translation="MRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNG
FT                   PLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGAVSISQDTASVFRNGQTAEYQMVMTV
FT                   SASVLIPGRDIYPISTKVFRSFFDNPQMALAKDNEQEMIIKEMYDRAAEQLIRKLPSIR
FT                   AADIRSDEEQTSTTTDTPATPARVSTTLGN"
FT   gene            complement(758427..761009)
FT                   /gene="leuS"
FT                   /locus_tag="ECSP_0695"
FT   CDS_pept        complement(758427..761009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="ECSP_0695"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70569"
FT                   /protein_id="ACT70569.1"
FT                   /translation="MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPS
FT                   GRLHMGHVRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDN
FT                   IAYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQ
FT                   TVLANEQVIDGCCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRN
FT                   WIGRSEGVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAF
FT                   IDECRNTKVAEAEMATMEKKGVNTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPG
FT                   HDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAI
FT                   ADKLTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDV
FT                   VMDGITSPIKADPQWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPEYKEGMLDSEA
FT                   ANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFYY
FT                   VGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQVMVE
FT                   RYGADTVRLFMMFASPADMTLEWQESGVEGANRFLKRVWKLVYEHTAKGDVAALNVDAL
FT                   TEDQKALRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPTDGEQDRALMQEA
FT                   LLAVVRMLNPFTPHICFTLWQELKGEGDIDNAPWPVADEKAMVEDSTLVVVQVNGKVRA
FT                   KITVPVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVVG"
FT   gene            761245..761727
FT                   /gene="ybeL"
FT                   /locus_tag="ECSP_0696"
FT   CDS_pept        761245..761727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeL"
FT                   /locus_tag="ECSP_0696"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70570"
FT                   /protein_id="ACT70570.1"
FT                   /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTR
FT                   TEVDELTRAVRRDLEEFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREV
FT                   FQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP"
FT   gene            complement(761800..762774)
FT                   /pseudo
FT                   /locus_tag="ECSP_0697"
FT                   /note="gene disrupted by in-frame stop codon; sel1 repeat
FT                   protein"
FT   gene            762939..763646
FT                   /gene="ybeR"
FT                   /locus_tag="ECSP_0698"
FT   CDS_pept        762939..763646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="ECSP_0698"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70571"
FT                   /protein_id="ACT70571.1"
FT                   /translation="MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTRFFDLSSSW
FT                   GIDDRDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVAS
FT                   TAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYSNWRQYFA
FT                   GYTFGRQYWQSPEDDNLPLLREFLARKEYDDSGNDMFYQLFASDDAYYATLPWQPLADY
FT                   PTCPETLKDMSDL"
FT   gene            763643..765070
FT                   /gene="djlB"
FT                   /locus_tag="ECSP_0699"
FT   CDS_pept        763643..765070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlB"
FT                   /locus_tag="ECSP_0699"
FT                   /product="predicted chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70572"
FT                   /protein_id="ACT70572.1"
FT                   /translation="MKNCWKILNIEETTDVDIIRRAYLALLPSFHPETDPQGFKQLRQA
FT                   YEEALRIAQSPAKSVWQPEEYEVAEHEILLAFRALLASDSERFLPSAWQRFIQQLNYCS
FT                   MNEIDELRWSLCTIAMNTAHLSFECVVLLAERLRWLQEENVGEIDEEELESFLYAIAKG
FT                   NVFNFQIILHLPVAVQNDTIDFYQMFARIWSSHPEWLTLYLAQHRAVIIPDDAKLHRNL
FT                   LRWYSAGRLGIPELLDYARSWREAEPDNEDARYYEYAQRVYCGEGESLLAELCDYWHEY
FT                   PSTQADALMLQWCRQHRVDYYPLVVMMIEARELVNDQGKPLLYVPGDSARTRFHLYEIL
FT                   SDEKLSALGRSLVEMVLHKGCKPRISLTRDTEHTLWPLYLVAKQLVQASQPTEESLMPI
FT                   VSRLDAENRCPLEALIIRRLLIQAANFTEKQTVEPEPQPQPMPVDDGGPGCLGIIKIIF
FT                   YIFIFAGLIGKILHLFG"
FT   gene            complement(765080..765634)
FT                   /gene="ybeT"
FT                   /locus_tag="ECSP_0700"
FT   CDS_pept        complement(765080..765634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeT"
FT                   /locus_tag="ECSP_0700"
FT                   /product="conserved outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70573"
FT                   /protein_id="ACT70573.1"
FT                   /translation="MNKKLMYIFTIFIVAAITCISQPKKTTLRDKAMVNYAFDYLSSPG
FT                   SLPFTTAATELSAIHGHSTSQYRLGEFYLHGSDGKPLDYTQARYWYEQSAEQENPRAQS
FT                   KLGWIYLKGLGVKPDTRKAILWYKEAAEQGYAHAQYTLGLIYRNGSGINVNHYESQKWL
FT                   KLAAKQHYKNAERLLAGLPAH"
FT   gene            765736..766443
FT                   /gene="ybeU"
FT                   /locus_tag="ECSP_0701"
FT   CDS_pept        765736..766443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeU"
FT                   /locus_tag="ECSP_0701"
FT                   /product="predicted tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70574"
FT                   /protein_id="ACT70574.1"
FT                   /translation="MNKEEQYLLFALSAPMEILNQGCKPAHDSPKMYTGIKEFDLSSSW
FT                   GINNRDDLIQTIYQMTDDGHANDLAGLYLTWHRSSPEEWKALIAGGSERGLIYTQFVAQ
FT                   TAMCCGEGGIKAWDYVRMGFLSRVGVLNKWLTEDESLWLQSRVYERAHHYYHSWMHYFS
FT                   AYSLGRLYWQSSQCEDNASLREALTLYKYDSAGSRMFEELAAGSDRFYATLPWQPLTVQ
FT                   PECPVTLKDVSDL"
FT   gene            complement(767951..769621)
FT                   /gene="hscC"
FT                   /locus_tag="ECSP_0702"
FT   CDS_pept        complement(767951..769621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscC"
FT                   /locus_tag="ECSP_0702"
FT                   /product="Hsp70 family chaperone Hsc62, binds to RpoD and
FT                   inhibits transcription"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70575"
FT                   /protein_id="ACT70575.1"
FT                   /translation="MDNAELAIGIDLGTTNSLIAVWKDGAAQLIPNKFGEYLTPSIISM
FT                   DENNHILVGKPAVSRRTSHPDKTAALFKRAMGSNTNWRLGSDTFNAPELSSLVLRSLKE
FT                   DAEEFLQRPIKDVVISVPAYFSDEQRKHTRLAAELAGLNAVRLINEPTAAAMAYGLHTQ
FT                   QNTRSLVFDLGGGTFDVTVLEYATPVIEVHASAGDNFLGGEDFTHMLVDEVLKRADVAR
FT                   TTLNESELAALYACVEAAKCSNQSPIHIRWQYQDETRECEFYENELEDLWLPLLNRLRV
FT                   PIEQALRDARLKPSQIDSLVLVGGASQMPLVQRIAVRLFGKLPYQSYDPSTIVALGAAI
FT                   QAACRLRSEDIEEVILTDICPYSLGVEVNRQGVSGIFSPIIERNTTVPVSRVETYSTMH
FT                   PEQDSITVNVYQGENHKVKNNILVESFDVPLKRTGAYQSIDIRFSYDINGLLEVDVLLE
FT                   DGSVKSRVINHSPVTLSAQQIEESRTRLSALKIYPRDMLINRTFKAKLEELWARALGDE
FT                   REEIGRVITDFDAALQSNDMARVDEVRRQASVYLAIEIP"
FT   gene            complement(769705..770640)
FT                   /gene="rihA"
FT                   /locus_tag="ECSP_0703"
FT   CDS_pept        complement(769705..770640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rihA"
FT                   /locus_tag="ECSP_0703"
FT                   /product="ribonucleoside hydrolase 1"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70576"
FT                   /protein_id="ACT70576.1"
FT                   /translation="MALPILLDCDPGHDDAIAIVLALASPELDVKAITSSAGNQTPEKT
FT                   LRNVLRMLTLLNRTDIPVAGGAVKPLMRELIIADNVHGESGLDGPALPEPTFAPQNCTA
FT                   VELMAKTLRESAEPVTIVSTGPQTNVALLLNSHPELHSKIARIVIMGGAMGLGNWTPAA
FT                   EFNIYVDPEAAEIVFQSGIPVVMAGLDVTHKAQIHVEDTERFRAIGNPVSTIVAELLDF
FT                   FLEYHKDEKWGFVGAPLHDPCTIAWLLKPELFTTVERWVGVETQGKYTQGMTVVDYYYL
FT                   TGNKPNATVMVDVDRQGFVDLLADRLKFYA"
FT   gene            complement(770758..771483)
FT                   /gene="gltL"
FT                   /locus_tag="ECSP_0704"
FT   CDS_pept        complement(770758..771483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="ECSP_0704"
FT                   /product="glutamate and aspartate transporter subunit,
FT                   ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70577"
FT                   /protein_id="ACT70577.1"
FT                   /translation="MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVK
FT                   VLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDA
FT                   FFDDPKSDRAKDFLAKILH"
FT   gene            complement(771483..772157)
FT                   /gene="gltK"
FT                   /locus_tag="ECSP_0705"
FT   CDS_pept        complement(771483..772157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltK"
FT                   /locus_tag="ECSP_0705"
FT                   /product="glutamate and aspartate transporter subunit,
FT                   membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70578"
FT                   /protein_id="ACT70578.1"
FT                   /translation="MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMR
FT                   LSSFAPVAWFAKAYVNVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAF
FT                   SMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGI
FT                   VLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRR
FT                   TA"
FT   gene            complement(772157..772897)
FT                   /gene="gltJ"
FT                   /locus_tag="ECSP_0706"
FT   CDS_pept        complement(772157..772897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltJ"
FT                   /locus_tag="ECSP_0706"
FT                   /product="glutamate and aspartate transporter subunit,
FT                   membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70579"
FT                   /protein_id="ACT70579.1"
FT                   /translation="MSIDWNWGIFLQQAPFGNTTYLGWIWSGFQVTIALSICAWIIAFL
FT                   VGSFFGILRTVPNRFLSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAEL
FT                   DPNIQFFLSSMLCLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPN
FT                   AYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAAQASKLLDYSAHAWESFTAITLAYVFI
FT                   NAFIMLVMTLVERKVRLPGNMGGK"
FT   gene            complement(773067..773975)
FT                   /gene="gltI"
FT                   /locus_tag="ECSP_0707"
FT   CDS_pept        complement(773067..773975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltI"
FT                   /locus_tag="ECSP_0707"
FT                   /product="glutamate and aspartate transporter subunit,
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70580"
FT                   /protein_id="ACT70580.1"
FT                   /translation="MQLRKPATAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVG
FT                   HRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQN
FT                   GTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDIKDFADLKGKAVVVTSGTT
FT                   SEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNW
FT                   DIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNM
FT                   NFELSDEMKALFKEPNDKALN"
FT   gene            complement(774372..775910)
FT                   /gene="lnt"
FT                   /locus_tag="ECSP_0708"
FT   CDS_pept        complement(774372..775910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="ECSP_0708"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70581"
FT                   /protein_id="ACT70581.1"
FT                   /translation="MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIISLMGLQ
FT                   ALTFNRRPLQSAAIGFCWGFGLFGSGINWVYVSIATFGGMPGPVNIFLVVLLAAYLSLY
FT                   TGLFAGVLSRLWPKTTWLRVAIAAPALWQVTEFLRGWVLTGFPWLQFGYSQIDGPLKGL
FT                   APLMGVEAINFLLMMVSGLLALALVKRNWRPLVVAVVLFALPFPLRYIRWFTPQPEKTI
FT                   QVSMVQGDIPQSLKWDEGQLLNTLKIYYNATAPLMGKSSLIIWPESAITDLEINQQPFL
FT                   KALDGELRDKGSSLVTGIVDARLNKQNRYDTYNTIITLGKGAPYSYESADRYNKNHLVP
FT                   FGEFVPLESILRPLAPFFDLPMSSFSRGPYIQPPLSANGIELTAAICYEIILGEQVRDN
FT                   FRPDTDYLLTISNDAWFGKSIGPWQHFQMARMRALELARPLLRSTNNGITAVIGPQGEI
FT                   QAMIPQFTREVLTTNVTPTTGLTPYARTGNWPLWVLTALFGFAAVLMSLRQRRK"
FT   gene            complement(775935..776813)
FT                   /gene="corC"
FT                   /locus_tag="ECSP_0709"
FT   CDS_pept        complement(775935..776813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corC"
FT                   /locus_tag="ECSP_0709"
FT                   /product="predicted ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70582"
FT                   /protein_id="ACT70582.1"
FT                   /translation="MSDDNSHSSDTISNKKGFFSLLLSQLFHGEPKNRDELLALIRDSG
FT                   QNDLIDEDTRDMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFP
FT                   VISEDKDHIEGILMAKDLLPFMRSDAEAFSMDKVLRQAVVVPESKRVDRMLKEFRSQRY
FT                   HMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIED
FT                   FNEAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVKI
FT                   PDDSPQPKLDE"
FT   gene            complement(776903..777370)
FT                   /gene="ybeY"
FT                   /locus_tag="ECSP_0710"
FT   CDS_pept        complement(776903..777370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeY"
FT                   /locus_tag="ECSP_0710"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70583"
FT                   /protein_id="ACT70583.1"
FT                   /translation="MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRV
FT                   VDTAESHSLNLTYRGKDKPTNVLSFPFEVPPGMEMSLLGDLVICRQMVEKEAQEQGKPL
FT                   EAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYEDPYIAEKE"
FT   gene            complement(777367..778407)
FT                   /gene="ybeZ"
FT                   /locus_tag="ECSP_0711"
FT   CDS_pept        complement(777367..778407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="ECSP_0711"
FT                   /product="predicted protein with nucleoside triphosphate
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70584"
FT                   /protein_id="ACT70584.1"
FT                   /translation="MNIDTREITLEPADNARLLSLCGPFDDNIKQLERRLGIEINRRDN
FT                   HFKLTGRPICVTAAADILRSLYVDTAPMRGQIQDIEPEQIHLAIKEARVLEQSAESVPE
FT                   YGKAVNIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTGKTYLAVAAAVDALERQ
FT                   EIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLIERNVIE
FT                   VAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVITGDVTQIDLPRNTK
FT                   SGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYEAWEEAEQKRKAALAAERKR
FT                   EEQEQK"
FT   gene            complement(778560..779984)
FT                   /gene="miaB"
FT                   /locus_tag="ECSP_0712"
FT   CDS_pept        complement(778560..779984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="ECSP_0712"
FT                   /product="isopentenyl-adenosine A37 tRNA methylthiolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70585"
FT                   /protein_id="ACT70585.1"
FT                   /translation="MTKKLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLL
FT                   LNTCSIREKAQEKVFHQLGRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFG
FT                   PQTLHRLPEMINSVRGDRSPVVDISFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKYCTY
FT                   CVVPYTRGEEVSRPSDDILFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLL
FT                   RLVAAIDGIDRIRFTTSHPIEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTH
FT                   TALEYKAIIRKLRAARPDIQISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSA
FT                   RPGTPAADMVDDVPEEEKKQRLYILQERINQQAMAWSRRMLGTTQRILVEGTSRKSIME
FT                   LSGRTENNRVVNFEGTPDMIGKFVDVEITDVYPNSLRGKVVRTEDEMGLRVAETPESVI
FT                   ARTRKENDLGVGYYQP"
FT   gene            780130..781305
FT                   /gene="ubiF"
FT                   /locus_tag="ECSP_0713"
FT   CDS_pept        780130..781305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiF"
FT                   /locus_tag="ECSP_0713"
FT                   /product="2-octoprenyl-3-methyl-6-methoxy-1,4-benzoquinone
FT                   hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70586"
FT                   /protein_id="ACT70586.1"
FT                   /translation="MTNQPTEIAIVGGGMVGGALALGLAQHGFTVTVIEHAEPAPFVAD
FT                   SQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPL
FT                   LGYMVENTVLQQALWQALEAHPKVTLRVPTSLIALHRDNDLQELELKGGEVIRAKLVIG
FT                   ADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNW
FT                   ASLVWYDSPARIRQLQNMNMAQLQVEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQP
FT                   GLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRRMA
FT                   DNFIMQSGMDLFYAGFSNNLPPLRFVRNLGLMAAERAGVLKRQALKYALGL"
FT   gene            complement(781459..781533)
FT                   /locus_tag="ECSP_0714"
FT   tRNA            complement(781459..781533)
FT                   /locus_tag="ECSP_0714"
FT                   /product="tRNA-Gln"
FT                   /note="anticodon: CTG"
FT   gene            complement(781571..781645)
FT                   /locus_tag="ECSP_0715"
FT   tRNA            complement(781571..781645)
FT                   /locus_tag="ECSP_0715"
FT                   /product="tRNA-Gln"
FT                   /note="anticodon: CTG"
FT   gene            complement(781694..781770)
FT                   /locus_tag="ECSP_0716"
FT   tRNA            complement(781694..781770)
FT                   /locus_tag="ECSP_0716"
FT                   /product="tRNA-Met"
FT                   /note="anticodon: CAT"
FT   gene            complement(781786..781860)
FT                   /locus_tag="ECSP_0717"
FT   tRNA            complement(781786..781860)
FT                   /locus_tag="ECSP_0717"
FT                   /product="tRNA-Gln"
FT                   /note="anticodon: TTG"
FT   gene            complement(781895..781969)
FT                   /locus_tag="ECSP_0718"
FT   tRNA            complement(781895..781969)
FT                   /locus_tag="ECSP_0718"
FT                   /product="tRNA-Gln"
FT                   /note="anticodon: TTG"
FT   gene            complement(781993..782077)
FT                   /locus_tag="ECSP_0719"
FT   tRNA            complement(781993..782077)
FT                   /locus_tag="ECSP_0719"
FT                   /product="tRNA-Leu"
FT                   /note="anticodon: TAG"
FT   gene            complement(782088..782164)
FT                   /locus_tag="ECSP_0720"
FT   tRNA            complement(782088..782164)
FT                   /locus_tag="ECSP_0720"
FT                   /product="tRNA-Met"
FT                   /note="anticodon: CAT"
FT   gene            complement(782544..784208)
FT                   /gene="asnB"
FT                   /locus_tag="ECSP_0721"
FT   CDS_pept        complement(782544..784208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="ECSP_0721"
FT                   /product="asparagine synthetase B"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70587"
FT                   /protein_id="ACT70587.1"
FT                   /translation="MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDKAI
FT                   LAHERLSIVDVNAGAQPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVIL
FT                   ALYQEKGPEFLDDLQGMFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMK
FT                   ALVPVCRTIKEFPAGSYLWSQDGEIRSYYHRDWFDFDAVKDNVTDKNELRQALEDSVKS
FT                   HLMSDVPYGVLLSGGLDSSIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDL
FT                   KAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAM
FT                   GIKMVLSGEGSDEVFGGYLYFHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVE
FT                   ARVPFLDKKFLDVAMRINPQDKMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVG
FT                   YSWIDTLKEVAAQQVSDQQLETARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPG
FT                   GPSVACSSAKAIEWDEAFKKMDDPSGRAVGVHQSAYK"
FT   gene            complement(784465..785217)
FT                   /gene="nagD"
FT                   /locus_tag="ECSP_0722"
FT   CDS_pept        complement(784465..785217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagD"
FT                   /locus_tag="ECSP_0722"
FT                   /product="UMP phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70588"
FT                   /protein_id="ACT70588.1"
FT                   /translation="MTIKNVICDIDGVLMHDNVAVPGAAEFLHGIMDKGLPLVLLTNYP
FT                   SQTGQDLANRFATAGVDVPDSVFYTSAMATADFLRRQEGKKAYVVGEGALIHELYKAGF
FT                   TITDVNPDFVIVGETRSYNWDMMHKAAYFVANGARFIATNPDTHGRGFYPACGALCAGI
FT                   EKISGRKPFYVGKPSPWIIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLS
FT                   GVSSLDDIDSMPFRPSWIYPSVAEIDVI"
FT   gene            complement(785265..786485)
FT                   /gene="nagC"
FT                   /locus_tag="ECSP_0723"
FT   CDS_pept        complement(785265..786485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagC"
FT                   /locus_tag="ECSP_0723"
FT                   /product="DNA-binding transcriptional dual regulator,
FT                   repressor of N-acetylglucosamine"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70589"
FT                   /protein_id="ACT70589.1"
FT                   /translation="MTPGGQAQIGNVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLA
FT                   PASVTKITRQLIERGLIKEVDQQASTGGRRAISIVTETRNFHAIGVRLGRHDATITLFD
FT                   LSSKVLAEEHYPLPERTQQTLEHALLNAIAQFIDSYQRKLRELIAISVILPGLVDPDSG
FT                   KIHYMPHIQVENWGLVEALEERFKVTCFVGHDIRSLALAEHYFGASQDCEDSILVRVHR
FT                   GTGAGIISNGRIFIGRNGNVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQRVLNL
FT                   LKQGYQSRVPLDDCTIKTICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVI
FT                   AGEITEADKVLLPAIESCINTQALKAFRTNLPVVRSELDHRSAIGAFALVKRAMLNGIL
FT                   LQHLLEN"
FT   gene            complement(786494..787642)
FT                   /gene="nagA"
FT                   /locus_tag="ECSP_0724"
FT   CDS_pept        complement(786494..787642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="ECSP_0724"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70590"
FT                   /protein_id="ACT70590.1"
FT                   /translation="MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRS
FT                   LNGAILSPGFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSD
FT                   ELMKQGVRVMREYLAKHPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENA
FT                   DVITKVTLAPEMVPAEVISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMP
FT                   YITGREPGLAGAILDEADIYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGAN
FT                   IEQFIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPA
FT                   RAIGVEKRLGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ"
FT   gene            complement(787702..788502)
FT                   /gene="nagB"
FT                   /locus_tag="ECSP_0725"
FT   CDS_pept        complement(787702..788502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="ECSP_0725"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70591"
FT                   /protein_id="ACT70591.1"
FT                   /translation="MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTP
FT                   MTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENI
FT                   NLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLT
FT                   HDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNH
FT                   MWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL"
FT   gene            788835..790781
FT                   /gene="nagE"
FT                   /locus_tag="ECSP_0726"
FT   CDS_pept        788835..790781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="ECSP_0726"
FT                   /product="fused N-acetyl glucosamine specific PTS enzyme:
FT                   IIC, IIB , and IIA components"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70592"
FT                   /protein_id="ACT70592.1"
FT                   /translation="MNILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVAFIAQAG
FT                   GAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVLTKAMVTINPEINMGVLAGIIT
FT                   GLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGG
FT                   EWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDINRFYAG
FT                   DGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLE
FT                   FLFMFLAPLLYLLHALLTGISLFVATLLGIHAGFSFSAGAIDYALMYNLPAASQNVWML
FT                   LVMGVVFFAIYFVVFSLVIRMFNLKTPGREDKEDEIVTEEANSNTEEGLNQLATNYIAA
FT                   VGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESI
FT                   GDAMKKVVARGPVAAASAEATPATAAPVAKPQAVPNAVSIAELVSPITGDVVALDQVPD
FT                   EAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVA
FT                   LEGKGFKRLVEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSNIDDFSGLIIKAQGH
FT                   VVAGQTPLYEIKK"
FT   gene            790984..792648
FT                   /gene="glnS"
FT                   /locus_tag="ECSP_0727"
FT   CDS_pept        790984..792648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="ECSP_0727"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70593"
FT                   /protein_id="ACT70593.1"
FT                   /translation="MSEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHA
FT                   KSICLNFGIAQDYKGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHWSGNVRYSSDYF
FT                   DQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRT
FT                   GGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDAL
FT                   EGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDK
FT                   HVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENA
FT                   PRAMAVIDPVKLVIENYQGEGEMVTMPNHPNKPEMGSRQVPFSGEIWIDRSDFREEANK
FT                   QYKRLVLGKEVRLRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIH
FT                   WVSAAHALPVEIRLYDRLFSVPNPGAADDFLSVINPESLVIKQGFAEPSLKDAVAGKAF
FT                   QFEREGYFCLDSRHSTAEKPVFNRTVGLRDTWAKVGE"
FT   gene            complement(792721..792915)
FT                   /locus_tag="ECSP_0728"
FT   CDS_pept        complement(792721..792915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70594"
FT                   /protein_id="ACT70594.1"
FT                   /translation="MDKLRSGINSRRKAEKTPLNAAFWIVCIFLAGCGVNALSGLQKHA
FT                   NSIYCRDHVGLISVAHQAI"
FT   gene            793227..794629
FT                   /pseudo
FT                   /locus_tag="ECSP_0729"
FT                   /note="hypothetical protein; hypothetical protein"
FT   gene            794682..795008
FT                   /gene="ybfN"
FT                   /locus_tag="ECSP_0730"
FT   CDS_pept        794682..795008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfN"
FT                   /locus_tag="ECSP_0730"
FT                   /product="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70595"
FT                   /protein_id="ACT70595.1"
FT                   /translation="MKKLILIAMMASGLVACAQSTAPQEDSRLKEAYSACINTAQGSPE
FT                   KIEACQSVLNVLKKEKQHQQFADQESVRVLDYQQCLRATQTGNDQAVKADCDKVWQEIR
FT                   SNNK"
FT   gene            complement(795092..795538)
FT                   /gene="fur"
FT                   /locus_tag="ECSP_0731"
FT   CDS_pept        complement(795092..795538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="ECSP_0731"
FT                   /product="DNA-binding transcriptional dual regulator of
FT                   siderophore biosynthesis and transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70596"
FT                   /protein_id="ACT70596.1"
FT                   /translation="MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLID
FT                   MGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSD
FT                   DSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK"
FT   gene            complement(795827..796357)
FT                   /gene="fldA"
FT                   /locus_tag="ECSP_0732"
FT   CDS_pept        complement(795827..796357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldA"
FT                   /locus_tag="ECSP_0732"
FT                   /product="flavodoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70597"
FT                   /protein_id="ACT70597.1"
FT                   /translation="MAITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLE
FT                   AYDILLLGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCDALGT
FT                   IRDIIEPRGATIVGHWPTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQ
FT                   ISEELHLDEILNA"
FT   gene            complement(796497..796790)
FT                   /gene="ybfE"
FT                   /locus_tag="ECSP_0733"
FT   CDS_pept        complement(796497..796790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="ECSP_0733"
FT                   /product="LexA regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70598"
FT                   /protein_id="ACT70598.1"
FT                   /translation="MAKEQTDRTTLDLFAHERRPGRPKTNPLSRDEQLRINKRNQLKRD
FT                   KVRGLKRVELKLNAEAVEALNELAESRNMSRSELIEEMLMQQLAALRSQGIV"
FT   gene            complement(796930..797694)
FT                   /gene="ybfF"
FT                   /locus_tag="ECSP_0734"
FT   CDS_pept        complement(796930..797694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfF"
FT                   /locus_tag="ECSP_0734"
FT                   /product="esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70599"
FT                   /protein_id="ACT70599.1"
FT                   /translation="MKLNIRAQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVNDHNI
FT                   IQVDMRNHGLSPRDPVMNYPAMAQDLVDTLDAQQIDKATFIAHSMGGKAVMALTALAPD
FT                   RIDKLVAIDIAPVDYHVRRHDEIFSAINAVSESDAQTRQQAAAIMRQHLNEEGVIQFLL
FT                   KSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALFIPGGNSPYVSEQYRDDLLAQFP
FT                   QARAHVIAGAGHWVHAEKPDAVLRAIRRYLND"
FT   gene            797879..798424
FT                   /gene="seqA"
FT                   /locus_tag="ECSP_0735"
FT   CDS_pept        797879..798424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="seqA"
FT                   /locus_tag="ECSP_0735"
FT                   /product="regulatory protein for replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70600"
FT                   /protein_id="ACT70600.1"
FT                   /translation="MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAASQPAAPV
FT                   TKEVRVASPAIVEAKPIKTIKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQ
FT                   AFAEATESLHGRTRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHI
FT                   MQSMQFPAELIEKVCGTI"
FT   gene            798450..800090
FT                   /gene="pgm"
FT                   /locus_tag="ECSP_0736"
FT   CDS_pept        798450..800090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="ECSP_0736"
FT                   /product="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70601"
FT                   /protein_id="ACT70601.1"
FT                   /translation="MAIHNRAGQPAQQSDLINVAQLTAQYYVLKPEAGNAEHAVKFGTS
FT                   GHRGSAARHSFNEPHILAIAQAIAEERAKNGITGPCYVGKDTHALSEPAFISVLEVLAA
FT                   NGVDVIVQENNGFTPTPAVSNAILVHNKKGGPLADGIVITPSHNPPEDGGIKYNPPNGG
FT                   PADTNVTKVVEDRANALMADGLKGVKRISLDEAMASGHVKEQDLVQPFVEGLADIVDMA
FT                   AIQKAGLTLGVDPLGGSGIEYWKRIGEYYNLNLTIVNDQVDQTFRFMHLDKDGAIRMDC
FT                   SSECAMAGLLALRDKFDLAFANDPDYDRHGIVTPAGLMNPNHYLAVAINYLFQHRPQWG
FT                   KAVAVGKTLVSSAMIDRVVNDLGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASFLR
FT                   FDGTPWSTDKDGIIMCLLAAEITAVTGKNPQEHYNELAKRFGAPSYNRLQAAATSAQKA
FT                   ALSKLSPEMVSASTLAGDPITARLTAAPGNGASIGGLKVMTDNGWFAARPSGTEDAYKI
FT                   YCESFLGEEHRKQIEKEAVEIVSEVLKNA"
FT   gene            complement(800147..801466)
FT                   /gene="potE"
FT                   /locus_tag="ECSP_0737"
FT   CDS_pept        complement(800147..801466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potE"
FT                   /locus_tag="ECSP_0737"
FT                   /product="putrescine/proton symporter: putrescine/ornithine
FT                   antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70602"
FT                   /protein_id="ACT70602.1"
FT                   /translation="MSQAKSNKMGVVQLTILTMVNMMGSGIIMLPTKLAEVGTISIISW
FT                   LVTAVGSMALAWAFAKCGMFSRKSGGMGGYAEYAFGKSGNFMANYTYGVSLLIANVAIA
FT                   ISAVGYGTELLGASLSPVQIGLATIGVLWICTVANFGGARITGQISSITVWGVIIPVVG
FT                   LCIIGWFWFSPTLYVDSWNPHHAPFFSAVGSSIAMTLWAFLGLESACANTDVVENPERN
FT                   VPIAVLGGTLGAAVIYIVSTNVIAGIVPNMELANSTAPFGLAFAQMFTPEVGKVIMALM
FT                   VMSCCGSLLGWQFTIAQVFKSSSDEGYFPKIFSHVTKVDAPVQGMLTIVIIQSGLALMT
FT                   ISPSLNSQFNVLVNLAVVTNIIPYILSMAALVIIQKVANVPPSKAKVANFVAFVGAMYS
FT                   FYALYSSGEEAMLYGSIVTFLGWTLYGLVSPRFELKNKHG"
FT   gene            complement(801463..803670)
FT                   /gene="speF"
FT                   /locus_tag="ECSP_0738"
FT   CDS_pept        complement(801463..803670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speF"
FT                   /locus_tag="ECSP_0738"
FT                   /product="ornithine decarboxylase isozyme, inducible"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70603"
FT                   /protein_id="ACT70603.1"
FT                   /translation="MNKMSELKIAVSRSCPDCFSTHRACVNIDESNYIDVAAIILSVSD
FT                   VERGKLDEIDATGYDIPVFIATENEERIPAEYLSRISGVFEHGEARKEFYGRQLETAAS
FT                   HYETQLRPPFFRALVDYVNQGNSAFDCPGHQGGEFFRRHPAGNQFVEYFGEALFRADLC
FT                   NADVAMGDLLIHEGAPCIAQQHAAKVFNADKTYFVLNGTSSSNKVVLNALLTPGDLVLF
FT                   DRNNHKSNHHGALLQAGATPVYLETARNPYGFIGGIDAHCFEESYLRELITEVAPQRAK
FT                   EARPFRLAVIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMADCSPLL
FT                   LDLNENDPGILVTQSVHKQQAGFSQTSQIHKKDSHIKGQQRYVPHKRMNNAFMMHASTS
FT                   PFYPLFAALDINAKMHEGVSGRNMWMDCVVNGINARKLILDNCQHIRPFIPELVDGKPW
FT                   QSYETAQIAVDLRFFQFVPGEHWHSFEGYAENQYFVDPCKLLLTTPGIDARNGEYEAFG
FT                   VPATILANFLRENGVVPEKCDLNSILFLLTPAEDMAKLQQLVALLVRFEKLLESDAPLA
FT                   EVLPSIYKQHEERYAGYTLRQLCQEMHDLYARHNVKQLQKEMFRKEHFPRVSMNPQEAN
FT                   YAYLRGEVELVRLPDAEGRIAAEGALPYPPGVLCVVPGEIWGGAVLRYFSALEEGINLL
FT                   PGFAPELQGVYIEEHDGRKQVWCYVIKPRDAQSTLLKGEKL"
FT   gene            complement(804055..804189)
FT                   /locus_tag="ECSP_0739"
FT   CDS_pept        complement(804055..804189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0739"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70604"
FT                   /protein_id="ACT70604.1"
FT                   /translation="MIYYLGYDRFLLIFFTDYSHFMDRITLPSTDTARGKGKWKIITA"
FT   gene            complement(804351..805028)
FT                   /gene="kdpE"
FT                   /locus_tag="ECSP_0740"
FT   CDS_pept        complement(804351..805028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="ECSP_0740"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system with KdpD"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70605"
FT                   /protein_id="ACT70605.1"
FT                   /translation="MTNVLIVEDEQAIRRFLRTALEGDGMRVYEAETLQRGLLEAATRK
FT                   PDLIILDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFG
FT                   IGELQARLRVALRRHSATAAPDPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVL
FT                   LNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPSHFITETGIGYR
FT                   FML"
FT   gene            complement(805025..807709)
FT                   /gene="kdpD"
FT                   /locus_tag="ECSP_0741"
FT   CDS_pept        complement(805025..807709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="ECSP_0741"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with KdpE"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70606"
FT                   /protein_id="ACT70606.1"
FT                   /translation="MNNEPLRPDPDRLLEQTAAPHRGKLKVFFGACAGVGKTWAMLAEA
FT                   QRLRAQGLDIVVGVVETHGRKDTAAMLEGLAVLPPKRLAYRGRHISEFDLDAALARRPA
FT                   LILMDELAHSNAPGSRHPKRWQDIEELLEAGIDVFTTVNVQHLESLNDVVSGVTGIQVR
FT                   ETVPDPFFDAADDVVLVDLPPDDLRQRLKEGKVYIAGQAERAIEHFFRKGNLIALRKLA
FT                   LRRTADRVDEQMRAWRGHPGEEKVWHTRDAILLCIGHNTGSEKLVRAAARLASRLGSVW
FT                   HAVYVETPALHRLPEKKRRAILSALRLAQELGAETATLSDPAEEKAVVRYAREHNLGKI
FT                   ILGRPASRRWWRRETFADRLARIAPDLDQVLVALDEPPARTINNAPDSRSFKDKWRVQI
FT                   QGCVVAAALCAVITLIAMQWLMAFDAANLVMLYLLGVVVVALFYGRWPSVVATVINVVS
FT                   FDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQARVARYREQRTRHLYE
FT                   MSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQ
FT                   WSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFT
FT                   LLVANALERLTLTASEEQARMASEREQIRNALLAALSHDLRTPLTVLFGQAEILTLDLA
FT                   SEGSPHARQASEIRQHVLNTTRLVNNLLDMARIQSGGFNLKKEWLTLEEVVGSALQMLE
FT                   PGLSSPINLSLPEPLTLIHVDGPLFERVLINLLENAVKYAGAQAEIGIDAHVEGENLQL
FT                   DVWDNGPGLPPGQEQTIFDKFARGNKESAVPGVGLGLAICRAIVDVHGGTITAFNRPEG
FT                   GACFRVTLPQQTAPELEEFHEDM"
FT   gene            complement(807702..808274)
FT                   /gene="kdpC"
FT                   /locus_tag="ECSP_0742"
FT   CDS_pept        complement(807702..808274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="ECSP_0742"
FT                   /product="potassium translocating ATPase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70607"
FT                   /protein_id="ACT70607.1"
FT                   /translation="MRGLRPALSTFIFLLLITGGVYPLLTTALGQWWFPWQANGSLIRE
FT                   GDTVRGSALIGQNFTDNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAA
FT                   LRAANPNASTSVPVELVTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYS
FT                   QQPLVKYIGQPVVNIVELNLALDKLDE"
FT   gene            complement(808283..810331)
FT                   /gene="kdpB"
FT                   /locus_tag="ECSP_0743"
FT   CDS_pept        complement(808283..810331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="ECSP_0743"
FT                   /product="potassium translocating ATPase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70608"
FT                   /protein_id="ACT70608.1"
FT                   /translation="MSRKQLALFEPTLVVQALKEAVKKLNPQAQWRNPVMFIVWIGSLL
FT                   TTCISIAMASGAMPGNALFSVAISGWLWVTVLFANFAEALAEGRSKAQANSLKGVKKTA
FT                   FARKLREPKYGAAADKVPADQLRKGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESA
FT                   PVIRESGGDFASVTGGTRILSDWLVIECSVNPGETFLDRMIAMVEGAQRRKTPNEIALT
FT                   ILLIALTIVFLLATATLWPFSAWGGNAVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSR
FT                   MLGANVVATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTLADAAQLA
FT                   SLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVD
FT                   AIRRHVEANGGHFPADVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFA
FT                   QLRKMGIKTVMITGDNRLTAAAIAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTG
FT                   DGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLT
FT                   TFSIANDVAKYFAIIPAAFAVTYPQLNALNIMRLHSPDSAILSAVIFNALIIVFLIPLA
FT                   LKGVSYKPLTASAMLRRNLWIYGLGGLLVPFIGIKVIDLLLTVCGLV"
FT   gene            complement(810354..812027)
FT                   /gene="kdpA"
FT                   /locus_tag="ECSP_0744"
FT   CDS_pept        complement(810354..812027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="ECSP_0744"
FT                   /product="P-type ATPase, high-affinity potassium transport
FT                   system, A chain"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70609"
FT                   /protein_id="ACT70609.1"
FT                   /translation="MAAQGFLLIATFLLVLMVLARPLGSGLAWLINDIPLPGTTGVERV
FT                   LFSALGVSNHEMNWKQYLCAILGLNMLGLAVLFFMLLGQHYLPLNPQQLPGLSWDLALN
FT                   TAVSFVTNTNWQSYSGETTLSYFSQMAGLTVQNFLSAASGIAVIFALIRAFTRQSMSTL
FT                   GNAWVDLLRITLWVLVPVALVIALFFIQQGALQNFLPYQAVNTVEGAQQLLPMGPVASQ
FT                   EAIKMLGTNGGGFFNANSSHPFENPTALTNFVQMLAIFLIPTALCFAFGEVTGDRRQGR
FT                   MLLWAMSVIFVICVGVVMWAEVQGNPHLLALGADSSINMEGKESRFGVLVSSLFAVVTT
FT                   AASCGAVIAMHDSFTALGGMVPMWLMQIGEVVFGGVGSGLYGMMLFVLLAVFIAGLMIG
FT                   RTPEYLGKKIDVREMKLTALAILVTPTLVLMGAALAMMTDAGRSAMLNPGPHGFSEVLY
FT                   AVSSAANNNGSAFAGLSANSPFWNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKSQPASS
FT                   GTLPTHGPLFVGLLIGTVLLVGALTFIPALALGPVAEYLS"
FT   gene            812429..812635
FT                   /gene="ybfA"
FT                   /locus_tag="ECSP_0745"
FT   CDS_pept        812429..812635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="ECSP_0745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70610"
FT                   /protein_id="ACT70610.1"
FT                   /translation="MELYREYPAWLIFLRRTYAVAAGVLALPFMLFWKDRARFYSYLHR
FT                   VWSKTSDKPVWMDQAEKATGDFY"
FT   gene            812875..817074
FT                   /gene="ybfO"
FT                   /locus_tag="ECSP_0746"
FT   CDS_pept        812875..817074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfO"
FT                   /locus_tag="ECSP_0746"
FT                   /product="conserved protein, rhs-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70611"
FT                   /protein_id="ACT70611.1"
FT                   /translation="MSGKPAARQGDMTQYGGSIVQGSAGVRIGAPTGVACSVCPGGVTS
FT                   GHPVNPLLGAKVLPGETDIALPGPLPFILSRTYSSYRTKTPAPVGSLGPGWKMPADIRL
FT                   QLRDNTLILSDNGGRSLYFEHLFPGEDGYSRSESLWLVRGGVAKLDEGHRLAALWQALP
FT                   EELRLSPHRYLATNSPQGPWWLLGWCERVPEADEVLPAPLPPYRVLTGLVDRFGRTQTF
FT                   HREAAGEFSGEITGVTDGAGRHFRLVLTTQAQRAEEARQQAISGGTEPSAFPDTLPGYT
FT                   EYGRDNGIRLSAVWLTHDPEYPENLPAAPLVRYGWTPRGELAVVYDRSGKQVRSFTYDD
FT                   KYRGRMVAHRHTGRPEIRYRYDSDGRVTEQLNPAGLSYTYQYEKDRITITDSLNRREVL
FT                   HTQGEGGLKRVVKKEHADGSVTQSQFDAVGRLRAQTDAAGRTTEYSPDVVTGLITRITT
FT                   PDGRASAFYYNHHSQLTSATGPDGLEIRREYDEWGRLIQETAPDGDITRYRYDNPHSDL
FT                   PCATEDATGSRKTMTWSRYGQLLSFTDCSGYVTRYDHDRFGQMTAVHCEEGLSQYRAYD
FT                   SRGQLIAVKDTQGHETRYEYNAAGDLTTVIAPDGSRNGTQYDAWGKAICTTQGGLTRSM
FT                   EYDAAGRVIRLTSENGSHTTFRYDVLDRLIQETGFDGRTQRYHHDLTGKLIRSEDEGLV
FT                   THWHYDEADRLTHRTVKGETAERWQYDERGWLTDISHISEGHRVTVHYGYDEKGRLTGE
FT                   RQTVHHPQTEALLWQHETRHAYNAQGLANRCIPDSLPAVEWLTYGSGWLAGMKLGDTPL
FT                   VDFTRDRLHRKTLRRFGRYELTTAYTPAGQLQSQHLNSLQYDRDYTWNDNGELIRISSP
FT                   RQTRSYSYSDSGRLTGVHTTAANLDIRIPYATDPAGNRLPDPELHPDSTLSMWPDNRIA
FT                   RDAHYLYRYDRHGRLTEKTDLIPEGVIRTDDERTHRYHYDSQHRLVHYTRTQYEEPLVE
FT                   SRYLYDPLGRRVAKRVWRRERDLTGWMSLSRKPQVTWYGWDGDRLTTIQNDRTRIQTIY
FT                   QPGSFTPLIRVETATGELAKTQRRSLADALQQSGGEDGGSVVFPPVLVQMLDRLESEIL
FT                   ADRVSEESRRWLASCGLTVAQMQSQMDPVYTPARKIHLYHCDHRGLPLALISKEGATEW
FT                   CAEYDEWGNLLNEENPHQLQQLIRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIGL
FT                   KGGWNFYQYPLNPVQYIDSMGLASKYGHLNNGGYGARPNKPPTPDPSKFPDIAKQLRLP
FT                   YPIDQASSAPNVFKTFFRALSPYDYTLYCRKWVKPNLTCTPQDDPQYPGMDTKTASDYL
FT                   PQTNWPTTQLPPGYTCAEPYLFPDINKPDGPATAGIDDLGEILAKMKQRTSRGIRK"
FT   gene            817098..817640
FT                   /gene="ybfC"
FT                   /locus_tag="ECSP_0747"
FT   CDS_pept        817098..817640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfC"
FT                   /locus_tag="ECSP_0747"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70612"
FT                   /protein_id="ACT70612.1"
FT                   /translation="MIFVSFGVIADCEIQAKDHDCFTIFAKGTIFSAFPVLNNKAMWRW
FT                   YQNEDIGEYYWQTELGTCKNNKFTPSGARLLIRVGSLRLNENHAIKGTLQELINTAEKT
FT                   AFLGDRFRSYIRAGIYQKKSSDPAQLLAVLDNSIMVKYFKDEKPTYARMTAHLPNKDES
FT                   YECLTKIQHELLRSEEK"
FT   mobile_element  819083..820373
FT                   /mobile_element_type="insertion sequence:ISEc1"
FT   gene            819227..820363
FT                   /locus_tag="ECSP_0748"
FT   CDS_pept        819227..820363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0748"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70613"
FT                   /protein_id="ACT70613.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLIICAVISGAEGWE
FT                   DIEDFGETHLDFLKQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAPPELLNILD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCEVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPKMTV
FT                   RYYISSADLTAGKFATAIRNHWHVENKLHWRLDVVMNKDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS"
FT   gene            820512..821021
FT                   /gene="ybgA"
FT                   /locus_tag="ECSP_0749"
FT   CDS_pept        820512..821021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="ECSP_0749"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70614"
FT                   /protein_id="ACT70614.1"
FT                   /translation="MNQQRFDDSTLIRIFALHELHRLKEHGLTRGALLDYHSRYKLVFL
FT                   AHSQPEYRKLGPFVADIHQWQNLDDFYNQYRQRVIVLLSHPANPRDHTNVLMHVQGYFR
FT                   PHIESTERQQLAALIDSYRRGEQPLLAPLMRIKHYMALYPYAWLSGQRYFELWPRVINL
FT                   RHSGVL"
FT   gene            821018..822436
FT                   /gene="phr"
FT                   /locus_tag="ECSP_0750"
FT   CDS_pept        821018..822436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phr"
FT                   /locus_tag="ECSP_0750"
FT                   /product="deoxyribodipyrimidine photolyase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70615"
FT                   /protein_id="ACT70615.1"
FT                   /translation="MTTHLVWFRQDLRLHDNLALAAACRNSSARLLALYIATPRQWAAH
FT                   NMSPRQAELINAQLNGLQIALAEKGIPLLFREVDDFAASVEIVKQVCAENSVTHLFYNY
FT                   QYEVNERARDVQVERTLRNVVCEGFDDSVILPPGAVMTGNHEMYKVFTPFKNAWLKRLR
FT                   EGMPECVAAPKVRSSGSIKPAPSITLNYPRQSFDTAHFPVEEKAAIAQLRQFCQNGAGE
FT                   YEQQRDFPAVEGTSRLSASLATGGLSPRQCLHRLLAEQPQALDGGAGSVWLNELIWREF
FT                   YRHLMTYYPSLCKHCPFIAWTDRVQWQSNPAHLQAWQEGKTGYPIVDAAMRQLNSTGWM
FT                   HNRLRMITASFLVKDLLIDWREGERYFMSQLIDGDLAANNGGWQWAASTGTDAAPYFRI
FT                   FNPTTQGEKFDREGEFIRQWLPELRNVPGKSVHEPWKWAEKAGVKLDYPQPIVEHKEAR
FT                   VQTLAAYEAARKGK"
FT   gene            complement(822586..824067)
FT                   /gene="ybgH"
FT                   /locus_tag="ECSP_0751"
FT   CDS_pept        complement(822586..824067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgH"
FT                   /locus_tag="ECSP_0751"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70616"
FT                   /protein_id="ACT70616.1"
FT                   /translation="MNKHASQPRAIYYVVALQIWEYFSFYGMRALLILYLTNQLKYNDT
FT                   HAYELFSAYCSLVYVTPILGGFLADKVLGNRMAVMLGALLMAIGHVVLGASEIHPSFLY
FT                   LSLAIIVCGYGLFKSNVSCLLGELYEPTDPRRDGGFSLMYAAGNVGSIIAPIACGYAQE
FT                   EYSWAMGFGLAAVGMIAGLVIFLCGNRHFTHTRGVNKKVLRATNFLLPNWGWLLVLLVA
FT                   TPALITVLFWKEWSVYALIVATIIGLGVLAKIYRKAENQKQRKELRLIVTLTFFSMLFW
FT                   AFAQQGGSSISLYIDRFVNRDMFGYTVPTAMFQSINAFAVMLCGVFLAWVVKESVAGNR
FT                   TVRIWGKFALGLGLMSAGFCILTLSARWSAMYGHSSLPLMVLGLAVMGFAELFIDPVAM
FT                   SQITRIEIPGVTGVLTGIYMLLSGAIANYLAGVIADQTSQASFDASGAINYSINAYIEV
FT                   FDQITWGALACVGVVLMIWLYQALKFRNRALALES"
FT   gene            824338..825081
FT                   /gene="ybgI"
FT                   /locus_tag="ECSP_0752"
FT   CDS_pept        824338..825081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgI"
FT                   /locus_tag="ECSP_0752"
FT                   /product="metal-binding predicted hydrolase-oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70617"
FT                   /protein_id="ACT70617.1"
FT                   /translation="MKNTELEQLINEKLNSAAISDYAPNGLQVEGKETVQKIVTGVTAS
FT                   QALLDEAVRLGADAVIVHHGYFWKGESPVIRGMKRNRLKTLLANDINLYGWHLPLDAHP
FT                   ELGNNAQLAALLGITVMGEIEPLVPWGELTMPVPGLELASWIEARLGRKPLWCGDTGPE
FT                   VVQRVAWCTGGGQSFIDSAARFGVDAFITGEVSEQTIHSAREQGLHFYAAGHHATERGG
FT                   IRALSEWLNENTDLDVTFIDIPNPA"
FT   gene            825104..825760
FT                   /gene="ybgJ"
FT                   /locus_tag="ECSP_0753"
FT   CDS_pept        825104..825760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgJ"
FT                   /locus_tag="ECSP_0753"
FT                   /product="predicted enzyme subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70618"
FT                   /protein_id="ACT70618.1"
FT                   /translation="MQRARCYLIGETAVVLELEPPVTLASQKRIWRLAQRLVDMPNVVE
FT                   AIPGMNNITVILRNPESLALDAIERLQRWWEESEALEPESRFIEIPVVYGGAGGPDLAV
FT                   VAAHCGLSEKQVVELHSSVEYVVWFLGFQPGFPYLGSLPEQLHTPRRAEPRLLVPAGSV
FT                   GIGGPQTGVYPLATPGGWQLIGHTSLSLFDPARDEPILLRPGDSVRFVPQKEGVC"
FT   gene            825754..826686
FT                   /gene="ybgK"
FT                   /locus_tag="ECSP_0754"
FT   CDS_pept        825754..826686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgK"
FT                   /locus_tag="ECSP_0754"
FT                   /product="predicted enzyme subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70619"
FT                   /protein_id="ACT70619.1"
FT                   /translation="MLKIIRAGMYTTVQDGGRHGFRQSGISHCGALDMPALRIANLLVG
FT                   NDANAPALEITLGQLTVEFETDGWFALTGAGCEARLDDNAVWTGWRLPMKAGQRLTLKR
FT                   PQHGMRSYLAVAGGIDVPPVMGSCSTDLKVGIGGLEGRLLKDGDRLPIGKAKRDFMEAQ
FT                   GVKQLLWGNRIRALPGPEYHEFDRASQDAFWRSPWQLSSQSNRMGYRLQGQILKRTTDR
FT                   ELLSHGLLPGVVQVPHNGQPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFV
FT                   QCSLEEALKSRQDQQRYFEQLAWRLHNEN"
FT   gene            826676..827410
FT                   /gene="ybgL"
FT                   /locus_tag="ECSP_0755"
FT   CDS_pept        826676..827410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgL"
FT                   /locus_tag="ECSP_0755"
FT                   /product="predicted lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70620"
FT                   /protein_id="ACT70620.1"
FT                   /translation="MKIDLNADLGEGCTSDAELLTLVSSANIACGFHAGDAQTMQACVR
FT                   EAIKNGVAIGAHPSFPDRKNFGRSAMQLPPETVYAQTLYQIGALATITRAQGGVMRHVK
FT                   PHGMLYNQAAKEAQLADAIARAVYACDPALVLVGLAGSELIRAGKQYGLTTREEVFADR
FT                   GYQADGSLVPRSQSGALIEDEEQALAQTLEMVQHGRVKSITGEWATVTAQTVCLHGDGE
FT                   HALAFARRLRSAFAEKGIVVAA"
FT   gene            827446..828267
FT                   /gene="nei"
FT                   /locus_tag="ECSP_0756"
FT   CDS_pept        827446..828267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nei"
FT                   /locus_tag="ECSP_0756"
FT                   /product="endonuclease VIII, 5-formyluracil"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70621"
FT                   /protein_id="ACT70621.1"
FT                   /translation="MPEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHV
FT                   THVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEESQTTRVLRVKLQTADKTILLY
FT                   SASDIEMLTPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAF
FT                   LAGLGNYLRVEILWQVGLTGNHKAKTSMRRNWMHSHTRYWIFLGFLTLRGGRWMRISIM
FT                   GRCFALRFFIVMANCANAVAASLRKPRCHLARFTGVRAASTRPYVSAHRLK"
FT   gene            complement(828233..829279)
FT                   /gene="abrB"
FT                   /locus_tag="ECSP_0757"
FT   CDS_pept        complement(828233..829279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="ECSP_0757"
FT                   /product="predicted regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70622"
FT                   /protein_id="ACT70622.1"
FT                   /translation="MPVLQWGMLCVLSLLLSIGFLGLHLPAALLLGPMIAGIIFSMRGV
FT                   TLQLPRSAFLAAQAILGCMIAQNLTGSILTTLEVNWPIVLAILLVTLLSSAIVGWLLVR
FT                   YSSLPGNTGAWGSSPGGAAAMVAMAQDYGADIRLVAFMQYLRVLFVAGAAVLVTRMMLG
FT                   DNAEAVNQHIVWFPPVSINLLLTILLAVVAGTVGCLLRLPSGTMLIPMLAGAVLQSGQL
FT                   ITIELPEWLLAMAYMAIGWRIGLGFDKQILLRALRPLPQILLSIFALLAICAGMAWGLT
FT                   RFMHIDFMTAYLATSPGGLDTVAVIAAGSNADMALIMAMQTLRLFSILLTGPAIARFIS
FT                   TYAPKRTA"
FT   gene            complement(829428..830489)
FT                   /gene="ybgO"
FT                   /locus_tag="ECSP_0758"
FT   CDS_pept        complement(829428..830489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgO"
FT                   /locus_tag="ECSP_0758"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70623"
FT                   /protein_id="ACT70623.1"
FT                   /translation="MRFAKGVLLAICLIFLPLKAALALNCYFGTANGAVEKSEAIMPFA
FT                   APANSKPGDKIWESDDIKIPVYCDNNTNGNFESEHVYAWVNPYPGIQDPYYQLGVTYEG
FT                   VDYDASLGKSRIDTNQCIDSKNIDIYTPEQIIAMGWQNKLCSGDPTVMHKSRTFVARMR
FT                   LYVKVRAMPPHDYQSKLSDYIVVQFDGAGSVNEDPTAKNLKYHITGLENIRVLDCSVNF
FT                   AISPETQVVDFGRFNVLDIRRHTMSQQFKITTTKSQNDQCTDGFKVSSSFYTDETLIDE
FT                   DKSLLIGNGLKLRLLDENASPYTFNKYSEYADFTSDLLVYEKTYTAELSSTPGTPIDVG
FT                   PFDTVVLFKINYN"
FT   gene            complement(830486..831217)
FT                   /gene="ybgP"
FT                   /locus_tag="ECSP_0759"
FT   CDS_pept        complement(830486..831217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgP"
FT                   /locus_tag="ECSP_0759"
FT                   /product="predicted pili assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70624"
FT                   /protein_id="ACT70624.1"
FT                   /translation="MTFVKGFPLILLVASMCSHGAVQPDRTRIIFNSKDKATSLRVENR
FT                   SDKLPYLAYSWIENEKGEKSDEFLVALPPIQRLEPKATSQVRIMKQAATAKLPTDRESL
FT                   FYYNLREIPPVPEGSEGHAILQVAVQSRIKLFWRPAALRKKMGDHVEQQLQVSQQNNQL
FT                   TLKTPTGYYLTIAYLGRDEKGVLPGFKSTMVAPFSSVTTSTGSYSGKQFYLGYMDDYGA
FT                   LRMNTLSCQRQCRLQPVENKK"
FT   gene            complement(831232..833682)
FT                   /locus_tag="ECSP_0760"
FT   CDS_pept        complement(831232..833682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0760"
FT                   /product="outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70625"
FT                   /protein_id="ACT70625.1"
FT                   /translation="MNIYRLSVLSCLAMVTPPALTAEFNLNVLDKSIRDSVDISLLNQK
FT                   GVVAPGDYFVSVTVNNNKISNGQQIRWQKSGDKIIPCINESLIELFGLKSDFRKKLPAI
FT                   KECVDFSVFPEIIFTFDQANQQLNITIPQAWLAWHSENWTPPSTWNNGIPGFLMDYNLF
FT                   ASTYRPQSGSSSNNLNAYGTTGLNAGAWRLRSDYQLSQSDSGDNREQSGAISRTYLFRP
FT                   LPQIGSRLTLGETDFSSNIFDGFSYTGAALASDDRMLPWELRGYAPQISGIAQTNATVT
FT                   ISHSGRVIYQKKVPPGPFIIDDLNQSVQGTLDVKVSEEDGRVNNFQVSAASTPFLTRQG
FT                   QVRYKLAAGRPRSSMSHHTEDETFISHEVSWGMLSNTSLYGGMLLAGDDYRSGALGIGQ
FT                   NMLWMGALSFDVTWADSHFDTQQDEQGYSYRFNYSKQVDATNSTISLAAYRFSDRHFHS
FT                   YANYIDHKYNDADAQDEKQTISLSFGQPITLLNLNLYANILHQSWWNADTSTTANITVG
FT                   FNVDIGDWKDISVSTSFNTTHYEDKDRDNQIYFSISLPIGESGRLGYDMQNNSNTTTHR
FT                   MSWNDTLDERNSWGMSAGIQSDRPDNGAQVSGNYQHLSSAGEWDLTGTYAANDYTSASA
FT                   SWSGSFTATQHGAAFHRRSSTNEPRLMVSTDGVGDIPIQGNIDYTNRFGIAVVPFVSSY
FT                   QPTTVAVNMNDLPDGVTVSENVVKETWTEGAIGFKSLASRAGKDLNVIISDANGHFPPL
FT                   GADVRQAEGGVSVGMVGENGHAWLSGVDENQQFTVHWGDQKTCAIHLPEHLEDVTKRLI
FT                   LPCH"
FT   gene            complement(833741..834307)
FT                   /gene="ybgD"
FT                   /locus_tag="ECSP_0761"
FT   CDS_pept        complement(833741..834307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgD"
FT                   /locus_tag="ECSP_0761"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70626"
FT                   /protein_id="ACT70626.1"
FT                   /translation="MFKGQKTLAALAISLLFASPVFAADEGSGEIHFKGEVIEAPCEIH
FT                   PDDLDMNIDLGEVTTSHINREHHSEKKPVNIRLINCDIAGWDDGKGGVVSKVGVTFDST
FT                   AKTTGATPLLSNISAGEATGVGVRLMNKDESFVTLGTEAPTIDLLASSTEQTLNFFAWM
FT                   EQMDNAVSVTAGAVTANATYVLDYQ"
FT   gene            complement(834694..835977)
FT                   /gene="gltA"
FT                   /locus_tag="ECSP_0762"
FT   CDS_pept        complement(834694..835977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="ECSP_0762"
FT                   /product="citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70627"
FT                   /protein_id="ACT70627.1"
FT                   /translation="MADTKAKLTLNGDTAVELDVLKGTLGQDVIDIRTLGSKGVFTFDP
FT                   GFTSTASCESKITFIDGDEGILLHRGFPIDQLATDSNYLEVCYILLNGEKPTQEQYDEF
FT                   KTTVTRHTMIHEQITRLFHAFRRDSHPMAVMCGITGALAAFYHDSLDVNNPRHREIAAF
FT                   RLLSKMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVNPILERAMDR
FT                   ILILHADHEQNASTSTVRTAGSSGANPFACIAAGIASLWGPAHGGANEAALKMLEEISS
FT                   VKHIPEFVRRAKDKNDSFRLMGFGHRVYKNYDPRATVMRETCHEVLKELGTKDDLLEVA
FT                   MELENIALNDPYFIEKKLYPNVDFYSGIILKAMGIPSSMFTVIFAMARTVGWIAHWSEM
FT                   HSDGMKIARPRQLYTGYEKRDFKSDVKH"
FT   gene            836686..837075
FT                   /gene="sdhC"
FT                   /locus_tag="ECSP_0763"
FT   CDS_pept        836686..837075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="ECSP_0763"
FT                   /product="succinate dehydrogenase, membrane subunit, binds
FT                   cytochrome b556"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70628"
FT                   /protein_id="ACT70628.1"
FT                   /translation="MIRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILL
FT                   WLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFE
FT                   AGKRSAKISFVITVVLSLLAGVLVW"
FT   gene            837069..837416
FT                   /gene="sdhD"
FT                   /locus_tag="ECSP_0764"
FT   CDS_pept        837069..837416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="ECSP_0764"
FT                   /product="succinate dehydrogenase, membrane subunit, binds
FT                   cytochrome b556"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70629"
FT                   /protein_id="ACT70629.1"
FT                   /translation="MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTY
FT                   EVWIGFCASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVY
FT                   VIYGFVVVWGV"
FT   gene            837416..839182
FT                   /gene="sdhA"
FT                   /locus_tag="ECSP_0765"
FT   CDS_pept        837416..839182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="ECSP_0765"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70630"
FT                   /protein_id="ACT70630.1"
FT                   /translation="MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSH
FT                   TVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGL
FT                   PFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSE
FT                   WYALDLVKNQDGAVVGCTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDG
FT                   VGMAIRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAK
FT                   DLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHV
FT                   DPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANR
FT                   LGGNSLLDLVVFGRAAGLHLQESIAEQGALRDASESDVEASLDRLNRWNNNRNGEDPVA
FT                   IRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELD
FT                   NLMETAYATAVSANFRTESRGAHSRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPK
FT                   LRPAFPPKIRTY"
FT   gene            839198..839914
FT                   /gene="sdhB"
FT                   /locus_tag="ECSP_0766"
FT   CDS_pept        839198..839914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="ECSP_0766"
FT                   /product="succinate dehydrogenase, FeS subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70631"
FT                   /protein_id="ACT70631.1"
FT                   /translation="MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEK
FT                   DPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLV
FT                   VDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNP
FT                   TRAIGHIKSMLLQRNA"
FT   gene            complement(839948..840079)
FT                   /locus_tag="ECSP_0767"
FT   CDS_pept        complement(839948..840079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70632"
FT                   /protein_id="ACT70632.1"
FT                   /translation="MSGAVFKDFLHFFVTPDALRLSGLRVMTCRPDKAFTPHPALVA"
FT   gene            840215..843016
FT                   /gene="sucA"
FT                   /locus_tag="ECSP_0768"
FT   CDS_pept        840215..843016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="ECSP_0768"
FT                   /product="2-oxoglutarate decarboxylase, thiamin-requiring"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70633"
FT                   /protein_id="ACT70633.1"
FT                   /translation="MQNSALKAWLDSSYLSGANQSWIEQLYEDFLTDPDSVDANWRSTF
FT                   QQLPGTGVKPDQFHSQTREYFRRLAKDASRYSSTISDPDTNVKQVKVLQLINAYRFRGH
FT                   QHANLDPLGLWQQDKVADLDPSFHDLTEADFQETFNVGSFASGKETMKLGELLEALKQT
FT                   YCGPIGAEYMHITSTEEKRWIQQRIESGRATFNSEEKKRFLSELTAAEGLERYLGAKFP
FT                   GAKRFSLEGGDALIPMLKEMIRHAGNSGTREVVLGMAHRGRLNVLVNVLGKKPQDLFDE
FT                   FAGKHKEHLGTGDVKYHMGFSSDFQTDGGLVHLALAFNPSHLEIVSPVVIGSVRARLDR
FT                   LDEPSSNKVLPITIHGDAAVTGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSNP
FT                   LDARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRH
FT                   GHNEADEPSATQPLMYQKIKKHPTPRKIYADKLEQEKVATLEDATEMVNLYRDALDAGD
FT                   CVVAEWRPMNMHSFTWSPYLNHEWDEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAK
FT                   IYGDRQAMAAGEKLFDWGGAENLAYATLVDEGIPVRLSGEDSGRGTFFHRHAVIHNQSN
FT                   GSTYTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQ
FT                   VVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQVCVPST
FT                   PAQVYHMLRRQALRGMRRPLVVMSPKSLLRHPLAVSSLEELANGTFLPAIGEIDELDPK
FT                   GVKRVVMCSGKVYYDLLEQRRKNNQHDVAIVRIEQLYPFPHKAMQEVLQQFAHVKDFVW
FT                   CQEEPLNQGAWYCSQHHFREVIPFGASLRYAGRPASASPAVGYMSVHQKQQQDLVNDAL
FT                   NVE"
FT   gene            843031..844248
FT                   /gene="sucB"
FT                   /locus_tag="ECSP_0769"
FT   CDS_pept        843031..844248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="ECSP_0769"
FT                   /product="dihydrolipoyltranssuccinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70634"
FT                   /protein_id="ACT70634.1"
FT                   /translation="MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKV
FT                   VLEVPASADGILDAVLEDEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQA
FT                   SLEEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA
FT                   APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGE
FT                   AFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVT
FT                   PVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP
FT                   PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPT
FT                   RLLLDV"
FT   gene            844342..845508
FT                   /gene="sucC"
FT                   /locus_tag="ECSP_0770"
FT   CDS_pept        844342..845508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="ECSP_0770"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70635"
FT                   /protein_id="ACT70635.1"
FT                   /translation="MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVV
FT                   KCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDI
FT                   AKELYLGAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGREL
FT                   AFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNA
FT                   LFRQPDLREMRDQSQEDPREAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGG
FT                   EPANFLDVGGGATKERVTEAFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVG
FT                   VNVPVVVRLEGNNAELGAKKLADSGLNIIAAKGLTDAAQQVVAAVEGK"
FT   gene            845508..846377
FT                   /gene="sucD"
FT                   /locus_tag="ECSP_0771"
FT   CDS_pept        845508..846377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="ECSP_0771"
FT                   /product="succinyl-CoA synthetase, NAD(P)-binding, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70636"
FT                   /protein_id="ACT70636.1"
FT                   /translation="MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGG
FT                   TTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLD
FT                   MLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVK
FT                   QTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYI
FT                   KEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIG
FT                   EALKTVLK"
FT   gene            846627..846773
FT                   /locus_tag="ECSP_0772"
FT   CDS_pept        846627..846773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0772"
FT                   /product="histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70637"
FT                   /protein_id="ACT70637.1"
FT                   /translation="MTVALSKSTKAMFTAFRQVVPFVSQDRVFTPDIAASQKFLEGYAI
FT                   NQK"
FT   gene            847044..847949
FT                   /locus_tag="ECSP_0773"
FT   CDS_pept        847044..847949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0773"
FT                   /product="putative LysR-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70638"
FT                   /protein_id="ACT70638.1"
FT                   /translation="MRGKIPKTELLVTFEVVARHESYTRAAEELALTQSAVFRQVSALE
FT                   EFLRTPLFSHSKKRIFLNDTGKYYLGIVKETLNKLERDTNTIMTWQPTVQVIELAVNPT
FT                   FSTHWLIPNLHEFTKLHPDIIVNIHSLANNGDFLNREYDAVIMRENFCAPWAEVEYLFE
FT                   EEILPVCSGSLLAMSDQKLSVAELLTELPLLHQSTRITGWEEWFALSGVSSPLVNNGPR
FT                   FDLLSMLIAAVRSNLGVALLPRFAIQHDLDSGDMVIPCDVPIRTGNRFIMTWQEEKSDS
FT                   PHLQQFREWLLAKSVVPQEM"
FT   gene            complement(847983..848585)
FT                   /locus_tag="ECSP_0774"
FT   CDS_pept        complement(847983..848585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0774"
FT                   /product="putative corrinoid:ATP adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70639"
FT                   /protein_id="ACT70639.1"
FT                   /translation="MEARISTERHVQRQQKLKEQVDTRVAAAIEKKGILIVFTGNGKGK
FT                   STAAFGTVTRAVGHGKTVGVAQYIKGQWDNGEYNLLQPLGVEFHIMGTGFTWETQNRQA
FT                   DIDAAKEVWSESKRMLADKRYDLVVLDELTYMLAYHYLDTEEVIASLQNRPAQQSVIVT
FT                   GRGCHSQILKMADTVSEIRPVKHAFDNGIQAQPGIDW"
FT   gene            complement(848595..850247)
FT                   /locus_tag="ECSP_0775"
FT   CDS_pept        complement(848595..850247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0775"
FT                   /product="putative fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70640"
FT                   /protein_id="ACT70640.1"
FT                   /translation="MSKPFIWQEPFLQNKDGTEYTLISDQHITVTELDGEEVIKIAPEA
FT                   LTLLARQAFYEASFFLRSAHLQQVASILNDQQASSNDKYVALQLLRNAEVSAKGVLPNC
FT                   QDTGTATIVASKGQQIWTGGNDAEALSKGIYSTFQENNLRFSQNAPLDMYTEVNTQTNL
FT                   PAQIDISAVAGDEYHFLCVNKGGGSANKAALYQETKSLLQPEKLTAFLIEKMKSLGTAA
FT                   CPPYHIAFVVGGLSADQTLKIAKLASTKYYDNLPTSGNEQGQAFRDIELEKVLLEASQQ
FT                   FGIGAQFGGKYFAHDIRVIRLPRHGGSCPIAMALSCSADRNIKAKINKHGIWLEKLEHN
FT                   PGQYIPASLREENHAQHVQLDLNRPLRDVMQDLARLPVGTRVSLSGPIVVARDIAHAKI
FT                   KARLDSGEPMPEYLKHHIVYYAGPAKTPENMACGSLGPTTGGRMDGYIDTFQAAGGSLV
FT                   MLSKGNRSQQVTDACHKHGGFNLGSIGGAAALLAQEYVKSLRCLEYPELGMEAVWMMEV
FT                   ENLPAFILVDDKGNNFFSQFEQQHRCASCPAGH"
FT   gene            complement(850355..851635)
FT                   /locus_tag="ECSP_0776"
FT   CDS_pept        complement(850355..851635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0776"
FT                   /product="putative symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70641"
FT                   /protein_id="ACT70641.1"
FT                   /translation="MKKISLTTMILLALVLGMIIGVVLNNTASPETAKLYAQEISIFTT
FT                   IFLRLIKMIIAPLVVSTLVVGIAKMGDAKALGRIFSKTLFLFICASLLSIALGLITVNF
FT                   FMPGTGINFVAHGAETTGVVAAEPFTLKVFISHAFPTSIVDAMAHNEILQIVVFSIFLG
FT                   CSLTAIGEKGSAIVHALDSLAHAMLKLTGYVMLFAPLTVFAAISALIAERGLAVMVSAG
FT                   IFMGEFYFTMLLLWVLLIGLAIVYVGPCIRRLTRALSEPALLAFTTSSSEAAFPGTLEK
FT                   LEQFGVSPKIASFVLPIGYSFNLVGSMAYCSFATVFIAQACNIHLSIGEQITMLLILML
FT                   TSKGMAGVPRASMVVIAATLNQFNIPEAGLILLMGVDPFLDMGRSATNVMSNAMGAAMV
FT                   SRWEGEHFGEGCRGKALKPNESNVALP"
FT   gene            complement(851796..852113)
FT                   /locus_tag="ECSP_0777"
FT   CDS_pept        complement(851796..852113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0777"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70642"
FT                   /protein_id="ACT70642.1"
FT                   /translation="MKQSIVSLAQVIRSKNAGPYELVLDILFKTKENYERVKSSGQLTP
FT                   ELIARLYHVEPDFIHRIVWFDPSNAVKIVMPRDIISGNVGDNDVYGAQQHAPLLNMSFD
FT                   L"
FT   gene            complement(852110..853480)
FT                   /locus_tag="ECSP_0778"
FT   CDS_pept        complement(852110..853480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0778"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70643"
FT                   /protein_id="ACT70643.1"
FT                   /translation="MARSFKVLSPTAILGYGFPEESFRKAMAESPDLIAVDAGSSDPGP
FT                   HYLGAGKPFTDRAGVKRDLRYMITAGVQNNIPVVIGTAGGSGAAPHLEWCREIIHEIAR
FT                   EEHLSFSMALIPADVDKAIVHQALDNGKITALDFVPPLTHDAIDESTYIVAQMGIEPFQ
FT                   RALKERAQVVLGGRAYDPACFAALPIMQGFDEGLALHCGKILECAAIAATPGSGSDCAM
FT                   GIIDDNGFTLKTFNPKRKFTETSAAAHTLYEKSDPYFLPGPGGVLNLKGCTFKAVNDGE
FT                   VYVSGSKHEETPYALKLEGARRVGFRCLTIAGTRDPIMIAGIDKIIDEVKTSVSRNLSL
FT                   DDDSIRINFHLYGKNGVMGDHEPMQTAGHELGIVLDVVAPTQEIANSVCSLVRSTMLHY
FT                   GYENRIATAGNLAFPFSPSDIQGGPVYEFSIYHLIEANDALRFDFHIEQVTPEGVQA"
FT   gene            complement(853484..854725)
FT                   /locus_tag="ECSP_0779"
FT   CDS_pept        complement(853484..854725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0779"
FT                   /product="putative methylaspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70644"
FT                   /protein_id="ACT70644.1"
FT                   /translation="MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFFYTGEPVTQGFNA
FT                   VRQAGECVSVQLILENGAVAVGDCTAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLVGR
FT                   DVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALATGRLKTEVVCDEWQLPRV
FT                   AESIPLFGQSGDDRYIAVDKMILKGIDVLPHALINNVEEKLGFKGEKLREYVRWLSDRI
FT                   LSKRTSARYHPTLHIDVYGTIGLIFDMDPLRCAQYIASLEKEAQGLPLYIEGPVDAGNK
FT                   PDQIRLLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAASCHMVQIKTPDLGSIHN
FT                   IVDAVLYCNSHSMEAYQGGTCNETDVSARTCVHVALAARPMPMLVKPGMGFDEGLDIVF
FT                   NEMNRTIALLQAKD"
FT   gene            complement(854725..856170)
FT                   /locus_tag="ECSP_0780"
FT   CDS_pept        complement(854725..856170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0780"
FT                   /product="putative glutamate mutase subumit E"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70645"
FT                   /protein_id="ACT70645.1"
FT                   /translation="MELRNKKLTHDEFMTERQQVLKTWETGKDVENFEDGVKYQQTIPE
FT                   HKRFSLALLKADKEGKTLSQPRAGVALMDEHIELLKTLQEECDLLPSTIDAYTRLNRYE
FT                   EAAVGIKKSIEAGTSKLNGLPVVNHGVAACRRLTETLQKPLQIRHGTPDARLLAEISMA
FT                   SGFTSYEGGGISYNIPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTL
FT                   IPPFISHSIAIIEGLLALEQGVKSITVGYGQVGSLTQDVAAIQSLRELAHEYFQSYGYT
FT                   DYELSTVFHQWMGGFPEDESKAFAIISWGAAVAGMSGATKVITKSPHEAWGIPTAAANI
FT                   QGLKASRQMLNMVNEQKFPPCPAVELEIELIKSEVRAVLNKVFELGNGDIARGTVLAFE
FT                   AGVLDVPFAPAACNAGKILPVRDNTGAIRVLEAGAVPLPKDILDLHHDYVAERARCEGR
FT                   QPTFQMVVDDINAVSHSKLIGRP"
FT   gene            complement(856189..857577)
FT                   /locus_tag="ECSP_0781"
FT   CDS_pept        complement(856189..857577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0781"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70646"
FT                   /protein_id="ACT70646.1"
FT                   /translation="MQIVSVDIGSTWTKAALFTREGDALTLVNHVLTPTTTHHLAKGFF
FT                   SSLNQVLNVDNALPLLNSGEVALKYSSSAKGGLAVAAMGLVPSITLETAKVTAHSAGAK
FT                   IAQYYAYKLNRRDIQALEETQPDILLFTGGTDGGEESYGLNNARVLAESKLDCAIIYAG
FT                   NRDIQDEVQEILGHKDLTIVDNVLPDLDHPNPVAARQAICDIFLKRIVKGKGLDVIVDK
FT                   TGEEPMPTPWTVFELVKAISNVDHSWKEFMLIDMGGATTDVYSACANTLSPDTVLHGVP
FT                   EPFVKRTVEGDLGMRVSAVVVGESAKELVNVNFAQQPAQLDAFYHYLRHLVAHPDYLPA
FT                   NAEEKYFDTVLAGLCVGYATERHAGTKKEVCTCVGNVDLQMGRDLTTVRKVVGSGGWLS
FT                   RASQFDMHHWLKYRELNDDGKRILLPTEFEYYRDSRGLLPLLANVARVDPLAAARTSIQ
FT                   CLTL"
FT   gene            complement(857577..858026)
FT                   /locus_tag="ECSP_0782"
FT   CDS_pept        complement(857577..858026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0782"
FT                   /product="putative glutamate mutase subumit S"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70647"
FT                   /protein_id="ACT70647.1"
FT                   /translation="MKKATLVIGVIGADCHAVGNKVLDRVFSNHDFRVINLGVMVSQDE
FT                   YIDAAIETGADAIVVSSIYGHGDIDCLGMRERCIERGLGDILLYVGGNLVVGKHDFADV
FT                   ETKFKEMGFDRVFAPSHDLEDVCQLMAHDINQRHDVDTRILEEAI"
FT   gene            complement(858213..858380)
FT                   /locus_tag="ECSP_0783"
FT   CDS_pept        complement(858213..858380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0783"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70648"
FT                   /protein_id="ACT70648.1"
FT                   /translation="MNCSEIRLKSYEMHLLMAKTTSQKCKLEVDHNYLNTLNQVNFKNL
FT                   TLMTLVDITH"
FT   gene            complement(858574..858996)
FT                   /locus_tag="ECSP_0784"
FT   CDS_pept        complement(858574..858996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0784"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70649"
FT                   /protein_id="ACT70649.1"
FT                   /translation="MIPSQISFNTLPVNATYASETTVDTQKFSDILYSAGCSLKDMAYL
FT                   SRCLASIHPTLAKNIYETENLSDQKLLHIDCRSTNEIKINIFFGQQREGLIEINSDTVI
FT                   FSILSSLIDSAISKFQHQIPVNGSVNRELLYEDYTD"
FT   gene            complement(859078..860022)
FT                   /locus_tag="ECSP_0785"
FT   CDS_pept        complement(859078..860022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0785"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70650"
FT                   /protein_id="ACT70650.1"
FT                   /translation="MSPDNIGSAVNRFSGWPSNDSLKTDKESMTSPVTVQVIKMIAAIL
FT                   DPHRIVVGIDTLYTTQRETFTSESQQLIESALQTLHVMNLNNLETNRDEESHYLAFEYN
FT                   VDTSDRITVSAYNEKKPGCYGQCLVIQDDETDLFNLIKIKIFEARHNYVAQLMSDPEFM
FT                   FKFSYSAQQNRLEPHLLVPAYFPLKTNEPVTQEDVLLLYRFFKMNDDFNKLTSDEYMSI
FT                   LTPLMKCERSVHDNNRYVTGKDTLLLDYPPSGNQIHFHVFPDESATLVLYFSNNDIECF
FT                   VFERDIPSQYRFFKMFTNLALVIDQLTEANKIL"
FT   gene            860828..862396
FT                   /gene="cydA"
FT                   /locus_tag="ECSP_0786"
FT   CDS_pept        860828..862396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="ECSP_0786"
FT                   /product="cytochrome d terminal oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70651"
FT                   /protein_id="ACT70651.1"
FT                   /translation="MLDIVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGK
FT                   QIYKDMTKFWGKLFGINFALGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAF
FT                   FLESTFVGLFFFGWDRLGKVQHMCVTWLVALGSNLSALWILVANGWMQNPIASDFNFET
FT                   MRMEMVSFSELVLNPVAQVKFVHTVASGYVTGAMFILGISAWYMLKGRDFAFAKRSFAI
FT                   AASFGMAAVLSVIVLGDESGYEMGDVQKTKLAAIEAEWETQPAPAAFTLFGIPDQEEET
FT                   NKFAIQIPYALGIIATRSVDTPVIGLKELMVQHEERIRNGMKAYSLLEQLRSGSTDQAV
FT                   RDQFNSMKKDLGYGLLLKRYTPNVADATEAQIQQATKDSIPRVAPLYFAFRIMVACGFL
FT                   LLAIIALSFWSVIRNRIGEKKWLLRAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLP
FT                   TAVANSSLTAGDLIFSMVLICGLYTLFLVAELFLMFKFARLGPSSLKTGRYHFEQSSTT
FT                   TQPAR"
FT   gene            862412..863551
FT                   /gene="cydB"
FT                   /locus_tag="ECSP_0787"
FT   CDS_pept        862412..863551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="ECSP_0787"
FT                   /product="cytochrome d terminal oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70652"
FT                   /protein_id="ACT70652.1"
FT                   /translation="MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTE
FT                   RRIMINSIAPHWDGNQVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGF
FT                   DYRSKIEETRWRNMWDWGIFIGSFVPPLVIGVAFGNLLQGVPFNVDEYLRLYYTGNFFQ
FT                   LLNPFGLLAGVVSVGMIITQGATYLQMRTVGELHLRTRATAQVAALVTLVCFALAGVWV
FT                   MYGIDGYVVKSTMDHYAASNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTIL
FT                   TARMDKAAWAFVFSSLTLACIILTAGIAMFPFVMPSSTMMNASLTMWDATSSQLTLNVM
FT                   TWVAVVLVPIILLYTAWCYWKMFGRITKEDIERNTHSLY"
FT   gene            863679..863972
FT                   /gene="ybgE"
FT                   /locus_tag="ECSP_0788"
FT   CDS_pept        863679..863972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgE"
FT                   /locus_tag="ECSP_0788"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70653"
FT                   /protein_id="ACT70653.1"
FT                   /translation="MSKIIATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSE
FT                   LEIWHGLLLMWAVCAGVIHGVGFRPQKVLWQGIFCPLLADIVLIVGLIFFFF"
FT   gene            864122..864526
FT                   /gene="ybgC"
FT                   /locus_tag="ECSP_0789"
FT   CDS_pept        864122..864526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgC"
FT                   /locus_tag="ECSP_0789"
FT                   /product="thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70654"
FT                   /protein_id="ACT70654.1"
FT                   /translation="MNTTLFRWPVRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHHF
FT                   SQQALMAERVAFVVRKMTVEYYAPARLDDMLEIQTEITSMRGTSLVFTQRIVNAENTLL
FT                   NEAEVLVVCVDPLKMKPRALPKSIVAEFKQ"
FT   gene            864523..865215
FT                   /gene="tolQ"
FT                   /locus_tag="ECSP_0790"
FT   CDS_pept        864523..865215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="ECSP_0790"
FT                   /product="membrane spanning protein in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70655"
FT                   /protein_id="ACT70655.1"
FT                   /translation="MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAA
FT                   AREAEAFEDKFWSGIELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAV
FT                   VEGASRAMRISMNRELENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQAT
FT                   LQMVAPGIAEALIATAIGLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAF
FT                   TVSESNKG"
FT   gene            865219..865647
FT                   /gene="tolR"
FT                   /locus_tag="ECSP_0791"
FT   CDS_pept        865219..865647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="ECSP_0791"
FT                   /product="membrane spanning protein in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70656"
FT                   /protein_id="ACT70656.1"
FT                   /translation="MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEV
FT                   DLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPK
FT                   TVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI"
FT   gene            865712..866986
FT                   /gene="tolA"
FT                   /locus_tag="ECSP_0792"
FT   CDS_pept        865712..866986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="ECSP_0792"
FT                   /product="membrane anchored protein in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70657"
FT                   /protein_id="ACT70657.1"
FT                   /translation="MSKATEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGG
FT                   GGSSIDAVMVDSGAVVEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLK
FT                   QLEKERLAAQEQKKQAEEAAKQAELKQKQAEEAAAKAAADAKAKAEADDKAAEEAAKKA
FT                   AADAKKKAEAEAAKAAAEAQKKAEAAAAALKKKAEAAEAAAAEARKKAAAEKAAADKKA
FT                   AEKAAADKKAAEKAAAEKAAAEKAAADKKAAEKAAAEKAAADKKAAAEKAAADKKAAAA
FT                   KAAAEKAAAAKAAAEADDIFGELSSGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADI
FT                   NNYAGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAK
FT                   LAKIPKPPSQAVYEVFKNAPLDFKP"
FT   gene            867119..868411
FT                   /gene="tolB"
FT                   /locus_tag="ECSP_0793"
FT   CDS_pept        867119..868411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="ECSP_0793"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70658"
FT                   /protein_id="ACT70658.1"
FT                   /translation="MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWA
FT                   GPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQV
FT                   TPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAF
FT                   RTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESG
FT                   RSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIR
FT                   QVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVS
FT                   SDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGS
FT                   VLNLVSTDGRFKARLPATDGQVKFPAWSPYL"
FT   gene            868446..868967
FT                   /gene="pal"
FT                   /locus_tag="ECSP_0794"
FT   CDS_pept        868446..868967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pal"
FT                   /locus_tag="ECSP_0794"
FT                   /product="peptidoglycan-associated outer membrane
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70659"
FT                   /protein_id="ACT70659.1"
FT                   /translation="MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDA
FT                   NGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVT
FT                   VEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAY
FT                   SKNRRAVLVY"
FT   gene            868977..869768
FT                   /gene="ybgF"
FT                   /locus_tag="ECSP_0795"
FT   CDS_pept        868977..869768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="ECSP_0795"
FT                   /product="SecB-dependent secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70660"
FT                   /protein_id="ACT70660.1"
FT                   /translation="MSSNFRHQLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVIQL
FT                   ERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVVERQKQILLQIDSLSSG
FT                   GAAAQSTSGDQSGAAASTTPTADAGTANAGAPVKSGDANTDYNAAIALVQDKSRQDDAM
FT                   VAFQNFIKNYPDSTYLPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMFK
FT                   VGVIMQDKGDTAKAKAVYQQVISKYPGTDGAKQAQKRLNAM"
FT   gene            869933..870008
FT                   /locus_tag="ECSP_0796"
FT   tRNA            869933..870008
FT                   /locus_tag="ECSP_0796"
FT                   /product="tRNA-Lys"
FT                   /note="anticodon: TTT"
FT   gene            870044..870119
FT                   /locus_tag="ECSP_0797"
FT   tRNA            870044..870119
FT                   /locus_tag="ECSP_0797"
FT                   /product="tRNA-Val"
FT                   /note="anticodon: TAC"
FT   gene            870122..870197
FT                   /locus_tag="ECSP_0798"
FT   tRNA            870122..870197
FT                   /locus_tag="ECSP_0798"
FT                   /product="tRNA-Lys"
FT                   /note="anticodon: TTT"
FT   gene            870249..870324
FT                   /locus_tag="ECSP_0799"
FT   tRNA            870249..870324
FT                   /locus_tag="ECSP_0799"
FT                   /product="tRNA-Val"
FT                   /note="anticodon: TAC"
FT   gene            870328..870403
FT                   /locus_tag="ECSP_0800"
FT   tRNA            870328..870403
FT                   /locus_tag="ECSP_0800"
FT                   /product="tRNA-Lys"
FT                   /note="anticodon: TTT"
FT   gene            870550..870625
FT                   /locus_tag="ECSP_0801"
FT   tRNA            870550..870625
FT                   /locus_tag="ECSP_0801"
FT                   /product="tRNA-Lys"
FT                   /note="anticodon: TTT"
FT   gene            870903..871946
FT                   /gene="nadA"
FT                   /locus_tag="ECSP_0802"
FT   CDS_pept        870903..871946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="ECSP_0802"
FT                   /product="quinolinate synthase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70661"
FT                   /protein_id="ACT70661.1"
FT                   /translation="MSVMFDPDTAIYPFPPKPTPLSIDEKAYYREKIKRLLKERNAVMV
FT                   AHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKTI
FT                   LMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
FT                   DHLDSLGEKIIWAPDKHLGRYVQKKTGADILCWQGACIVHDEFKTQALTRLQEEYPDAA
FT                   ILVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLE
FT                   APTAGEGATCRSCAHCPWMAMNGLQAIAEALEQEGSNYEVHVDERLRERALVPLNRMLD
FT                   FAATLRG"
FT   gene            871984..872703
FT                   /gene="pnuC"
FT                   /locus_tag="ECSP_0803"
FT   CDS_pept        871984..872703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnuC"
FT                   /locus_tag="ECSP_0803"
FT                   /product="predicted nicotinamide mononucleotide
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70662"
FT                   /protein_id="ACT70662.1"
FT                   /translation="MDFFSVQNILVHIPIGAGGYDLSWIEAVGTIAGLLCIGLASLEKI
FT                   SNYFFGLINVTLFGIIFFQIQLYASLLLQVFFFAANIYGWYAWSRQTSQNEAELKIRWL
FT                   PLPKALSWLAVCVVSIGLMTVFINPVFAFLTRVAVIIMQALGLQVAMPELQPDAFPFWD
FT                   SCMMVLSIVAMILMTRKYVENWLLWVIINVISVVIFALQGVYAMSLEYIILTFIALNGS
FT                   RMWINSARERGSRALSH"
FT   gene            complement(872700..873641)
FT                   /gene="zitB"
FT                   /locus_tag="ECSP_0804"
FT   CDS_pept        complement(872700..873641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zitB"
FT                   /locus_tag="ECSP_0804"
FT                   /product="zinc efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70663"
FT                   /protein_id="ACT70663.1"
FT                   /translation="MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVIGGFLSGSL
FT                   ALLADAGHMLTDTAALLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITIL
FT                   IVWEAIERFRTPRPVEGGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGD
FT                   LLGSVGAIIAALIIIWTGWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDI
FT                   AELKRRMCREIPEVRNVHHVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQ
FT                   IEHATIQMEYQPCHGPDCHLNEGVSGHSHHHH"
FT   gene            complement(873755..874135)
FT                   /gene="ybgS"
FT                   /locus_tag="ECSP_0805"
FT   CDS_pept        complement(873755..874135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgS"
FT                   /locus_tag="ECSP_0805"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70664"
FT                   /protein_id="ACT70664.1"
FT                   /translation="MKMTKLATLFLTATLSLASGAALAADSGAQTNNGQANAAADAGQV
FT                   APDARENVAPNNVDNNGVNTGSGGTMLHPDGSSMNNDGMTKDEEHKNTMCKDGRCPDIN
FT                   KKVQTGDGINNDVDTKTDGTTQ"
FT   gene            874451..875503
FT                   /gene="aroG"
FT                   /locus_tag="ECSP_0806"
FT   CDS_pept        874451..875503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="ECSP_0806"
FT                   /product="3-deoxy-D-arabino-heptulosonate-7-phosphate
FT                   synthase, phenylalanine repressible"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70665"
FT                   /protein_id="ACT70665.1"
FT                   /translation="MNYQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHK
FT                   ILKGNDDRLLVVIGPCSIHDPVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGW
FT                   KGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIG
FT                   ARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVN
FT                   TSGNGDCHIILRGGKEPNYSAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDV
FT                   CADVCQQIAGGEKAIIGVMVESHLVEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQ
FT                   LANAVKARRG"
FT   gene            complement(875669..876421)
FT                   /gene="gpmA"
FT                   /locus_tag="ECSP_0807"
FT   CDS_pept        complement(875669..876421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="ECSP_0807"
FT                   /product="phosphoglyceromutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70666"
FT                   /protein_id="ACT70666.1"
FT                   /translation="MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLL
FT                   KEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETA
FT                   EKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIP
FT                   YWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENF
FT                   KPLKRYYLGNADEIAAKAAAVANQGKAK"
FT   gene            complement(876495..876623)
FT                   /locus_tag="ECSP_0808"
FT   CDS_pept        complement(876495..876623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_0808"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70667"
FT                   /protein_id="ACT70667.1"
FT                   /translation="MLSPRHEGFISYCSNHQQTPTYLQLNIHNNLTLRHYFRYGYA"
FT   gene            complement(876623..877663)
FT                   /gene="galM"
FT                   /locus_tag="ECSP_0809"
FT   CDS_pept        complement(876623..877663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="ECSP_0809"
FT                   /product="galactose-1-epimerase (mutarotase)"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70668"
FT                   /protein_id="ACT70668.1"
FT                   /translation="MLNETPALAPDGQPYRLLTLRNNAGMVVTLMDWGATLLSARIPLS
FT                   DGSVREALLGCASPECYQDQAAFLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLH
FT                   GGPEGFDKRRWQIVNQNDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRAT
FT                   VDKPCPVNMTNHVYFNLDGKQSDVRNHKLQILADEYLPVDEGGIPHDGLKSVAGTSFDF
FT                   RSAKIIASEFLADDDQRKVKGYDHAFLLQAKGDGKKVAAHVWSADEKLQLKVYTTAPAL
FT                   QFYSGNYLGGTPSRGTEPYADWQGLALESEFLPDSPNHPEWPQPDCFLHPGEEYSSLTE
FT                   YQFIAE"
FT   gene            complement(877657..878805)
FT                   /gene="galK"
FT                   /locus_tag="ECSP_0810"
FT   CDS_pept        complement(877657..878805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="ECSP_0810"
FT                   /product="galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70669"
FT                   /protein_id="ACT70669.1"
FT                   /translation="MSLKEKTQSLFANAFGYPATHTIQAPGRVNLIGEHTDYNDGFVLP
FT                   CAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLDAPIVAHENYQWANYVRGVVKHLQ
FT                   LRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVLQQLYHLPLDGAQIALNGQEAEN
FT                   QFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVSMPKGVAVVIINSNFKRTLVGSE
FT                   YNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPIVAKRVRHILTENARTVEAASA
FT                   LEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVKAVIGDKGGVRMTGGGFGGCI
FT                   VALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAGQC"
FT   gene            complement(878809..879855)
FT                   /gene="galT"
FT                   /locus_tag="ECSP_0811"
FT   CDS_pept        complement(878809..879855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="ECSP_0811"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70670"
FT                   /protein_id="ACT70670.1"
FT                   /translation="MTQFNPVDHPHRRYNQLTGQWILVSPHRAKRPWQGAQETPAKQVL
FT                   PAHDPDCFLCAGNVRVTGDKNPDYTGTYVFTNDFAALMSDTPDAPESNDPLMRCQSARG
FT                   TSRVICFSPDHSKTLPELSVAALTEIVKTWQEQTAELGKTYPWVQVFENKGAAMGCSNP
FT                   HPHGQIWANSFLPNEAEREDRLQKEYFAEQKSPMLVDYVQRELADGSRTVVETEHWLAV
FT                   VPYWAAWPFETLLLPKAHVLRITDLTDAQRSDLALALKKLTSRYDNLFQCSFPYSMGWH
FT                   GAPFNGEENQHWQLHAHFYPPLLRSATVRKFMVGYEMLAETQRDLTAEQAAERLRAVSD
FT                   IHFRESGV"
FT   gene            complement(879865..880881)
FT                   /gene="galE"
FT                   /locus_tag="ECSP_0812"
FT   CDS_pept        complement(879865..880881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="ECSP_0812"
FT                   /product="UDP-glucose-4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70671"
FT                   /protein_id="ACT70671.1"
FT                   /translation="MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIE
FT                   RLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGT
FT                   LRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDL
FT                   QKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDY
FT                   PTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGSSVLDVVNAFSRACG
FT                   KPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD"
FT   gene            complement(881143..882615)
FT                   /gene="modF"
FT                   /locus_tag="ECSP_0813"
FT   CDS_pept        complement(881143..882615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modF"
FT                   /locus_tag="ECSP_0813"
FT                   /product="ATP-binding component of molybdate ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70672"
FT                   /protein_id="ACT70672.1"
FT                   /translation="MSSLQILQGTFRLSDTKTLQLPQLTLNAGDSWAFVGSNGSGKSAL
FT                   ARALAGELPLLKGERQSQFSHITRLSFEQLQKLVSDEWQRNNTDMLGPGEDDTGRTTAE
FT                   IIQDEVKDAPRCMQLAQQFGITPLLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPF
FT                   DGLDVASRQQLAERLASLHQSGITLVLVLNRFDEIPEFVQFAGVLADCTLAETGAKEEL
FT                   LQQALVAQLAHSEQLEGVQLPEPDEPSARHALPANEPRIVLNNGVVSYNDRPILNNLSW
FT                   QVNPGEHWQIVGPNGAGKSTLLSLITGDHPQGYSNDLTLFGRRRGSGETIWDIKKHIGY
FT                   VSSSLHLDYRVSTTVRNVILSGYFDSIGIYQAVSDRQQKLVQQWLDILGIDKRTADAPF
FT                   HSLSWGQQRLALIVRALVKHPTLLILDEPLQGLDPLNRQLIRRFVDVLISEGETQLLFV
FT                   SHHAEDAPACITHRLEFVPDGGLYHYALTKIN"
FT   gene            complement(882683..883471)
FT                   /gene="modE"
FT                   /locus_tag="ECSP_0814"
FT   CDS_pept        complement(882683..883471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modE"
FT                   /locus_tag="ECSP_0814"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70673"
FT                   /protein_id="ACT70673.1"
FT                   /translation="MQAEILLTLKLQQKLFADPRRISLLKHIALSGSISQGAKDAGISY
FT                   KSAWDAINEMNQLSEHILVERATGGKGGGGAVLTRYGQRLIQLYDLLAQIQQKAFDVLS
FT                   DDDALPLNSLLAAISRFSLQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAIT
FT                   AQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMA
FT                   LPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIATLC"
FT   gene            883600..883749
FT                   /gene="ybhT"
FT                   /locus_tag="ECSP_0815"
FT   CDS_pept        883600..883749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhT"
FT                   /locus_tag="ECSP_0815"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70674"
FT                   /protein_id="ACT70674.1"
FT                   /translation="MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQP
FT                   GQNH"
FT   gene            883916..884689
FT                   /gene="modA"
FT                   /locus_tag="ECSP_0816"
FT   CDS_pept        883916..884689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="ECSP_0816"
FT                   /product="molybdate transporter subunit;
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70675"
FT                   /protein_id="ACT70675.1"
FT                   /translation="MARKWLNLFAGAALSFAVAGNALADEGKITVFAAASLTNAMQDIA
FT                   TQYKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTL
FT                   LGNSLVVVAPKASEQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAW
FT                   DTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPV
FT                   AVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTTK"
FT   gene            884689..885378
FT                   /gene="modB"
FT                   /locus_tag="ECSP_0817"
FT   CDS_pept        884689..885378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="ECSP_0817"
FT                   /product="molybdate transporter subunit; membrane component
FT                   of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70676"
FT                   /protein_id="ACT70676.1"
FT                   /translation="MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKA
FT                   LLDSVLHLPLVLPPVVVGYLLLVSMGRRGFIGERLYDWFGITFAFSWRGAVLAAAVMSF
FT                   PLMVRAIRLALEGVDVKLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGE
FT                   FGATITFVSNIPGETRTIPSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARI
FT                   SRERAGR"
FT   gene            885381..886439
FT                   /gene="modC"
FT                   /locus_tag="ECSP_0818"
FT   CDS_pept        885381..886439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="ECSP_0818"
FT                   /product="molybdate transporter subunit; ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70677"
FT                   /protein_id="ACT70677.1"
FT                   /translation="MLELNFSQTLGNHCLTINETLPANGITAIFGVSGAGKTSLINAIS
FT                   GLTRPQKGRIVLNGRVLNDAEKGICLTPEKRRVGYVFQDARLFPHYKVRGNLRYGMAKS
FT                   MVDQFDKLVALLGIEPLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPR
FT                   KRELLPYLQRLTREINIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALEEVWGSSVM
FT                   NPWLPKEQQSSILKVTVLEHHPHYAMTALALGDQHLWVNKLDEPLQAALRIRIQASDVS
FT                   LVLQPPQQTSIRNVLRAKVVNSYDDNGQVEVELEVGGKTLWARISPWARDELAIKPGLW
FT                   LYAQIKSVSITA"
FT   gene            complement(886440..887258)
FT                   /gene="ybhA"
FT                   /locus_tag="ECSP_0819"
FT   CDS_pept        complement(886440..887258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhA"
FT                   /locus_tag="ECSP_0819"
FT                   /product="pyridoxal phosphatase / fructose
FT                   1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70678"
FT                   /protein_id="ACT70678.1"
FT                   /translation="MTTRVIALDLDGTLLTPKKTLLPSSIEALARAREAGYQLIIVTGR
FT                   HHVAIHPFYQALALDTPAICCNGTYLYDYHAKTVLEADPMPVNKALQLIEMLNEHHIHG
FT                   LMYVDDEMVYEHPTGHVIRTSNWAQTLPPEQRPTFTQVASLAETAQQVNAVWKFALTHD
FT                   DLPQLQHFGKHVEHELGLECEWSWHDQVDIARGGNSKGKRLTKWVEAQGWSMENVVAFG
FT                   DNFNDISMLEAAGTGVAMGNADDAVKARANIVIGDNTTDSIAQFIYSHLI"
FT   gene            887413..888408
FT                   /gene="pgl"
FT                   /locus_tag="ECSP_0820"
FT   CDS_pept        887413..888408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="ECSP_0820"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0820"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70679"
FT                   /protein_id="ACT70679.1"
FT                   /translation="MKQTVYIASPESQQIHVWNLNHEGALTLTQVVDVPGQVQPMVVSP
FT                   DKRYLYVGVRPEFRVLAYRIAPDDGALTFAAESALPGSPTHISTDHQGQFVFVGSYNAG
FT                   NVSVTRLEDGLPVGVVDVVEGLDGCHSANISPDNRTLWVPALKQDRICLFTVSDDGHLV
FT                   AQDPAEVTTVEGAGPRHMVFHPNEQYAYCVNELNSSVDVWELKDPHGNIECVQTLDMMP
FT                   ENFSDTRWAADIHITPDGRHLYACDRTASLITVFSVSEDGSVLSKEGFQPTETQPRGFN
FT                   IDHRGKYLIAAGQKSHHISVYEIVGEQGLLHEKGRYAVGQGPMWVVVNAH"
FT   gene            complement(888449..889402)
FT                   /gene="ybhD"
FT                   /locus_tag="ECSP_0821"
FT   CDS_pept        complement(888449..889402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhD"
FT                   /locus_tag="ECSP_0821"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70680"
FT                   /protein_id="ACT70680.1"
FT                   /translation="MKHELSSMKAFVILAESSSFNNAAKLLNITQPALTRRIKKMEEDL
FT                   HIQLFERTTRKVTLTKAGKRLLPEARELIKKFDETLFNIRDMNAYHRGMVTLACIPTAV
FT                   FYFLPLAIGKFNELYPNIKVRILEQGTNNCMESVLCNESDFGINMNNVTNSSIDFTPLV
FT                   NEPFVLACRRDHPLAKKQLVEWQELVGYKMIGVRSSSGNRLLIEQQLADKPWKLDWFYE
FT                   VRHLSTSLGLVEAGLGISALPGLAMPHAPYSSIIGIPLVEPVIRRTLGIIRRKDAVLSP
FT                   AAERFFALLINLWTDDKDNLWTNIVERQRHALQEIG"
FT   gene            889586..890638
FT                   /gene="ybhH"
FT                   /locus_tag="ECSP_0822"
FT   CDS_pept        889586..890638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhH"
FT                   /locus_tag="ECSP_0822"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0822"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70681"
FT                   /protein_id="ACT70681.1"
FT                   /translation="MKKIPCVMMRGGTSRGAFLLAEHLPEDQTQRDKILMAIMGSGNDL
FT                   EIDGIGGGNPLTSKVAIISRSSDPRADVDYLFAQVIVHEKRVDTTPNCGNMLSGVGAFA
FT                   IENGLIAATSPVTRVRIRNVNTGTFIEADVQTPNGVVEYEGSARIDGVPGTAAPVALTF
FT                   LNAAGTKTGKVFPTDNQIDYFDDVPVTCIDMAMPVVIIPAEYLGKTGYELPAELDADKA
FT                   LLARIESIRLQAGKAMGLGDVSNMVIPKPVLISPAQKGGAINVRYFMPHSCHRALAITG
FT                   AIAISSSCALEGTVTRQIVPSVGYGNINIEHPSGGLDVHLSNEGQDATTLRASVIRTTR
FT                   KIFSGEVYLP"
FT   gene            890714..892147
FT                   /gene="ybhI"
FT                   /locus_tag="ECSP_0823"
FT   CDS_pept        890714..892147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhI"
FT                   /locus_tag="ECSP_0823"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0823"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70682"
FT                   /protein_id="ACT70682.1"
FT                   /translation="MNKKSLWKLILILAIPCIIGFMPAPAGLSELAWVLFGIYLAAIVG
FT                   LVIKPFPEPVVLLIAVAASMVVVGNLSDGAFKTTAVLSGYSSGTTWLVFSAFTLSAAFV
FT                   TTGLGKRIAYLLIGKIGNTTLGLGYVTVFLDLVLAPATPSNTARAGGIVLPIINSVAVA
FT                   LGSEPEKSPRRVGHYLMMSIYMVTKTTSYMFFTAMAGNILALKMINDILHLQISWGGWA
FT                   LAAGLPGIIMLLVTPLVIYTMYPPEIKKVDNKTIAKAGLAELGPMKIREKMLLGVFVLA
FT                   LLGWIFSKSLGVDESSVAIVVMATMLLLGIVTWEDVVKNKGGWNTLIWYGGIIGLSSLL
FT                   SKVKFFEWLAEVFKNNLAFDGHGNVAFFVIIFLSIIVRYFFASGSAYIVAMLPVFAMLA
FT                   NVSGAPLMLTALALLFSNSYGGMVTHYGGAAGPVIFGVGYNDIKSWWLVGAVLTILTFL
FT                   VHITLGVWWWNMLIGWNML"
FT   gene            892330..894591
FT                   /gene="ybhJ"
FT                   /locus_tag="ECSP_0824"
FT   CDS_pept        892330..894591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhJ"
FT                   /locus_tag="ECSP_0824"
FT                   /product="predicted hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0824"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70683"
FT                   /protein_id="ACT70683.1"
FT                   /translation="MIKLSEKGVFLASNNEIIAEEHFTGEIKKEEAKKGTIAWSILSSH
FT                   NTSGNMDKLKIKFDSLASHDITFVGIVQTAKASGMERFPLPYVLTNCHNSLCAVGGTIN
FT                   GDDHVFGLSAAQRYGGIFVPPHIAVIHQYMREMMAGGGKMILGSDSHTRYGALGTMAVG
FT                   EGGGELVKQLLNDTWDIDYPGVVAVHLTGKPAPYVGPQDVALAIIGAVFKNGYVKNKVM
FT                   EFVGPGVAALSTDFRNSVDVMTTETTCLSSVWQTDEEVHNWLALHGRGQDYCQLNPQPM
FT                   AYYDGCISVDLSAIKPMIALPFHPSNVYEIDTLNQNLTDILREIEIESERVAHGKAKLS
FT                   LLDKVENGRLKVQQGIIAGCSGGNYENVIAAANALRGQSCGNDTFSLAVYPSSQPVFMD
FT                   LAKKGVVADLIGAGAIIRTAFCGPCFGAGDTPINNGLSIRHTTRNFPNREGSKPANGQM
FT                   SAVALMDARSIAATAANGGYLTSASELDCWDNVPEYAFDVTPYKNRVYQGFVKGAAQQP
FT                   LIYGPNIKDWPELGALTDNIVLKVCSKILDEVTTTDELIPSGETSSYRSNPIGLAEFTL
FT                   SRRDPGYVGSSKATAELENQRLAGNVSELTEVFARIKQIAGQEHIDPLQTEIGSMVYAV
FT                   KPGDGSAREQAASCQRVIGGLANIAEEYATKRYRSNVINWGMLPLQMVEAPTFEVGDYI
FT                   YIPGIKAALDNPGTTFKGYVIHEDAPVTEITLYMESLTAEEREIIKAGSLINFNKNRQM
FT                   "
FT   gene            complement(894732..896015)
FT                   /gene="ybhC"
FT                   /locus_tag="ECSP_0825"
FT   CDS_pept        complement(894732..896015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhC"
FT                   /locus_tag="ECSP_0825"
FT                   /product="predicted pectinesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECSP_0825"
FT                   /db_xref="EnsemblGenomes-Tr:ACT70684"
FT                   /protein_id="ACT70684.1"
FT                   /translation="MNTFSVSRLALALAFGVTLTACSSTPPDQRPSDQTAPGTSSRPIL
FT                   SAKEAQNFDAQHYFASLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTHTTIQAAVDAA
FT                   IIKRTNKRQYIAVMPGEYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWR
FT                   HDVNPRGKYMPGKPAWYMYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDS
FT                   VDAGNHPAVALRTDGDQVQINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIE
FT                   GDVDIVSGRGAVVFDNTEFRVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNASGDGV
FT                   AQLGRSLDVDANTNGQVVIRDSAINEGFNTAKPWGDAVISNRPFAGNTGSVDDSDEIQR
FT                   NLNDTNYNRMWEYNNRGVGSKVVAEAKK"
FT   gene            complement(896150..896920)
FT                   /locus_tag="ECSP_0826"
FT   CDS_pept        complement(896150..896920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECSP_08