(data stored in ACNUC7421 zone)

EMBL: CP001390

ID   CP001390; SV 1; circular; genomic DNA; STD; PRO; 4304501 BP.
XX
AC   CP001390; AASH01000000-AASH01000164;
XX
PR   Project:PRJNA16263;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   25-JUN-2014 (Rel. 121, Last updated, Version 6)
XX
DE   Geobacter daltonii FRC-32, complete genome.
XX
KW   .
XX
OS   Geobacter daltonii FRC-32
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Desulfuromonadales;
OC   Geobacteraceae; Geobacter.
XX
RN   [1]
RP   1-4304501
RA   Aklujkar M., Chin K.-J., Kanak A., Voordeckers J.W., Saunders E., Han C.S.,
RA   Land M.L., Lovely D.R., Kostka J.;
RT   "The genome of Geobacter daltonii, isolated from a shallow subsurface
RT   environment contaminated with heavy metals and hydrocarbons";
RL   Unpublished.
XX
RN   [2]
RP   1-4304501
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Saunders E., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Kostka J., Richardson P.;
RT   "Complete sequence of Geobacter sp. FRC-32";
RL   Unpublished.
XX
RN   [3]
RP   1-4304501
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Saunders E., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Kostka J., Richardson P.;
RT   ;
RL   Submitted (21-JAN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [4]
RC   Protein update by submitter
RP   1-4304501
RA   Aklujkar M., Chin K.-J., Kanak A., Voordeckers J.W., Saunders E., Han C.S.,
RA   Land M.L., Lovely D.R., Kostka J.;
RT   ;
RL   Submitted (23-JUN-2014) to the INSDC.
RL   Georgia Tech, Atlanta, GA 30332, USA
XX
DR   MD5; 9d792f7dad253dca92008d82bb8d908a.
DR   BioSample; SAMN00623045.
DR   EnsemblGenomes-Gn; EBG00001044486.
DR   EnsemblGenomes-Gn; EBG00001044488.
DR   EnsemblGenomes-Gn; EBG00001044492.
DR   EnsemblGenomes-Gn; EBG00001044495.
DR   EnsemblGenomes-Gn; EBG00001044497.
DR   EnsemblGenomes-Gn; EBG00001044499.
DR   EnsemblGenomes-Gn; EBG00001044501.
DR   EnsemblGenomes-Gn; EBG00001044503.
DR   EnsemblGenomes-Gn; EBG00001044505.
DR   EnsemblGenomes-Gn; EBG00001044507.
DR   EnsemblGenomes-Gn; EBG00001044509.
DR   EnsemblGenomes-Gn; EBG00001044511.
DR   EnsemblGenomes-Gn; EBG00001044514.
DR   EnsemblGenomes-Gn; EBG00001044517.
DR   EnsemblGenomes-Gn; EBG00001044519.
DR   EnsemblGenomes-Gn; EBG00001044521.
DR   EnsemblGenomes-Gn; EBG00001044523.
DR   EnsemblGenomes-Gn; EBG00001044525.
DR   EnsemblGenomes-Gn; EBG00001044528.
DR   EnsemblGenomes-Gn; EBG00001044530.
DR   EnsemblGenomes-Gn; EBG00001044533.
DR   EnsemblGenomes-Gn; EBG00001044536.
DR   EnsemblGenomes-Gn; EBG00001044538.
DR   EnsemblGenomes-Gn; EBG00001044540.
DR   EnsemblGenomes-Gn; EBG00001044542.
DR   EnsemblGenomes-Gn; EBG00001044544.
DR   EnsemblGenomes-Gn; EBG00001044546.
DR   EnsemblGenomes-Gn; EBG00001044548.
DR   EnsemblGenomes-Gn; EBG00001044549.
DR   EnsemblGenomes-Gn; EBG00001044550.
DR   EnsemblGenomes-Gn; EBG00001044551.
DR   EnsemblGenomes-Gn; EBG00001044552.
DR   EnsemblGenomes-Gn; EBG00001044553.
DR   EnsemblGenomes-Gn; EBG00001044554.
DR   EnsemblGenomes-Gn; EBG00001044555.
DR   EnsemblGenomes-Gn; EBG00001044556.
DR   EnsemblGenomes-Gn; EBG00001044558.
DR   EnsemblGenomes-Gn; EBG00001044560.
DR   EnsemblGenomes-Gn; EBG00001044562.
DR   EnsemblGenomes-Gn; EBG00001044563.
DR   EnsemblGenomes-Gn; EBG00001044564.
DR   EnsemblGenomes-Gn; EBG00001044565.
DR   EnsemblGenomes-Gn; EBG00001044566.
DR   EnsemblGenomes-Gn; EBG00001044567.
DR   EnsemblGenomes-Gn; EBG00001044568.
DR   EnsemblGenomes-Gn; EBG00001044569.
DR   EnsemblGenomes-Gn; EBG00001044570.
DR   EnsemblGenomes-Gn; EBG00001044571.
DR   EnsemblGenomes-Gn; EBG00001044573.
DR   EnsemblGenomes-Gn; EBG00001044574.
DR   EnsemblGenomes-Gn; EBG00001044575.
DR   EnsemblGenomes-Gn; EBG00001044576.
DR   EnsemblGenomes-Gn; EBG00001044577.
DR   EnsemblGenomes-Gn; EBG00001044578.
DR   EnsemblGenomes-Gn; EBG00001044580.
DR   EnsemblGenomes-Gn; EBG00001044582.
DR   EnsemblGenomes-Gn; EBG00001044584.
DR   EnsemblGenomes-Gn; EBG00001044587.
DR   EnsemblGenomes-Gn; EBG00001044589.
DR   EnsemblGenomes-Gn; EBG00001044591.
DR   EnsemblGenomes-Gn; EBG00001044593.
DR   EnsemblGenomes-Gn; EBG00001044595.
DR   EnsemblGenomes-Gn; EBG00001044597.
DR   EnsemblGenomes-Gn; EBG00001044599.
DR   EnsemblGenomes-Gn; EBG00001044600.
DR   EnsemblGenomes-Gn; EBG00001044601.
DR   EnsemblGenomes-Gn; EBG00001044602.
DR   EnsemblGenomes-Gn; EBG00001044603.
DR   EnsemblGenomes-Gn; EBG00001044605.
DR   EnsemblGenomes-Gn; EBG00001044606.
DR   EnsemblGenomes-Gn; EBG00001044607.
DR   EnsemblGenomes-Gn; EBG00001044608.
DR   EnsemblGenomes-Gn; EBG00001044609.
DR   EnsemblGenomes-Gn; EBG00001044610.
DR   EnsemblGenomes-Gn; EBG00001044611.
DR   EnsemblGenomes-Gn; EBG00001044612.
DR   EnsemblGenomes-Gn; EBG00001044613.
DR   EnsemblGenomes-Gn; EBG00001044614.
DR   EnsemblGenomes-Gn; EBG00001044615.
DR   EnsemblGenomes-Gn; EBG00001044616.
DR   EnsemblGenomes-Gn; EBG00001044617.
DR   EnsemblGenomes-Gn; EBG00001044618.
DR   EnsemblGenomes-Gn; EBG00001044619.
DR   EnsemblGenomes-Gn; EBG00001044620.
DR   EnsemblGenomes-Gn; EBG00001044621.
DR   EnsemblGenomes-Gn; EBG00001044622.
DR   EnsemblGenomes-Gn; EBG00001044624.
DR   EnsemblGenomes-Gn; EBG00001044625.
DR   EnsemblGenomes-Gn; EBG00001044626.
DR   EnsemblGenomes-Gn; EBG00001044627.
DR   EnsemblGenomes-Gn; Geob_C001.
DR   EnsemblGenomes-Gn; Geob_C002.
DR   EnsemblGenomes-Gn; Geob_C003.
DR   EnsemblGenomes-Gn; Geob_C004.
DR   EnsemblGenomes-Gn; Geob_C005.
DR   EnsemblGenomes-Gn; Geob_C006.
DR   EnsemblGenomes-Gn; Geob_C007.
DR   EnsemblGenomes-Gn; Geob_C008.
DR   EnsemblGenomes-Gn; Geob_C009.
DR   EnsemblGenomes-Gn; Geob_C010.
DR   EnsemblGenomes-Gn; Geob_C011.
DR   EnsemblGenomes-Gn; Geob_C012.
DR   EnsemblGenomes-Gn; Geob_C013.
DR   EnsemblGenomes-Gn; Geob_C014.
DR   EnsemblGenomes-Gn; Geob_C015.
DR   EnsemblGenomes-Gn; Geob_C016.
DR   EnsemblGenomes-Gn; Geob_C017.
DR   EnsemblGenomes-Gn; Geob_C018.
DR   EnsemblGenomes-Gn; Geob_C019.
DR   EnsemblGenomes-Gn; Geob_C020.
DR   EnsemblGenomes-Gn; Geob_C021.
DR   EnsemblGenomes-Gn; Geob_C022.
DR   EnsemblGenomes-Gn; Geob_C023.
DR   EnsemblGenomes-Gn; Geob_C024.
DR   EnsemblGenomes-Gn; Geob_C025.
DR   EnsemblGenomes-Gn; Geob_C026.
DR   EnsemblGenomes-Gn; Geob_R0001.
DR   EnsemblGenomes-Gn; Geob_R0002.
DR   EnsemblGenomes-Gn; Geob_R0003.
DR   EnsemblGenomes-Gn; Geob_R0004.
DR   EnsemblGenomes-Gn; Geob_R0005.
DR   EnsemblGenomes-Gn; Geob_R0006.
DR   EnsemblGenomes-Gn; Geob_R0007.
DR   EnsemblGenomes-Gn; Geob_R0008.
DR   EnsemblGenomes-Gn; Geob_R0009.
DR   EnsemblGenomes-Gn; Geob_R0010.
DR   EnsemblGenomes-Gn; Geob_R0011.
DR   EnsemblGenomes-Gn; Geob_R0012.
DR   EnsemblGenomes-Gn; Geob_R0013.
DR   EnsemblGenomes-Gn; Geob_R0014.
DR   EnsemblGenomes-Gn; Geob_R0015.
DR   EnsemblGenomes-Gn; Geob_R0016.
DR   EnsemblGenomes-Gn; Geob_R0017.
DR   EnsemblGenomes-Gn; Geob_R0018.
DR   EnsemblGenomes-Gn; Geob_R0019.
DR   EnsemblGenomes-Gn; Geob_R0020.
DR   EnsemblGenomes-Gn; Geob_R0021.
DR   EnsemblGenomes-Gn; Geob_R0022.
DR   EnsemblGenomes-Gn; Geob_R0023.
DR   EnsemblGenomes-Gn; Geob_R0024.
DR   EnsemblGenomes-Gn; Geob_R0026.
DR   EnsemblGenomes-Gn; Geob_R0027.
DR   EnsemblGenomes-Gn; Geob_R0028.
DR   EnsemblGenomes-Gn; Geob_R0029.
DR   EnsemblGenomes-Gn; Geob_R0030.
DR   EnsemblGenomes-Gn; Geob_R0031.
DR   EnsemblGenomes-Gn; Geob_R0032.
DR   EnsemblGenomes-Gn; Geob_R0033.
DR   EnsemblGenomes-Gn; Geob_R0034.
DR   EnsemblGenomes-Gn; Geob_R0035.
DR   EnsemblGenomes-Gn; Geob_R0036.
DR   EnsemblGenomes-Gn; Geob_R0037.
DR   EnsemblGenomes-Gn; Geob_R0038.
DR   EnsemblGenomes-Gn; Geob_R0039.
DR   EnsemblGenomes-Gn; Geob_R0040.
DR   EnsemblGenomes-Gn; Geob_R0041.
DR   EnsemblGenomes-Gn; Geob_R0042.
DR   EnsemblGenomes-Gn; Geob_R0043.
DR   EnsemblGenomes-Gn; Geob_R0044.
DR   EnsemblGenomes-Gn; Geob_R0045.
DR   EnsemblGenomes-Gn; Geob_R0046.
DR   EnsemblGenomes-Gn; Geob_R0047.
DR   EnsemblGenomes-Gn; Geob_R0048.
DR   EnsemblGenomes-Gn; Geob_R0049.
DR   EnsemblGenomes-Gn; Geob_R0050.
DR   EnsemblGenomes-Gn; Geob_R0051.
DR   EnsemblGenomes-Gn; Geob_R0053.
DR   EnsemblGenomes-Gn; Geob_R0054.
DR   EnsemblGenomes-Gn; Geob_R0055.
DR   EnsemblGenomes-Gn; Geob_R0056.
DR   EnsemblGenomes-Gn; Geob_R0057.
DR   EnsemblGenomes-Gn; Geob_R0058.
DR   EnsemblGenomes-Gn; Geob_R0059.
DR   EnsemblGenomes-Gn; Geob_R0060.
DR   EnsemblGenomes-Gn; Geob_R0061.
DR   EnsemblGenomes-Gn; Geob_R0062.
DR   EnsemblGenomes-Tr; EBT00001647172.
DR   EnsemblGenomes-Tr; EBT00001647173.
DR   EnsemblGenomes-Tr; EBT00001647174.
DR   EnsemblGenomes-Tr; EBT00001647175.
DR   EnsemblGenomes-Tr; EBT00001647176.
DR   EnsemblGenomes-Tr; EBT00001647177.
DR   EnsemblGenomes-Tr; EBT00001647178.
DR   EnsemblGenomes-Tr; EBT00001647179.
DR   EnsemblGenomes-Tr; EBT00001647180.
DR   EnsemblGenomes-Tr; EBT00001647181.
DR   EnsemblGenomes-Tr; EBT00001647182.
DR   EnsemblGenomes-Tr; EBT00001647183.
DR   EnsemblGenomes-Tr; EBT00001647184.
DR   EnsemblGenomes-Tr; EBT00001647185.
DR   EnsemblGenomes-Tr; EBT00001647186.
DR   EnsemblGenomes-Tr; EBT00001647187.
DR   EnsemblGenomes-Tr; EBT00001647188.
DR   EnsemblGenomes-Tr; EBT00001647189.
DR   EnsemblGenomes-Tr; EBT00001647190.
DR   EnsemblGenomes-Tr; EBT00001647191.
DR   EnsemblGenomes-Tr; EBT00001647192.
DR   EnsemblGenomes-Tr; EBT00001647193.
DR   EnsemblGenomes-Tr; EBT00001647194.
DR   EnsemblGenomes-Tr; EBT00001647195.
DR   EnsemblGenomes-Tr; EBT00001647196.
DR   EnsemblGenomes-Tr; EBT00001647197.
DR   EnsemblGenomes-Tr; EBT00001647198.
DR   EnsemblGenomes-Tr; EBT00001647199.
DR   EnsemblGenomes-Tr; EBT00001647200.
DR   EnsemblGenomes-Tr; EBT00001647201.
DR   EnsemblGenomes-Tr; EBT00001647202.
DR   EnsemblGenomes-Tr; EBT00001647203.
DR   EnsemblGenomes-Tr; EBT00001647204.
DR   EnsemblGenomes-Tr; EBT00001647205.
DR   EnsemblGenomes-Tr; EBT00001647206.
DR   EnsemblGenomes-Tr; EBT00001647207.
DR   EnsemblGenomes-Tr; EBT00001647208.
DR   EnsemblGenomes-Tr; EBT00001647209.
DR   EnsemblGenomes-Tr; EBT00001647210.
DR   EnsemblGenomes-Tr; EBT00001647211.
DR   EnsemblGenomes-Tr; EBT00001647212.
DR   EnsemblGenomes-Tr; EBT00001647213.
DR   EnsemblGenomes-Tr; EBT00001647214.
DR   EnsemblGenomes-Tr; EBT00001647215.
DR   EnsemblGenomes-Tr; EBT00001647216.
DR   EnsemblGenomes-Tr; EBT00001647217.
DR   EnsemblGenomes-Tr; EBT00001647218.
DR   EnsemblGenomes-Tr; EBT00001647219.
DR   EnsemblGenomes-Tr; EBT00001647220.
DR   EnsemblGenomes-Tr; EBT00001647221.
DR   EnsemblGenomes-Tr; EBT00001647222.
DR   EnsemblGenomes-Tr; EBT00001647223.
DR   EnsemblGenomes-Tr; EBT00001647224.
DR   EnsemblGenomes-Tr; EBT00001647225.
DR   EnsemblGenomes-Tr; EBT00001647226.
DR   EnsemblGenomes-Tr; EBT00001647227.
DR   EnsemblGenomes-Tr; EBT00001647228.
DR   EnsemblGenomes-Tr; EBT00001647229.
DR   EnsemblGenomes-Tr; EBT00001647230.
DR   EnsemblGenomes-Tr; EBT00001647231.
DR   EnsemblGenomes-Tr; EBT00001647232.
DR   EnsemblGenomes-Tr; EBT00001647233.
DR   EnsemblGenomes-Tr; EBT00001647234.
DR   EnsemblGenomes-Tr; EBT00001647235.
DR   EnsemblGenomes-Tr; EBT00001647236.
DR   EnsemblGenomes-Tr; EBT00001647237.
DR   EnsemblGenomes-Tr; EBT00001647238.
DR   EnsemblGenomes-Tr; EBT00001647239.
DR   EnsemblGenomes-Tr; EBT00001647240.
DR   EnsemblGenomes-Tr; EBT00001647241.
DR   EnsemblGenomes-Tr; EBT00001647242.
DR   EnsemblGenomes-Tr; EBT00001647243.
DR   EnsemblGenomes-Tr; EBT00001647244.
DR   EnsemblGenomes-Tr; EBT00001647245.
DR   EnsemblGenomes-Tr; EBT00001647246.
DR   EnsemblGenomes-Tr; EBT00001647247.
DR   EnsemblGenomes-Tr; EBT00001647248.
DR   EnsemblGenomes-Tr; EBT00001647249.
DR   EnsemblGenomes-Tr; EBT00001647250.
DR   EnsemblGenomes-Tr; EBT00001647251.
DR   EnsemblGenomes-Tr; EBT00001647252.
DR   EnsemblGenomes-Tr; EBT00001647253.
DR   EnsemblGenomes-Tr; EBT00001647254.
DR   EnsemblGenomes-Tr; EBT00001647255.
DR   EnsemblGenomes-Tr; EBT00001647256.
DR   EnsemblGenomes-Tr; EBT00001647257.
DR   EnsemblGenomes-Tr; EBT00001647258.
DR   EnsemblGenomes-Tr; EBT00001647259.
DR   EnsemblGenomes-Tr; EBT00001647260.
DR   EnsemblGenomes-Tr; EBT00001647261.
DR   EnsemblGenomes-Tr; Geob_C001-1.
DR   EnsemblGenomes-Tr; Geob_C002-1.
DR   EnsemblGenomes-Tr; Geob_C003-1.
DR   EnsemblGenomes-Tr; Geob_C004-1.
DR   EnsemblGenomes-Tr; Geob_C005-1.
DR   EnsemblGenomes-Tr; Geob_C006-1.
DR   EnsemblGenomes-Tr; Geob_C007-1.
DR   EnsemblGenomes-Tr; Geob_C008-1.
DR   EnsemblGenomes-Tr; Geob_C009-1.
DR   EnsemblGenomes-Tr; Geob_C010-1.
DR   EnsemblGenomes-Tr; Geob_C011-1.
DR   EnsemblGenomes-Tr; Geob_C012-1.
DR   EnsemblGenomes-Tr; Geob_C013-1.
DR   EnsemblGenomes-Tr; Geob_C014-1.
DR   EnsemblGenomes-Tr; Geob_C015-1.
DR   EnsemblGenomes-Tr; Geob_C016-1.
DR   EnsemblGenomes-Tr; Geob_C017-1.
DR   EnsemblGenomes-Tr; Geob_C018-1.
DR   EnsemblGenomes-Tr; Geob_C019-1.
DR   EnsemblGenomes-Tr; Geob_C020-1.
DR   EnsemblGenomes-Tr; Geob_C021-1.
DR   EnsemblGenomes-Tr; Geob_C022-1.
DR   EnsemblGenomes-Tr; Geob_C023-1.
DR   EnsemblGenomes-Tr; Geob_C024-1.
DR   EnsemblGenomes-Tr; Geob_C025-1.
DR   EnsemblGenomes-Tr; Geob_C026-1.
DR   EnsemblGenomes-Tr; Geob_R0001-1.
DR   EnsemblGenomes-Tr; Geob_R0002-1.
DR   EnsemblGenomes-Tr; Geob_R0003-1.
DR   EnsemblGenomes-Tr; Geob_R0004-1.
DR   EnsemblGenomes-Tr; Geob_R0005-1.
DR   EnsemblGenomes-Tr; Geob_R0006-1.
DR   EnsemblGenomes-Tr; Geob_R0007-1.
DR   EnsemblGenomes-Tr; Geob_R0008-1.
DR   EnsemblGenomes-Tr; Geob_R0009-1.
DR   EnsemblGenomes-Tr; Geob_R0010-1.
DR   EnsemblGenomes-Tr; Geob_R0011-1.
DR   EnsemblGenomes-Tr; Geob_R0012-1.
DR   EnsemblGenomes-Tr; Geob_R0013-1.
DR   EnsemblGenomes-Tr; Geob_R0014-1.
DR   EnsemblGenomes-Tr; Geob_R0015-1.
DR   EnsemblGenomes-Tr; Geob_R0016-1.
DR   EnsemblGenomes-Tr; Geob_R0017-1.
DR   EnsemblGenomes-Tr; Geob_R0018-1.
DR   EnsemblGenomes-Tr; Geob_R0019-1.
DR   EnsemblGenomes-Tr; Geob_R0020-1.
DR   EnsemblGenomes-Tr; Geob_R0021-1.
DR   EnsemblGenomes-Tr; Geob_R0022-1.
DR   EnsemblGenomes-Tr; Geob_R0023-1.
DR   EnsemblGenomes-Tr; Geob_R0024-1.
DR   EnsemblGenomes-Tr; Geob_R0026-1.
DR   EnsemblGenomes-Tr; Geob_R0027-1.
DR   EnsemblGenomes-Tr; Geob_R0028-1.
DR   EnsemblGenomes-Tr; Geob_R0029-1.
DR   EnsemblGenomes-Tr; Geob_R0030-1.
DR   EnsemblGenomes-Tr; Geob_R0031-1.
DR   EnsemblGenomes-Tr; Geob_R0032-1.
DR   EnsemblGenomes-Tr; Geob_R0033-1.
DR   EnsemblGenomes-Tr; Geob_R0034-1.
DR   EnsemblGenomes-Tr; Geob_R0035-1.
DR   EnsemblGenomes-Tr; Geob_R0036-1.
DR   EnsemblGenomes-Tr; Geob_R0037-1.
DR   EnsemblGenomes-Tr; Geob_R0038-1.
DR   EnsemblGenomes-Tr; Geob_R0039-1.
DR   EnsemblGenomes-Tr; Geob_R0040-1.
DR   EnsemblGenomes-Tr; Geob_R0041-1.
DR   EnsemblGenomes-Tr; Geob_R0042-1.
DR   EnsemblGenomes-Tr; Geob_R0043-1.
DR   EnsemblGenomes-Tr; Geob_R0044-1.
DR   EnsemblGenomes-Tr; Geob_R0045-1.
DR   EnsemblGenomes-Tr; Geob_R0046-1.
DR   EnsemblGenomes-Tr; Geob_R0047-1.
DR   EnsemblGenomes-Tr; Geob_R0048-1.
DR   EnsemblGenomes-Tr; Geob_R0049-1.
DR   EnsemblGenomes-Tr; Geob_R0050-1.
DR   EnsemblGenomes-Tr; Geob_R0051-1.
DR   EnsemblGenomes-Tr; Geob_R0053-1.
DR   EnsemblGenomes-Tr; Geob_R0054-1.
DR   EnsemblGenomes-Tr; Geob_R0055-1.
DR   EnsemblGenomes-Tr; Geob_R0056-1.
DR   EnsemblGenomes-Tr; Geob_R0057-1.
DR   EnsemblGenomes-Tr; Geob_R0058-1.
DR   EnsemblGenomes-Tr; Geob_R0059-1.
DR   EnsemblGenomes-Tr; Geob_R0060-1.
DR   EnsemblGenomes-Tr; Geob_R0061-1.
DR   EnsemblGenomes-Tr; Geob_R0062-1.
DR   EuropePMC; PMC3001079; 20716518.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01322; CRISPR-DR9.
DR   RFAM; RF01733; atoC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; CP001390.
DR   SILVA-SSU; CP001390.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001414
CC   Source DNA and bacteria available from Joel Kostka
CC   (jkostka@ocean.fsu.edu)
CC   Contacts: Joel Kostka (jkostka@ocean.fsu.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Meta information:
CC    Organism display name:  Geobacter sp FRC-32
CC    Culture Collection IDs:
CC    GOLD ID:  Gi00944 http://genomesonline.org/GOLD_CARDS/Gi00944.html
CC    Sequencing Platforms:  Sanger
CC    Sequencing Coverage:  10x
CC    Sequencing Status:  Draft
CC    Phenotypes:  Iron reducer, Uranium reducer
CC    Diseases:  None
CC    Habitat:  Fresh water, Soil, Sediment
CC    Oxygen Requirement:  Anaerobe
CC    Cell Shape:  Rod-shaped
CC    Motility:  Motile
CC    Sporulation:  Nonsporulating
CC    Energy Source:  Chemolithotroph
CC    Temperature Range:  Mesophile
CC    Biotic Relationship:  Free living
CC    Isolation:  Uranium-contaminated subsurface at US.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4304501
FT                   /organism="Geobacter daltonii FRC-32"
FT                   /strain="FRC-32"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:316067"
FT   gene            185..1522
FT                   /gene="dnaA"
FT                   /locus_tag="Geob_0001"
FT   CDS_pept        185..1522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Geob_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18379"
FT                   /db_xref="GOA:B9M7S1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M7S1"
FT                   /protein_id="ACM18379.1"
FT                   /translation="MEKIWLEAQSNIKKVLTPQTYNTWIKPIHFHNVSDTNLTLEVPSK
FT                   FIKEWVTEKYLSIIIEAISSLTNIKYQVDFKITEKSQVEKKKVDLQATEKIENDSTRNV
FT                   DFNTNLNPKYTFDSFVCGASNQFAHAASQAVANNPACNYNPLFIYGGVGLGKTHLLIAI
FT                   GNQIRENNKKAKICYYSSEKFMNEMINSLRYKKMDEFRNKFRKMDILLIDDIQFMAGKE
FT                   ATQEEFFHTFNALYESHKQIVVTSDKFPKDIPGLEERLRSRFEWGLIADIQPPDIETKI
FT                   AILKKKSDLNSITLPNDVALFLASSATSNVRELEGMLIRLGAYASLTGSEISLNMARDI
FT                   LKDIIVEKTKDITVEMIQKHVADHFKIKVSELKSDKRLKTFVIPRQIAIYISRELTKAS
FT                   YPEIGERFGGKDHSTIIHSVKKIEKQMENDLEIKNTVEKMKKELMS"
FT   gene            1736..2854
FT                   /gene="dnaN"
FT                   /locus_tag="Geob_0002"
FT   CDS_pept        1736..2854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Geob_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18380"
FT                   /db_xref="GOA:B9M7S2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7S2"
FT                   /protein_id="ACM18380.1"
FT                   /translation="MEFSISKETFTKALQKIQGIVEKRNTMPILSNALIEASNGLLHIT
FT                   ATDLEVGMKSSYPVTIAKEGKITVAAKKIYEIIKELSDEEITFSTKENDWIEIHCGKAH
FT                   FNIVGLSPDEFPYFPKVNDNIFVNLSNNFLSEMIEKTSYAICTDESKFNLNGIFIKAAS
FT                   EEGRNVIRMVATDGHRLSVTNKEFEGAISNELSKGVIFPKKGIYELKKIAEEESGDIMM
FT                   GFMDNSAVIKKDNTVIVMRLIDGEFPDYTKVIPANNDKKVTVSREALLHSLRRMAILSS
FT                   EKFKGIKLDVRSGSIEISSSNPELGDAREEQEVLYDGTPLSVRFNARYLIDVLTVLRDD
FT                   QVELDLRDELSPIIMKPIAKDDFMSVIMPMRL"
FT   gene            2952..4046
FT                   /gene="recF"
FT                   /locus_tag="Geob_0003"
FT   CDS_pept        2952..4046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="Geob_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18381"
FT                   /db_xref="GOA:B9M7S3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M7S3"
FT                   /protein_id="ACM18381.1"
FT                   /translation="MKLNKIYLQSFRNLQETMLMPAQHFNIFYGNNGQGKTNLLESIFI
FT                   MATMKSFKTARSSDLVRWGAISSLLKGWVERDGVTREIAVFLDNQGKKIRVDQKAVTRI
FT                   DDFFGHLNVVVFTPEEVNMVKGLPELRRKYLDRAVFSSDITYLSVYHAYSKILKNRNML
FT                   LKRGEKASFDIWTEKLVEQGKNIILSRLAYLDALRDLLKRFYREISGNEEAVDISYRPY
FT                   HMDLADCRGDVADAFAEALAKTATEEERRGTTLAGPHRDDVEFILNGRPLKQFGSQGQQ
FT                   KSYVLALKMAETEYLQKKFHSQPIFLLDDLSSELDQERKKNLMEFLKKRDMQVFITTTS
FT                   LQNINVDEIENYRTYRIEEGKVLH"
FT   gene            4056..6440
FT                   /gene="gyrB"
FT                   /locus_tag="Geob_0004"
FT   CDS_pept        4056..6440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Geob_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18382"
FT                   /db_xref="GOA:B9M7S4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7S4"
FT                   /protein_id="ACM18382.1"
FT                   /translation="MSNDETSKDYGADKIKVLEGLSAVRKRPAMYIGSTSIQGLHHLVY
FT                   EVVDNSIDEALAGHCDDIAVTINVDGSVTVVDNGRGIPTDMHPTEGKSAAEVVLTVLHA
FT                   GGKFDNTSYKVSGGLHGVGVSVVNALSKKLELEIRRDGKIFKQSYRCGDPQGPLEVVGE
FT                   TKKRGTKIIFFPDDEIFETTEFSFDILSQRLRELAFLNAGVKIKIVDERTEKVHEFFYE
FT                   GGIRSFVEYLNKNKTPIHPQPIFINGEKGGVEMEIAMQYNDSYDEKVFSFANNINTHEG
FT                   GTHLVGFKAALTRTMNTYANTNNLLKNVKENISGEDLREGLTAVISVKISQPQFEGQTK
FT                   TKLGNSEVKGYVETLMNEKLATYLEENPQIAKRILEKSIDAARAREAARRARDLTRRKG
FT                   ALEVGTLPGKLADCQEKDPALCELFLVEGDSAGGSAKQGRDRKYQAILPLKGKILNVEK
FT                   ARFDKMLSSQEIRTLIAALGTSVGKGDFDIAKLRYHRIIIMTDADVDGSHILTLLLTFF
FT                   FRQMLELIERGYLYIAQPPLYKIKRGKKEQYLKNEAALQSYLLEEGTEDLILRFGSDER
FT                   TYRGKQIIPLLRQIIEHQSLFGKVVKKGVNEELLKIFLKSGVKSGLEEISELEPYLARM
FT                   KENFPDADYMPGDQKIIFMLGNLRVSIDQHIFDAINSYEYDLLVESQRKVETIMGNESA
FT                   TVATEEKQLLETESHEELLAFFLETAKKGLYIQRYKGLGEMNPEQLWETTMHPENRLLL
FT                   QVKIEDTVEAEEIFTVLMGDQVEPRREFIELNALNVSNLDI"
FT   gene            6492..9062
FT                   /gene="gyrA"
FT                   /locus_tag="Geob_0005"
FT   CDS_pept        6492..9062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="Geob_0005"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18383"
FT                   /db_xref="GOA:B9M7S5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7S5"
FT                   /protein_id="ACM18383.1"
FT                   /translation="MLTQTNKVAVNIEDEMKRSYMDYAMSVIIGRALPDVRDGLKPVHR
FT                   RCLYAMYDMGNDYNKPYKKSARVVGDVIGKYHPHGDTAVYDTLVRMAQDFSLRYPLVDG
FT                   QGNFGSVDGDSPAAMRYTEIRMYQLAHELLADIDKETVEMGPNYDDSLKEPLVLPAKFP
FT                   NLLVNGSSGIAVGMATNIPPHNLAEVIDGIVAVIHNPELTFEELIALIPGPDFPTAGFI
FT                   YGREGILSAYSTGRGIIQMRARAIVETHKKTERQSIVVTEIPYQVNKARLVEKIAELVR
FT                   EKKIEGISDLRDESDREGMRVVVELKKDENPQIVLNHLYKQTQMQSSFGIIMLAIVNNR
FT                   PKVLTLRETINHFIDHRREIVTRRTIFDLKKAEARAHILEGLKIALDWLDAVIELIRGS
FT                   KNPAEAKEGLMSGIFSDEEWLKKLGLSLPANHAEYAKPVMLSELQAQAILEMRLHRLTG
FT                   MERDKIIDEYHEILRYIARLKEILASETEILKIIVGELLELKEKFGDKRRTEIIDQTAE
FT                   ISLEDTIVEEDMVVTISHTGYIKRNAVTMYRAQRRGGKGKTGMKTKEEDFVEQLFIASS
FT                   KDYLMFFTDAGKVYWLKVYEIPEAGRATRGKAIVNLLNLSANEKITAILPVKEFAADKF
FT                   IMMATRHGVVKKTPLMEYSHPRLGGIIAVNLDEGDKLISVALTDGRQDVLLASRNGKSI
FT                   RFKESDVRTVGRVSRGVRGMTLEDDDVVIGMEIINEEYTDSTLFTVTENGFGKRTELGE
FT                   YRCQSRGGKGIITIKTTERNGCVVDIKQVVDENDLMLITDQGKILRVPVEGFSIIGRNT
FT                   QGVRLMVTEDDERVVAVARLAEKEEDDADESTDGGLDTEVEEQE"
FT   gene            9107..10669
FT                   /locus_tag="Geob_0006"
FT   CDS_pept        9107..10669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18384"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7S6"
FT                   /protein_id="ACM18384.1"
FT                   /translation="MHLRKIDTSLNDRRGILRQLERVKEENISLDELEEIGRSLKKNGK
FT                   SALRPLVRNLWLERRGDLISRYTYLLDFFEDEVWIDQLIQIALKRRDLDHDAKAAILAA
FT                   LEGYGVDVSHPPFSYLFAGIANSASISVPEVLDRGEEGLISFMEEFLLYPQEIRLMVIG
FT                   RLPEVGNPKVVDLLQILLRLDDGGVTPATLAALGRIREKASAELLRKYLSQAAEPLAGV
FT                   AARSLRRLSFLGVDAGNLSEQDTSLPFHICCAGPPDGDGYRTLFFSRTSGGDTFAILCL
FT                   QIHELIGIVGARGSASVVGSELEEELAELHGEEEVVPVEADYALCLMQDALYRNRETGT
FT                   ELPAEFYVRSGMFSRGQLVPAIYEPPLQPTKAKIRLTNNCLDEIADDDFFSCWFMTDSS
FT                   VYGYAAEWRDLQLKCSGRELTRGLELILARFCQELFPHSVERIHRRLLLVADLMRRVGR
FT                   DPRLAEKTAALAGNVVEFKLPYHFHPFLRRLALESMDMAREAMEEGFDTRRYESESGEE
FT                   WDD"
FT   gene            10721..11734
FT                   /gene="gpsA"
FT                   /locus_tag="Geob_0007"
FT   CDS_pept        10721..11734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="Geob_0007"
FT                   /product="sn-glycerol-3-phosphate 2-dehydrogenase,
FT                   NAD(P)-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18385"
FT                   /db_xref="GOA:B9M7S7"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7S7"
FT                   /protein_id="ACM18385.1"
FT                   /translation="MLIPEKIGVIGAGSWGTTLADLLAKKGHDVTLWAYEPELVVEMAR
FT                   TRYNSIFLPGISLSPVLKFTNLLQEAVADKGLLLFVVPSQVTRRVVKNALPFMSPSAII
FT                   VSASKGIEVDTLMTVSQVYRELLPHELYANFSALSGPSFAREVAQEMPTAVAVASERGD
FT                   IARKVQQIFNTRKFRVYTNNDVAGVELGGAIKNVIAIAAGISDGLGFGHNTRAALITRG
FT                   LAEMTRLGRALGAKEATFAGLAGMGDLVLTCTGDLSRNRTVGMQLGQGRRLAEILGEMR
FT                   MVAEGVKTTESAYNLAARLKVEMPITEKVYEVLYQDKPAREAVLELMTRDLKAEDY"
FT   gene            11804..14059
FT                   /locus_tag="Geob_0008"
FT   CDS_pept        11804..14059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0008"
FT                   /product="sensor histidine kinase, HAMP and PAS
FT                   domain-containing"
FT                   /note="domains: HAMP, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18386"
FT                   /db_xref="GOA:B9M7S8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7S8"
FT                   /protein_id="ACM18386.1"
FT                   /translation="MQFSLSIRSKLFLSILLILVVSYTTLLFTTVEGLESHIEHDIGKG
FT                   LEAHLNYARSQFYVRAEQIKYSLMQPIMAPPVQQHLIRRDSVWLKDAMRRWKKVLPFVD
FT                   VLTIIDPQNRVIARYNNQQRGDLFGIHEIVRQMYRDKKAVISIELVDKEFLQQEEDPAG
FT                   TDTEAMVVLVAIPVFNADGTLLGGVVAGDKINNDPYLPFQIQEIFGEEAEVAVSQRGMR
FT                   IASNRAEDNIQTATVESHVIERLQKGYSYRGKAEIGNNAYETVFEPLTNSRGEFVGSLS
FT                   VALSRENMQKIRVDSLKNILMSAIVGILLSFVIAFIAARKFAGPILELANGARRIELGD
FT                   LSQRVMVRNNDEIGDLAGSFNRMVNALAERDSIISRKNNDLQELNGLLEKKVSLRTAEL
FT                   SMEMGRLETILTSMVEGVLVTDSDSRVILFNPAAQAILGIVPYKVIGQSIEQLGNSGEF
FT                   SNLVRCIQEIKETWGPVASRQEDLTLKGKKLKINLAPMAREGNEFAGIVMSLRDITAEE
FT                   EIDRMKTEFISTVSHELKTPLTSMKGSLQLLLNRGKWLTETERQLLSVCLRNTQRLIRM
FT                   ISEILDISRMESGGMDFTFKPLSMGELVVYAIEEIKTFAHNRSISIVNSLGDHLPLVYG
FT                   DHDRLIQVLTNLLSNAVKFSPEGKIVMVLAEREGNYLVVSVTDRARAIQWSDREKLFKK
FT                   FQQLESDQPMQGGTGLGLAICKEIIEKHHGKIYYNAGKEGGNVFSFTVPIYEENHGK"
FT   gene            14049..15599
FT                   /locus_tag="Geob_0009"
FT   CDS_pept        14049..15599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0009"
FT                   /product="response receiver sensor histidine kinase, PAS
FT                   domain-containing"
FT                   /note="domains: REC, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18387"
FT                   /db_xref="GOA:B9M7S9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7S9"
FT                   /protein_id="ACM18387.1"
FT                   /translation="MANKKILIVDDEPDIALILKLQLEDAGYRTAIARDGVEGLEAIDR
FT                   DRFSLVLLDIKMPRIDGLQMLERVQNLHPEVAVVMMTAHGSEDIAVEAMKNGALDYIAK
FT                   PFSTEDVLQKVERAIQLNKAKRDNIRLQQQLDEERQKMEAVLQGMADLLLAVDPEGRII
FT                   TVNLKSEQVLGLNRDQLLGMPVEEALRADIAAESIPCRVVLRSGQPCLDVYYTIQAETA
FT                   AIPVSSSASPLFNASGQLTGSVEIIRDISAYKALEQEKEDFVSMLSHDLKAPITAVVGS
FT                   VDLVREGRLGPVNEDQREYLESSMESCAEMVEMIDTLLGVHKFEAGKMLMHFKEEMPSQ
FT                   LIQRTMTRFLTVARRAQLRLFATVQDHLPAISADRATFSRLLGNLISNALKFTAEGGEI
FT                   EISAVAVNDPETIRGKIPARYGAQKLTLDKPMVQITVRDTGEGIAEDSLEDIFDRFVQA
FT                   RNRRQGKSSGTGLGLTFCRKVMDAHQGFIWAESIVGRGSRFIMLFPAIVESDEVEHHE"
FT   gene            15618..17453
FT                   /gene="fgrK"
FT                   /locus_tag="Geob_0010"
FT   CDS_pept        15618..17453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgrK"
FT                   /locus_tag="Geob_0010"
FT                   /product="sensor histidine kinase of FgrL, PAS and PAS
FT                   domain-containing"
FT                   /note="domains: PAS, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18388"
FT                   /db_xref="GOA:B9M7T0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7T0"
FT                   /protein_id="ACM18388.1"
FT                   /translation="MERAFKISLKITVIYILVGAVWILFSDELLAYLVQDVRTIKLVSI
FT                   SKGWFFVAATGLMLYFLVRRHMLLLIRSETAVRERNRELARTEEELRRQIVEQQKTEAK
FT                   LHGANQRLRTLFHTSPLAIVALDPGGRVTQWNKAAQSLFGWTAEEIKGSPYPLLPEWSL
FT                   EEQRQFMEKTLRGEVSNDIQVRRKKKNGELLDVSLSIAPTRDADGAVTGIMAILADITE
FT                   RRKAEEASQASKQLYVELVDSIDGIVWELDYKTFCFTFVSKRAEELLGYPAEEWLKSSS
FT                   FWQDHLHPADRDGTVRLCLAASDQGKNHELVYRFLAANGDYVWLRDIVTVSTEKGHVAK
FT                   LRGVMFDITTQKIAAEALLASEERYRSLNAELEKRVMERTAQLEEANRELESFSYSVSH
FT                   DLRAPLRHIEGFSQLLLEDYGKQLDEEGQSHLLRLKRASQRMSQLIDDLLELSRVTRSE
FT                   LNCQATNLSRMAHLVLLELGQSQPERKVKWEIAEDVMADGDARLLRVVMENLLGNAWKY
FT                   TARNEEAIIEFGSYMDRGAAIYYVRDNGAGFDMKYADKLFAPFQRLHRTEEFEGTGIGL
FT                   ATVKRIVGRHGGRIWAESAPEAGATFYFTLSGVGE"
FT   gene            17450..19577
FT                   /gene="fgrL"
FT                   /locus_tag="Geob_0011"
FT   CDS_pept        join(17450..17943,17945..19577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgrL"
FT                   /locus_tag="Geob_0011"
FT                   /product="flagellar biogenesis master response receiver
FT                   sensor histidine kinase, PAS and GAF domain-containing"
FT                   /note="domains: REC, PAS, GAF, HisKA, HATPase_c; possible
FT                   homopolymeric tract sequence error"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AID57964"
FT                   /db_xref="GOA:A0A068F214"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A068F214"
FT                   /protein_id="AID57964.1"
FT                   /translation="MKRPLRILLVEDSEEDVLLLLRVLKDGGFEPVWQRVETAADMGRA
FT                   LAEQKWDLVISDYNMPQFDALEALNILHGSNLDLPFIIVSGKIGEDLAIAAMKSGAHDY
FT                   LMKDNLSRLMPAVDRELREAADRQKHRSAQEDIRRGKMQWEAVFDSVSDLIIITDTEGR
FT                   ITCCSYADILGRNIGRLFYGEENISSRTFLFPHKFHAAAEEDLVFPLLNGWFSVASYPM
FT                   NVENEPVGIVFIIRDITKRKRMEEEKRVIDRELLTLYAIAFRLNTKQSLEKIMEDLLFQ
FT                   LHNMLRIEFSCIQTLRHKELKLTASLGLDPELEKVLKSLPVDTPWVKSMLKGKLAKART
FT                   PARLLPANVAQAITRVGITAWCTIPLRIGSEVIGVMMVASSAKKSYSDREVFLLTLIAN
FT                   QLAVLIENYTLYDQMREKATELQRSRKALKENLLEVKRANIELDRLNVAKNNFIGMASH
FT                   ELKTPITSIMGGVQFLLKYGGLQMTPEQENILISVYEGIGQLKCLVENLLSISRIEAKE
FT                   IIPHKKPLRLLVLCKEVYGNFSLPLTGRKITVDFTGAEDEVPVDESLASLAIRNLLENA
FT                   IKFTPDGGEVQIRGEVLGKKDIVSQSRTIGPFYRNFPKNLSGSCFYRLNVTDNGIGIPA
FT                   EEQVRIFEKFYGVGDIAYHSSGTSDFMSKGTGLGLSIVRGVMDAHGGLVWVSQRKDANG
FT                   SVFTLLFPMDSDCL"
FT                   /artificial_location="low-quality sequence region"
FT   gene            19574..20503
FT                   /locus_tag="Geob_0012"
FT   CDS_pept        19574..20503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0012"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18389"
FT                   /db_xref="GOA:B9M7T1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7T1"
FT                   /protein_id="ACM18389.1"
FT                   /translation="MTNPAVSIKSVSKAYGSFAAVGNFSLEVERGMIFALLGPNGAGKT
FT                   TLIKILTTLMRPTSGDAFIEGYSVLGQAKQVRRLIGVVPQENNLDRYLTARENLVFHAR
FT                   MHGMSPHLYNQRIDRLLELIGLANRQNDFPDTFSGGMQRRLVVARALVHEPQVLFLDEP
FT                   TTGLDPQSRRVLWDYIQTLRSRMTIFLTTHYMDEADTFCDRIMIMDHGKALVDGTASAL
FT                   KEALSRAHIYEVEFRNHSDHYEEILHSLSFVDSLERNGNIFRLALAGEESLKPLMDCLG
FT                   SNDVRKICLQEPTLEDVFLELTGRTIRE"
FT   gene            20515..21270
FT                   /locus_tag="Geob_0013"
FT   CDS_pept        20515..21270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0013"
FT                   /product="ABC transporter, membrane protein, ABC-2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18390"
FT                   /db_xref="GOA:B9M7T2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7T2"
FT                   /protein_id="ACM18390.1"
FT                   /translation="MFRGGLTIWRRDMLVMRRSIFSELLAVTAYPLTLYLAFGFGLKGY
FT                   IADVEGIPYPLFIAPGLISMTAVNAAFTESAWSMWFHRRVQHTIEEYRVTPITVYDIVV
FT                   GKIFSGFCQGAIKGMAVAVVIFLLTPFRMDYSNLIAYLVYIVLGSMIFSCLGTVCGTTI
FT                   DKPENIGRVESVIIVPLIFMAGIFFPLSSYPATIQPLIRILPTTAIFEGARQALLHGAL
FT                   DWQYIIVLVVSAAVTFAVAAVTFNRKMSE"
FT   gene            21363..22442
FT                   /locus_tag="Geob_0014"
FT   CDS_pept        21363..22442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0014"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18391"
FT                   /db_xref="GOA:B9M7T3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7T3"
FT                   /protein_id="ACM18391.1"
FT                   /translation="MAEEFIPKWIAWETTQKCNLKCVHCRCSSDLTSSEGDFTTDEGKK
FT                   LLKEIADFSKPVVVLSGGEPLMRQDIFELAGYGTSLGLRMCMATNGALVTDEVCQKMKE
FT                   ADIKMVSLSLDGSTAAVHDNFRQCPGAFDGVVRAAELFRKHGQKFLINSSFTKRNQNDI
FT                   ANTFKVAKSLGATAWYMFMIVPTGRGEEIMNELISKEDYEEILDWHYQQEKMEDDILMR
FT                   PTCAPHYYRIVPQKAKAEGSSFERRSLTFSTGGGKGCIAAQTICLIDCFGNVKPCSYFH
FT                   RTAGNVKETPFREIWESSQIFKELRNFKDYKGKCGQCEYLNVCGGCRARADAVYGDYMA
FT                   EEPFCNYVPIRIQKQSEKK"
FT   gene            22574..23593
FT                   /gene="hemE"
FT                   /locus_tag="Geob_0015"
FT   CDS_pept        22574..23593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="Geob_0015"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18392"
FT                   /db_xref="GOA:B9M7T4"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M7T4"
FT                   /protein_id="ACM18392.1"
FT                   /translation="MNTRFLDACWGKPVDRTPVWLMRQAGRYLPDYMRVRSKCTFLELC
FT                   KTPELAAEVTIQPVDILGVDAAILFSDILTPVEPMGMALDFVPGPVFEHPIRTMADVEK
FT                   LRIPQMEQDVPYVLETIKILRRELANKVPLIGFGGAPFTLACYMVEGKGSKDWATIKRM
FT                   MYAAPEVYAALMEKVTMMDMEYLNAQIKAGAQAIQIFDTWGGVLSPSDYEKFVLPYTTK
FT                   LINGLNRQNVPVIHFVKGAGTMLDTVKKAGGDVMGLDWHTNLGKARDILGSMAVQGNLD
FT                   PTVLFAPNDVIEKEVKRVLDENGGRSGHIFNLGHGILPTVPPENAIHMVECVHRLSQQ"
FT   gene            23646..23879
FT                   /locus_tag="Geob_0016"
FT   CDS_pept        23646..23879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18393"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7T5"
FT                   /protein_id="ACM18393.1"
FT                   /translation="MLKRTGMVAAGLLLMTGIAFAGVDVSVNVGVPAPRIPAPQVRVIE
FT                   KETIIIKEKKGHGKHKGHYKEKEGKKKHRGKD"
FT   gene            23963..24481
FT                   /locus_tag="Geob_0017"
FT   CDS_pept        23963..24481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0017"
FT                   /product="protein of unknown function DUF2127"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18394"
FT                   /db_xref="GOA:B9M7T6"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7T6"
FT                   /protein_id="ACM18394.1"
FT                   /translation="MTKPEMHDKAGGADILALLHGGKASVRAVAILEATKGLLVVLVGF
FT                   GLFALIHRDVQAIAEEVVRAVHLNPASHLPRVFLDAMASVNDAKLWVMAASAMAYAIIR
FT                   FIEAYGLWQQQMWAIWFGILTGCLYLPVEVYELFLSTSLLKILMLALNLLIVFWLALVR
FT                   WQATHRGSN"
FT   gene            24541..26865
FT                   /gene="norZ"
FT                   /locus_tag="Geob_0018"
FT   CDS_pept        24541..26865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norZ"
FT                   /locus_tag="Geob_0018"
FT                   /product="nitric oxide reductase, cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18395"
FT                   /db_xref="GOA:B9M7T7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7T7"
FT                   /protein_id="ACM18395.1"
FT                   /translation="MKISDRKMLLSPLWLQTAIVTFLLGFAVLGYLALRVSTDHPPIPR
FT                   QVLSADGSTLFTGEDIISGQQIFQKYGLMQYGTIYGHGAYLGPDFTAQYLHHQGMEMLS
FT                   FYRGQGLSDAEARERIRRELKANLYDLNTGTLKYTKGQDQAFGTMVDFYRDWFGTSGNS
FT                   KGLRRPAITNEGEIKRLTAFFSWAAWTSAAVRPDASYSYTNNWPADPLAGNEPTAQALL
FT                   WSVLSLAALLGGTGVVLFLFGRYKWLGWHGEEERLSERRFIMPDEVRLTPAQRATAWYF
FT                   LVVAGLFLCQGLLGGVNAHYHVESEGFFGLKLDQWLPYNLSRMWHVQLALFFVASSFLA
FT                   MGIFLAPMIARREPRHQDKLALLLFGALVVVVVGSLAGEAASIKDYIGLNGPWFWIGSQ
FT                   GWEYLDLGRLWQMLLTMGMFLWLVILVRGLKDTLQEEHPGNMPWLFLYSALSIPLFYAV
FT                   GMAFSKSSNFAVIDFWRFWVVHLWVEDFLELFTTIMVAYIFVLLGVVRARVANIIIYMD
FT                   IILYSIGGVIGTMHHLYFSGAPAIHMALGAFFSAMEVIPLVLLTYEAWRFMQLGAAGGE
FT                   KSMFATPSSQFPHKWAVMFLIAVGFWNFLGAGVFGFLINLPIVSYYEIGTQWTANHGHG
FT                   ALMGVYGMLAMGFFMFVARYFIPRDRASELAMRSSFWSMNIGLAWMLFINLFPVGVLQL
FT                   NDALTYSYWHARAPEFFQQPLVRVFEWLRFPGDAIFIVGGIFPVVYLAVRMFINRNRPG
FT                   GHGWQEEGEFTRLAGGENLKA"
FT   gene            26958..27179
FT                   /locus_tag="Geob_0019"
FT   CDS_pept        26958..27179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18396"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7T8"
FT                   /protein_id="ACM18396.1"
FT                   /translation="MENCELLEKCVFFNDKMGNMPSTASVIKMRYCREDSSGCARYLVC
FT                   KALGRENVPADLFPNQEDRARQLIASAR"
FT   gene            complement(27233..28132)
FT                   /gene="hslO"
FT                   /locus_tag="Geob_0020"
FT   CDS_pept        complement(27233..28132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="Geob_0020"
FT                   /product="chaperonin Hsp33"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18397"
FT                   /db_xref="GOA:B9M7T9"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7T9"
FT                   /protein_id="ACM18397.1"
FT                   /translation="MPVSDYLVRIISKNGKVRALACLTTELVNELCRRHDTWPTASAAL
FT                   GRALTGGALFGALLKTGQRVALKFEGNGPLQKILVEGDSNGAVRGCVGAPHVHLPEKNG
FT                   KLDVAGALGRAGFLTVTKDLGLKEPYRGTVQLFSSEIAEDLALYLTESEQIPSAIGLGV
FT                   YVEPDNSVAAAGGFLIQALPPADDAAVDTLMDRLAKLPPISELLRNGSKPEELLALLFA
FT                   DIPYDILERRALAFDCSCSRQKIERVLLSLGREELSDILEKQEQVTVDCEFCRESYIFD
FT                   RKALELLLAELTDSASSK"
FT   gene            complement(28123..28656)
FT                   /locus_tag="Geob_0021"
FT   CDS_pept        complement(28123..28656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18398"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7U0"
FT                   /protein_id="ACM18398.1"
FT                   /translation="MSIFDMLKNPALLDLIKDQHLKEIVTRREVRVSQDYFHRELIARA
FT                   MDEEIHELSMKFYDGYGEISGKVKKKLIPFSIPFSARFGVERIFFTPKEKMIFLKIEEV
FT                   KPVDVDFVTRKVVEKIPFLSYCEGTIACDLTQVPELQKFLAYNINGIKVCDFLTIKELL
FT                   FREGEMIGRLGLCL"
FT   gene            complement(28689..31061)
FT                   /locus_tag="Geob_0022"
FT   CDS_pept        complement(28689..31061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0022"
FT                   /product="peptidase, U32 family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18399"
FT                   /db_xref="GOA:B9M7U1"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7U1"
FT                   /protein_id="ACM18399.1"
FT                   /translation="MSFVEKTRKKPELLSPAGSLEAFFAAMEKGADAVYAGLQDFSARA
FT                   KAKNFSLSQMERMLAYAHSMGRRVYVTINTLVKESELPRLVEVLASLEEMRVDGVILQD
FT                   MATARLIRNFFPGIPLHASTQMTIHNSLGVKQLEKFGFQRVVLARELHLDEIRAIADST
FT                   TAEIECFIHGALCFSFSGQCYFSSFLGGHSGNRGRCAQPCRRQYTYRGKEGYYFSTNDF
FT                   SSIDLLPQLVDAGVSSLKIEGRMKSAEYVASVVGAYRQVLDAPERKRAEAVAAAKELLK
FT                   LSFGRVPTKGFLASHQPTDIATPSLKGATGRFLGAIKSIQGNRITFETKDKLHVGDRIR
FT                   VQPKSDMAGRAFTIKELYLGKQQVKQAHEKALVSTPSPFPFKIGDTVFKVSSETAFTMS
FT                   ESACLKKLDAVKGDKLPCKLQLAMVDHNLRIEAMVAGKNECLEFPLGQLEEARTTDMEA
FT                   VLTAQFNKTGDTAFTLASLAAPGFPAVLIPPVKLKEIRREFYRRLAEKVAGELKAHTRG
FT                   HRKAALQALAGRKAAKEASREELTVRLEHIRDYHLLHQNGIDSLIMPVSRANMHQVPLF
FT                   VRKLKAREQQVIWQLPFIIFEADIPFFREAVTTLTSLGFRRFEATNLSHFELLSGHAVE
FT                   ISTDYRLFSLNSQALLAWQELGASAATLYIEDDAENMAELLAADVPIKRRVIAYCGVPA
FT                   ITSKIRIKDVRNDVPVVSDRNDGYVVTNRDGLTVVTPNVMFSLTAFKGKLKEMGCSSFI
FT                   LDLSQISSADYGRIINAFDRGVELNGTSDFNFNRGLV"
FT   gene            31207..32643
FT                   /locus_tag="Geob_0023"
FT   CDS_pept        31207..32643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0023"
FT                   /product="response receiver histidine kinase"
FT                   /note="domains: REC, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18400"
FT                   /db_xref="GOA:B9M7U2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7U2"
FT                   /protein_id="ACM18400.1"
FT                   /translation="MPEQIRILILEDSEEDAVLLVRELKKGGMDLSHERIDTPTALERA
FT                   LVQRTWDIIIADYRMPGFNAVEALEILRGTDMDIPFIILSGKIGEDLAVAAMKAGANDY
FT                   VMKSNLSRLVPAIQRELREAEERKRRREAEEALKNQFRQITAIFDSMNAMVSVADMESH
FT                   ELLFMNRFGGKLAGGEWKGKKSHEVLNYDQSLCTKETLLRDGEPQPPFVWEYQNPISGR
FT                   WYQCIDKAIYWPDGRLVRLQIAVDISERKEIEQMKDEMISAVSHEMRTPLTAMLGFTEY
FT                   LLENEVDPSQLKNYLNTIYKETARLKELIGNFLDLQQINARMTTYRMHPLDVCLLIKDA
FT                   AGLFALDYDSGRLVVQCPRNIPPLQGDEARLHQVLTNLISNGLKYSQAPARVTVGAEAE
FT                   GDQVVVWVKDEGCGIPPELQEKIFEKFYRIDNTDRRHIGGTGLGLALVREIVAAHGGRV
FT                   WVTSEVGRGSTFFISLPTAG"
FT   gene            complement(32648..33121)
FT                   /locus_tag="Geob_0024"
FT   CDS_pept        complement(32648..33121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18401"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7U3"
FT                   /protein_id="ACM18401.1"
FT                   /translation="MRPFILMLTVILSLACFSPAPAKTPYLSAEELQAEAQKGFGEILD
FT                   LWRDGRYDQLFDRTVAGKGSKEQFVRKLATAAKKPACCWEKMQEVKVSVKNDYTVTLRA
FT                   KVGMEGEAAGTDHVTKSFKLQKEEGVWCISQADIFSLAGEGRKTSKKRTAKNN"
FT   misc_feature    complement(33189..33226)
FT                   /note="heptanucleotide repeats; Geob_R7201"
FT   misc_feature    33245..33310
FT                   /note="heptanucleotide repeats; Geob_R7202"
FT   gene            complement(33315..34334)
FT                   /gene="aroG-2"
FT                   /locus_tag="Geob_0025"
FT   CDS_pept        complement(33315..34334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG-2"
FT                   /locus_tag="Geob_0025"
FT                   /product="3-deoxy-D-arabino-heptulosonate-7-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18402"
FT                   /db_xref="GOA:B9M7U4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7U4"
FT                   /protein_id="ACM18402.1"
FT                   /translation="MIIVMKSGAVKKDREEVLKRVRELGYQPHVIHGATRDVIGAVGDE
FT                   RGKTVLQSIESMHGVESVVPILQPYKLASKEVKKETSIIPITDTLSIGGKEIVVMAGPC
FT                   SVESEEQIISSALAVKEAGAHVLRGGAFKPRTSPYSFQGLEEEGLKLLAKARDLTGLPI
FT                   VTEVVNPETADLVAEYSDILQIGARNAQNFALLKKVGQLSRPVLLKRGMSMTIQEFLMS
FT                   AEYILSEGNQKVILCERGIRTFETATRNTLDLSAIPVLKEKTHLPVIVDPSHGTGHYQY
FT                   VAPMAYAAVASGADGLIIEVHPDPERASSDGPQSLKPKKFARMMAQLKLFAEAADRRL"
FT   gene            34752..35531
FT                   /locus_tag="Geob_0026"
FT   CDS_pept        34752..35531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18403"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7U5"
FT                   /protein_id="ACM18403.1"
FT                   /translation="MKQPLILAAAVLISLLPLAGQADEGQKPIHPVISSARPGAEKPKE
FT                   AEQPKQVQVSGKVMQTMNGGGYTYILVKQADGNKIWLAIPQTSVELGAQLTFKPGMEMV
FT                   NLPSKSLNRTFDRIIFSEGIVDEGKNAKKGTKKSPGSKGAIAVAEGKIKVKKATGANAY
FT                   TVAELYKLKGKLNKKNIVVRGKVVRVSANIMGKNWIHLQDGSGDPKKGTHNLVVTSQAM
FT                   PVIGEVVTAKGVLYGDKDFGGGYKYVVIVEKAELEIQ"
FT   gene            35710..36168
FT                   /gene="yqaA"
FT                   /locus_tag="Geob_0027"
FT   CDS_pept        35710..36168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqaA"
FT                   /locus_tag="Geob_0027"
FT                   /product="membrane protein YqaA"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18404"
FT                   /db_xref="GOA:B9M7U6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7U6"
FT                   /protein_id="ACM18404.1"
FT                   /translation="MQDILLSHGYPALFLLSFLASTLVPLGSEWLLAIMLVNRHDPVAT
FT                   VAVATTGNLLGACTTYWLGIYGGPWLIRRVLRINEQAEARAKEFYRRYGSWSLLFSWLP
FT                   VIGDPLCLAGGLLRIGFVRFFGLVFLGKFCRYAAVAWLTLQGSKIITG"
FT   gene            36190..37488
FT                   /locus_tag="Geob_0028"
FT   CDS_pept        36190..37488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0028"
FT                   /product="zinc-dependent peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18405"
FT                   /db_xref="GOA:B9M7U7"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7U7"
FT                   /protein_id="ACM18405.1"
FT                   /translation="MITRRKKVLANGLRVVAVEMPHLHSVEIAVYIRVGGRNDPQQQAG
FT                   LSHFLEHMLFRGNEDYPAGIDLEVAFDAIGGSVNAATDEESTCYFSRVHPRHVEKGLQL
FT                   FASMLLRSTLTGLDVEKRIITEEALEDINDRGEETNPSNLSSKMMWPGHPLGMPTIGYL
FT                   ETINAITEQDLRRHLASFYVPSNSVVVVAGDIKADRIFSACEDAFADWSGQPLPALLRA
FT                   TGDQHRPQSLFVRDADSQVNLQIAFRGFARPDPRIMTTRLIRRILCGGGSSRLHLLLRE
FT                   KLGIVYSVDASISAYDETGSFGIELATAPENLPLAVREILNQVRRLAVEAVGDEELARV
FT                   KDGYFFDLEYSRDSTYEMQVRYGWGELMDIVRELEEDHAEAAAIDAHQLKEAAAALFAP
FT                   CNLNLVAVGPLKAGLKREVEKILLDYEQECTRE"
FT   gene            37491..37874
FT                   /gene="cbiX"
FT                   /locus_tag="Geob_0029"
FT   CDS_pept        37491..37874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiX"
FT                   /locus_tag="Geob_0029"
FT                   /product="sirohydrochlorin cobaltochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18406"
FT                   /db_xref="GOA:B9M7U8"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7U8"
FT                   /protein_id="ACM18406.1"
FT                   /translation="METAILIMAHGSRIPDANQAVHEIAGMVKKMTGYDIVEVSFREQH
FT                   APNIQKGIDACVARGAERILLLPYFLYLGAHVLEDLPAELEEARQRHPQVEMAMGKHLG
FT                   VHHKLAEIVVERIAQSLTEQRWY"
FT   gene            37874..38515
FT                   /gene="cbiC"
FT                   /locus_tag="Geob_0030"
FT   CDS_pept        37874..38515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiC"
FT                   /locus_tag="Geob_0030"
FT                   /product="cobalt-precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18407"
FT                   /db_xref="GOA:B9M7U9"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7U9"
FT                   /protein_id="ACM18407.1"
FT                   /translation="MSTHLRPEEIEAESFRLIEAEVGPHSWSFEEWQVVRRAIHTSADF
FT                   EYSRNLFFSAAAVVRGVAALRRGLGIVTDTNMALAGINRVRRERFGNRISCFVADAQVA
FT                   RAAQAEGVTRSILAMRKGAADPANGIFVIGNAPTSLFELLRLVREENFKPALVVGLPVG
FT                   FVGAAESKEALLALEDDYPGIPFITNRGRKGGSNVAAAVVNALLIMAEGG"
FT   gene            38526..39614
FT                   /gene="cbiD"
FT                   /locus_tag="Geob_0031"
FT   CDS_pept        38526..39614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /locus_tag="Geob_0031"
FT                   /product="cobalt-precorrin-5B C1-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18408"
FT                   /db_xref="GOA:B9M7V0"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M7V0"
FT                   /protein_id="ACM18408.1"
FT                   /translation="MTRAFLRSGYTTGACAAAAAKGAAEMLRDGQVIDRVEIILPGGEL
FT                   VPFTLRNQQLGDKFASCSVIKDAGDDPDITNGAEINVSLTIEPAPPGTKGEIAVSGGTG
FT                   IGKVTKPGLAVPVGEWAINPVPRKMIRVVINEVFAIRCVPSLMKVTVSIPNGEELAKKT
FT                   LNARLGIIGGLSILGTTGIVKPISAKAWTDTIDAAIDVALACGSKTLILSTGRTSELVA
FT                   ERHLQLGKLTQEEAFIMMGDHVGYALKTCAAKGVREIVIAGQFAKLLKVACGHEQTHVS
FT                   SSELDLQQLVSWLGPDPRTSGLVLLARRANTARQVLEESGNDPVLMAAVCERVKGFAAR
FT                   LVQESSIKVLLAGYGQEVLYFG"
FT   gene            39646..40863
FT                   /gene="cbiET"
FT                   /locus_tag="Geob_0032"
FT   CDS_pept        39646..40863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiET"
FT                   /locus_tag="Geob_0032"
FT                   /product="cobalt-precorrin-6B C5,C15-methyltransferase and
FT                   C12-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18409"
FT                   /db_xref="GOA:B9M7V1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7V1"
FT                   /protein_id="ACM18409.1"
FT                   /translation="MPQREKIYLIGAGIEGWEGFGATALETINKAEVLIGHQRLLDIFP
FT                   DFKGEKRVLEDLSIMLEYLKTTEKRTVVLGSGDPNFFGVARFILRNLPKERIEIFPNVT
FT                   SVQYAFARIKEPWDDAVFISVHGRGLKSAIDRIIASEKVAVLTDAVNSPAAIARELAAR
FT                   GAEGFEAWLCEDMGLPGEKFTKTDVRSLVNISCSPLNILILIKAWEPTLEHYPLIGIRD
FT                   EEFATAKKLITKEEVRAVTLAKLRLQDDLVMWDIGAGSGSVSIEASNLMPNGKIFALEK
FT                   NAQYLSFIRDNLKKFVARNVTLIEAFAPEGLEDLPDPDRVFIGGSGGMLEDIIEAVDRR
FT                   LKPEGQIVLNAVTLDTLTKAVEFLEDHGYSVEITCVNISRTKGLTEYKMFEAHNPVYII
FT                   AATKDD"
FT   misc_feature    40891..40964
FT                   /note="conserved nucleotide sequence; Geob_R6201"
FT   gene            41018..41743
FT                   /gene="cbiL"
FT                   /locus_tag="Geob_0033"
FT   CDS_pept        41018..41743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiL"
FT                   /locus_tag="Geob_0033"
FT                   /product="cobalt-sirohydrochlorin C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18410"
FT                   /db_xref="GOA:B9M7V2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7V2"
FT                   /protein_id="ACM18410.1"
FT                   /translation="MQNPKPGKIYAVGVGPGDPELVTRKAERIIRSVPVICTPTGTVDA
FT                   SSYALSIVEEFIDRNHQEVLVQVFPMKRDQEGLDTFWEKAAAQVAERVAAGKDVAFITI
FT                   GDPFLYSTFLYLYRIFRDRYPHLEIEVVPGISSINAASIAADLPLGMASDRIAILPTTY
FT                   EDEELRRTFENFDTIVLMKVSRVFDRVYALLQEMGLEKQAVFVRRVGSADEEVVTELAS
FT                   LVGRKLDYLSLLIVKKNLW"
FT   gene            41757..42548
FT                   /gene="cbiF"
FT                   /locus_tag="Geob_0034"
FT   CDS_pept        41757..42548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiF"
FT                   /locus_tag="Geob_0034"
FT                   /product="cobalt-precorrin-4 C11-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18411"
FT                   /db_xref="GOA:B9M7V3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7V3"
FT                   /protein_id="ACM18411.1"
FT                   /translation="MNAATENRIAFVGAGPGDAELITVKGARLLGEAEVVVYAGSLVDR
FT                   ELVRTYAANAQVFDSAGMTLEETTSALSEAVFAGKKTVRLHTGDPSIYGAIQEQMVELD
FT                   RLGIGYEVVPGVTSAFAAAATLKQELTLPEVTQTVIITRLAGRTPVPERETLARTAGIG
FT                   ATMVIYLSVAMIEQVVAELLQGAYTEQTPVAVVARATWPDEQVVEGTLADIAARVKEAG
FT                   IGKQALIVVGDVLSARREGLKAKSLLYDKGFSHEFRDGIVG"
FT   gene            42891..43745
FT                   /locus_tag="Geob_0035"
FT   CDS_pept        42891..43745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0035"
FT                   /product="KilA-N domain DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18412"
FT                   /db_xref="GOA:B9M7V4"
FT                   /db_xref="InterPro:IPR017880"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7V4"
FT                   /protein_id="ACM18412.1"
FT                   /translation="MAGKIDVQGKEITIISREREDYISLTDIARYRNAAEPFAVINNWM
FT                   RGRSTIELLGLWEKLSNPDFKPLEFERFKNEAGSNYFVLSPQRWIEATNAIGLVSKSGR
FT                   YGGTFAHKDIAFEFASWISVEFKLYLIKEFQRLKEEEARSKTLEWNLQRTLAKINYKIH
FT                   TDAIKDHLIPRRLTKTQITTIYATEADLLNVALFGMTSGEWRQNNPKQTGNMRDYATLE
FT                   QLVVLSNLESINSVLIYQGLSQQERIRQLNDAAITQMKSLTGNVNLRQLKESDNGLLPK
FT                   IVE"
FT   gene            43831..44889
FT                   /gene="cbiG"
FT                   /locus_tag="Geob_0036"
FT   CDS_pept        43831..44889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiG"
FT                   /locus_tag="Geob_0036"
FT                   /product="cobalt-precorrin-5A hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18413"
FT                   /db_xref="GOA:B9M7V5"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR021745"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7V5"
FT                   /protein_id="ACM18413.1"
FT                   /translation="MRIAIIAITRNGARLGAQLRDGFPRADLFVLQKYAGMAGKKAVPF
FT                   IGELKELVRRLWPETHGFIFIMATGIVVRMIAPLLEAKDKDPAVVVMDDAGRFSIPILS
FT                   GHLGGANELACRCAFLTGAREVITTATDANNLPSFDMLAKEEGWVIDDLSRVKVLNSLL
FT                   LDDAEIAAVDGTGRVRTWFHGRCNLSFHDTFIEALQSSAKGYLFVTNRQLPPQVQSEKL
FT                   LILRPRNLVLGIGCNSGTSAEEIGALVSANMKRLFLSMKSLKCIASATAKRAEPGLLTF
FT                   AERLGLSIAFYESEELNRVASPSPPSNHALAAIGATGVAEPAALLASGGGTMLLKKVKS
FT                   GNITLAIAECQN"
FT   gene            44909..45436
FT                   /locus_tag="Geob_0037"
FT   CDS_pept        44909..45436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18414"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7V6"
FT                   /protein_id="ACM18414.1"
FT                   /translation="MRLSVKTIVSCTLVLAFLAASALANDLAFEEREPDGFRGIAWGAP
FT                   VYEVEGLEFSKEGTAALRELYTRTNKQAAAQVTVYSRPDDQLKIGEATVTRIYYYFYKD
FT                   LFYGATAYFAGKDNYNKLLAACRKKFGEPALMENDRAEWKGSQASVLLLPTGVLSIDSE
FT                   EIKAQMEEPEGF"
FT   gene            45443..47785
FT                   /gene="cbiH/cbiP"
FT                   /locus_tag="Geob_0038"
FT   CDS_pept        45443..47785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiH/cbiP"
FT                   /locus_tag="Geob_0038"
FT                   /product="cobalt-precorrin-3 C17-methyltransferase and
FT                   adenosylcobyric acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18415"
FT                   /db_xref="GOA:B9M7V7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7V7"
FT                   /protein_id="ACM18415.1"
FT                   /translation="MAQSALYIVGIGPGGLNHMTFEAREALASSDVIVGYKTYLDFITP
FT                   LLAGKEVVSSGMLKEVERCNQALSIACSGKSVALVSSGDAGVYGMAGLALELAENLPAP
FT                   PDIIIIPGVSAVQAAAAVLGAPLMHDFAVISLSDLLTPWPVIEKRVAAAAAADFVIALY
FT                   NPKSKGRTMQIEAAQAIIAAQRAAGTPVGIVRNACREGEDMVVTTLDQMLDHDIDMFSI
FT                   VIIGNSATFVDQKGRMVTPRGYKTGSRFEVLGSKLKTENLEHRTSNLEPALSRAVMICG
FT                   TGSDVGKSVLTAGFCRILKKRGIGVAPFKSQNMALNSAVTPEGGEIGRAQAVQAEACGI
FT                   APHVDMNPVLLKPNSDVGSQVIVQGRVIGNMKVAEYNAYKPEAFVSVKESFSRLRQCHD
FT                   FIVIEGAGSIAEINLKQHDIANLKVAEMAGCPVILVADIDRGGVFAQIVGTIELLEPAE
FT                   RAMVKGIIINKFRGDASLLKSGIDFVEVRTGLPVLGVIPYFQGFRIADEDSVPLESRAA
FT                   ASRSRHAAGDKLQIGVIRMSRMSNYTDFDALENEPDVELRYIDSPKQMKGLDLIILPGS
FT                   KSTLTDLYFLMERGLYKAIREFGGAIFGICGGYQMLGRRVLDPFNVESDIKEAEGLSLL
FT                   DVETVMLMQKETHQVTGHLLAEMDLADGGRELTGYEIHMGETTRGDNALPFARIKCRSD
FT                   RLVDIEDGAVSRDGRIHGTYLHGIFDNAGFRTAFLNGIRRSKGLRERHKVIPIKDPYEL
FT                   LADHLERHLDMDRLFAICGLKSAKADR"
FT   gene            47800..48762
FT                   /gene="cbiB"
FT                   /locus_tag="Geob_0039"
FT   CDS_pept        47800..48762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiB"
FT                   /locus_tag="Geob_0039"
FT                   /product="adenosylcobinamide-phosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18416"
FT                   /db_xref="GOA:B9M7V8"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7V8"
FT                   /protein_id="ACM18416.1"
FT                   /translation="MSEPFINHVFVVIVAVILDLLLGDPPGLPHPVVGIGRLILFLEAH
FT                   LRRVFADARRGGIALLCITVGITCLSAALLLKVAALIHPIFATAVAIYLSWTCLASRSL
FT                   HRESMLVVDALRKGDLPAARIWLSRIVGRDTGDLDQTGVIRGVVETVAENTSDGVIAPL
FT                   VCLMIGGPVLGLAYKAVNTLDSMVGYKNDRYLHFGWASARFDDLANYLPARLTGLLLVL
FT                   AAPFAGLSAGSAWRIMRRDGRNHSSPNSGIPEAAAAGALGVQLGGVNYYFGKPVAKPTI
FT                   GDHVYPLSLAACHGAVRLMYGAEVLLLAGFVVFATVIYR"
FT   gene            48771..49862
FT                   /gene="cobD"
FT                   /locus_tag="Geob_0040"
FT   CDS_pept        48771..49862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /locus_tag="Geob_0040"
FT                   /product="L-threonine-O-3-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18417"
FT                   /db_xref="GOA:B9M7V9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7V9"
FT                   /protein_id="ACM18417.1"
FT                   /translation="MKTTFDHGGNVFSVARSLGIKPEDIADFSASINPLGISTAVKEAL
FT                   ISSFDRYTHYPDSDAVELSSGLAAFHGLDRNSVCVANGSTELIYLMPRFLKGRRALVIA
FT                   PAFSEYARALDRAGWDVAYLELDAENGFSLSVPLLEEKLSGGFDALFLCNPGNPTGKML
FT                   PLGTIKVVYRLCRASGTFLVLDEAFMDFCEAESAKHLLLDGGGVVLRSMTKFFAIPGLR
FT                   LGYAMGSPEIIPELVSLREPWSVNTPAQIAGLAAIADTDYRLRTLQTIAEERALLAAQL
FT                   ATLNGLTVYPSAANYLLVRLDEGPTAAELRQRLLARGLLIRDCSNFQGLDTRFFRVAVR
FT                   RRRENELLVREMEKTLGDAGKLV"
FT   gene            complement(49854..50681)
FT                   /locus_tag="Geob_0041"
FT   CDS_pept        complement(49854..50681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0041"
FT                   /product="PilZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18418"
FT                   /db_xref="GOA:B9M7W0"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR040638"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7W0"
FT                   /protein_id="ACM18418.1"
FT                   /translation="MSEQNLYYRDYFHVNQRARVDLPLGNGRFFHEWAVISSAHGDLIS
FT                   LRLSRDVLPHDLLLAKGEPVSVRAGSGGQGYRCHAVIEDVELEKVTLRLSGSVIPDELR
FT                   AYFRLDTLLEFNYSPAGKEETWELPGNRCIIGTGTGCAKPSSQQWNFQRSRLMEMCNDK
FT                   GNGEKHAAQPIIVNISGGGLRAQTVEEIQVGSVFNLAFHLPNSQPHQVQTLAEVIYCQP
FT                   LASVWHTSTSFSTGMRYLKINERSRDSIIKFVCSEEIKKIRNCNKNFHSMASN"
FT   gene            51022..51447
FT                   /locus_tag="Geob_0042"
FT   CDS_pept        51022..51447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0042"
FT                   /product="transcriptional regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18419"
FT                   /db_xref="GOA:B9M7W1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7W1"
FT                   /protein_id="ACM18419.1"
FT                   /translation="MSDKFNQDLKELKLKVTPKRLAILSLLAEELSYASPEEVWRKLQK
FT                   NFDSIGLPTVYRNLEELANGGLITKVIHPNRQLYYYFCPNGHHHHHFVCLSCRKVEDIN
FT                   FCGMEEIEKKVSGTVLSHIVQVNGLCRECSESQGGAI"
FT   gene            51444..52373
FT                   /gene="acdA"
FT                   /locus_tag="Geob_0043"
FT   CDS_pept        51444..52373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdA"
FT                   /locus_tag="Geob_0043"
FT                   /product="periplasmic divalent manganese/zinc-binding
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18420"
FT                   /db_xref="GOA:B9M7W2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7W2"
FT                   /protein_id="ACM18420.1"
FT                   /translation="MKKFLFLFMLLLVPALLSCEKREQHNSGKLKVVTTLFPLFDFARQ
FT                   IGGDKIDVTLLLPPGMEPHSFEPKPDDIIRVSRADIFIFTNRYMEPWAAQIAEAAAQKG
FT                   LTVDASRGVNLYKAGEEKAEEDGHGHRAGRVDPHVWLDFDNDRIMVDNILAAFVAKDPA
FT                   NRQYYTANAVAYKAKLADLDGRFKVGLSRCATRDFLHGGHFAFGYMARRYNLHYQSAYA
FT                   LNAEAEPTAGKLTSLIRQMRSSGLKYIYTEELLNPRVAETIARETGAQLLRLHGAHNIG
FT                   KADFDRGVTFISLMEENLKNLRTGLQCP"
FT   gene            52364..53116
FT                   /locus_tag="Geob_0044"
FT   CDS_pept        52364..53116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0044"
FT                   /product="divalent manganese/zinc ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18421"
FT                   /db_xref="GOA:B9M7W3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7W3"
FT                   /protein_id="ACM18421.1"
FT                   /translation="MSIEALSVKGLCSGYQGADVLQDLTFAVHSGDYVGVVGPNGSGKS
FT                   TLVKSILGLIKPERGAISLFGTPFAQFRDWNRIGYLPQGLQFFNPNFPATVAEVVRLGR
FT                   LAAKSFPRRFDRNDAAAVAKTLQWMDIAHIRDKMIGELSGGLRQRVLLARALVNEPELL
FT                   VLDEPTTALDPETREHFYQLLADMNRERNTTVILITHDTGTIGRYATKLLYLDKRVIFY
FT                   GGFDEFCKSAEMTGFFGEKAQHVVCHRH"
FT   misc_feature    complement(53122..53176)
FT                   /note="conserved nucleotide sequence; Geob_R4001"
FT   gene            53214..54035
FT                   /locus_tag="Geob_0045"
FT   CDS_pept        53214..54035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0045"
FT                   /product="divalent manganese/zinc ABC transporter, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18422"
FT                   /db_xref="GOA:B9M7W4"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7W4"
FT                   /protein_id="ACM18422.1"
FT                   /translation="MDLAEILSYGFLQRALVGGSLIAVLCSTLGIFLVLRRFSLIGDGL
FT                   AHVTFGSVALALFLGFQSVLMTVAAIPVVLLASIGILKLTDKAKIYGDTAIGIVSSLGI
FT                   AVGVMLASKAGGFNVDLFSYLFGNILSISMTELMLAAVLFLVVLISIFFFYNELFATTF
FT                   DEDLARSAGIQTSRINMVLVLLTALTVVLAMKVVGIMLISALLILPAVSALQLARSFKG
FT                   AIFSSALIGMGTVMISICLSLVLNLPAGATIVLFNFVIFAASFCFRLLRRR"
FT   misc_feature    54032..54167
FT                   /note="conserved nucleotide sequence; Geob_R8001"
FT   gene            54300..54743
FT                   /locus_tag="Geob_0046"
FT   CDS_pept        54300..54743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0046"
FT                   /product="response receiver"
FT                   /note="domains: REC"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18423"
FT                   /db_xref="GOA:B9M7W5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7W5"
FT                   /protein_id="ACM18423.1"
FT                   /translation="MSSHQSVTILLVEDDAGHARLIEKNLRRAGVANEIIHLDNGQKAI
FT                   DFLFNEGEFTGHENRVPFLILLDLNMPVLDGYQVLSRIKANERTRNIPVVMLTTTENPR
FT                   EISRCYSLGCNIYVTKPVDYDSFSQAIRNLGLFLSIVKVPDDL"
FT   gene            54782..56101
FT                   /locus_tag="Geob_0047"
FT   CDS_pept        54782..56101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0047"
FT                   /product="response receiver sensor diguanylate cyclase, PAS
FT                   domain-containing"
FT                   /note="domains: REC, PAS, GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18424"
FT                   /db_xref="GOA:B9M7W6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7W6"
FT                   /protein_id="ACM18424.1"
FT                   /translation="MAAKNSVSILYMEDDAGLARLLQRNLQRLGYVVDVVDNGEKGLAM
FT                   LEGGGYDLVLLDYHMPVCGGMEVLRAMTARGLPPVIMVTGNGNEKIAVEALKLGANDYV
FT                   VKDVEMGYLELLPMIIEQVLEKEQLVREREQMLHAVRESEERYRKLVELSPDGIAIHQH
FT                   GKLVFINPNGLEILGAREEQELLGKDLAGIIQPAFRDRHLPGLGLLVEEQEDFPVIEEK
FT                   FLRLDQTEVDVEVTTLPFTFNNEPAFQLIFRDISERKQAYDRLQYMANFDPLTSLPNRI
FT                   LFFDRLGQTVSHARRYNQMFALLYVDLDRFKPVNDNLGHDVGDMLLREVAGRMTGCIRD
FT                   ADTVARMGGDEFCIILSKIAGKGDAETVAGKIIAALDVDFCLRGHQCSIGASIGISIFP
FT                   ADSDDPQLLLKMADMAMYNAKENGRNRFCLFADQSLMVDQ"
FT   gene            56098..58059
FT                   /locus_tag="Geob_0048"
FT   CDS_pept        56098..58059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0048"
FT                   /product="sensor histidine kinase, HAMP and PAS
FT                   domain-containing"
FT                   /note="domains: HAMP, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18425"
FT                   /db_xref="GOA:B9M7W7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7W7"
FT                   /protein_id="ACM18425.1"
FT                   /translation="MKIRGKLLTGYFLVALFTAVVGWFGMRIVNTVSEEFKRQAEDEIP
FT                   LGRSLQELKYAGLRIVSSTVEYGFLWQQGDRELFQGELAEEKKFIAEGISSYYKALGRY
FT                   EKDLLRHHRGVRDQGHDRINESGEALIKTAAAIVSALEKSRPARELVELKEKNERAERQ
FT                   FLQAVEQESQENARDFAEIKQFTYRTMQGALQNIVMVTGATFALAILSGMVISASFSRR
FT                   LRTLQNAVRKMGEGDLKAAIHIGPEDEIGALAKSFQGMAQALHRSTQEIIAGKDYFSEV
FT                   IHSMMDALIVVSPDGAIQQVNGAACAMLGYDDEPVGRPLKEVLPYCSLEELVNLGYLSD
FT                   EERTLVARDGRKIPVALSISIIWNPDNSMRSLVCVAHDITGRKQWEAMQRRYNRELKDS
FT                   NDELRGFVYTISHDLRTPLVNIRGFAGELADNLKELSAVLEEAMPHVGEAARGRMVEIV
FT                   RSEVPEALHFITDSVRKMDGMLSSVLRLSHLGQRKMTVEPVNVSELVKGIGARLGKTID
FT                   GAEAEVIIGDLPDLETDRAALEEIMGGLLDNAVKYRAHGRRAKVEVSAENSDEGWLFHV
FT                   RDNGVGISEEDIGKIFDPFRRAGKQESTGEGMGLAYVRALVKQCHGRIWCSSEVGTGST
FT                   FSFTIGEEWLTTAQGGRA"
FT   gene            58056..58877
FT                   /locus_tag="Geob_0049"
FT   CDS_pept        58056..58877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0049"
FT                   /product="periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18426"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7W8"
FT                   /protein_id="ACM18426.1"
FT                   /translation="MKRDLIFKRAMVCLIVAGFLTATAASAETVIKVGGSGGPLGSAKL
FT                   LAKAYMKIHKGVSIKVLPSLGSSGGIKAVIGGAVDIALSGRPLKAEEKSRGAVETKYAR
FT                   SPYVFITHRQVNKESTTIREVEQLYGGKIREWPDGKQVRLVMRPESDSDTKLLRSLSPG
FT                   MDQAVLSAIRQPEMNFAVTDQDSIDMVMKIPGSFGGATLTQVLTEKLPVKVLALDGVQP
FT                   KAKTMKEAYPVWKEFYIVTLGNSSEAAKEFAAFFSSPAGRKILAANGNQPL"
FT   gene            58902..60212
FT                   /locus_tag="Geob_0050"
FT   CDS_pept        58902..60212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0050"
FT                   /product="sensor histidine kinase"
FT                   /note="domains: HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18427"
FT                   /db_xref="GOA:B9M7W9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7W9"
FT                   /protein_id="ACM18427.1"
FT                   /translation="MSSEHNKLIRITSCIAGTVAIAITVALPLIYFLVSYKYTMGGLET
FT                   EAEINARNIASIIRSNPDLWKYETPRLYELLARRPRAGHAETRRIFDKGGELVAESTDR
FT                   LNPPVVSSTYPLKDSGVEVGKIEISRSLAPLLLRVGLVALIGIFLGTAVFISLLMMPKK
FT                   ALNELKRAEERLQHFAQNLQEVNEELKNFAYIISHDLRAPLVNVKGFTGELQACMQELD
FT                   SITRRRECDLDGNDGKRLTEILETDVPEAIGFITSSVSRMDTLIGLVLKLSRLGHRELK
FT                   PEPVDLNELVDGILKTLTHQLEQKNAQVSVGMLPEVVQDRVALEQIIGNLLDNAVKYLD
FT                   PERPGRLEISAEKTHEGYIFNFRDNGRGISLDDQNKVFDIFRRAGKQDVQGDGMGLAYV
FT                   KALVRRLDGQIWCASEFGEGSTFSFSLPLTEDGMGRV"
FT   gene            60230..61570
FT                   /locus_tag="Geob_0051"
FT   CDS_pept        60230..61570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0051"
FT                   /product="response receiver sensor diguanylate cyclase, PAS
FT                   domain-containing"
FT                   /note="domains: REC, PAS, GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18428"
FT                   /db_xref="GOA:B9M7X0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7X0"
FT                   /protein_id="ACM18428.1"
FT                   /translation="MVDEMGAVDGKADGARILYMEDDAGLARLLQRTLQRLGHVIDLAE
FT                   NGELGLAMSEKVEYDVILVDYNMPLCGGIDVLRILTAREKHPPVIMVTGSGNEKVAVEA
FT                   LKLGATDYIVKDVEMGYLELLPLVIDQVLQKQQLVAERQQMLTAIHESEWRYRKLVELS
FT                   PDGIVICSAGKFVFINPAGVSLLGAPEAKDLLGMAMLDFVHPDFKEIFKAQLRQMEDSG
FT                   YNVPWIEERFIRFDMADIDVEVSGVPFTFNGEPAVQIIFRDITERTLAKRRLEQLAHYD
FT                   MLTSLPNRTLFFDRFNTNLEQGKRYGIAFALLFLDLDRFKQINDQDGHDVGDLLLQKVA
FT                   ERLKGCLRKSDTVARMGGDEFAVVLSRISERKDAATVAKKIIGELSVPFQLKGKEGSIG
FT                   VSIGISIFPDDGTDLESLLKHADTAMYRAKQGGSRFEFYQAGEGNLT"
FT   gene            61664..62149
FT                   /gene="tadA"
FT                   /locus_tag="Geob_0052"
FT   CDS_pept        61664..62149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="Geob_0052"
FT                   /product="tRNA (adenosine34)-deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18429"
FT                   /db_xref="GOA:B9M7X1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7X1"
FT                   /protein_id="ACM18429.1"
FT                   /translation="MAIERDDAFWMGKAIAQAEKAAARGEVPIGAVIVRDGKIIARGHN
FT                   LREGMQDPSAHAELIAIRRGAKKNGNWRLLGTTLYVTLEPCLMCMGAILLARVEKVVFG
FT                   CHDPKGGAAGSLYNLSDDSRLNHRVTLVSGIREAECAALLSDFFAALRREKKQNKRE"
FT   gene            62159..62246
FT                   /locus_tag="Geob_R0001"
FT   tRNA            62159..62246
FT                   /locus_tag="Geob_R0001"
FT                   /product="tRNA-Ser"
FT   gene            62648..67174
FT                   /locus_tag="Geob_0053"
FT   CDS_pept        62648..67174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0053"
FT                   /product="cytochrome c, 26 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18430"
FT                   /db_xref="GOA:B9M7X2"
FT                   /db_xref="InterPro:IPR010176"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7X2"
FT                   /protein_id="ACM18430.1"
FT                   /translation="MGKTIVRKIRGVSLRAKIALIAGFTMLLSTFMYQGWYRPVVASAT
FT                   EMVSNGVFNGSAGWTFSTATYDSTTTRTASSGSAKLSISGRNTATIGTVTQAVSIPAGS
FT                   TIDAVSLYAQLTTSHETTGDNISVDLRYSDATTVNILSSGELTNSSWTVSNGTGVTLAM
FT                   DVNQVIITMNTKSGNNSASTASLWVDEVTVSYTAGLPCSLNIPTLAVSPSSSLVAAGAN
FT                   MLYTATVTNNDSGAGCSNVTFNLGLINTNTSDFTLTAISPASLLLPAGAQGTAEFTVTA
FT                   QATAADGAVNTSTVSVSAFGHTAPPNATVQTTVNSGGSPLLHTSANLDPTNAKGYGTWG
FT                   ASYACSTCHNRNSTNVKRVLETIVTPLGSRPVLFSRMTASIANTQGTFGDDLRTTYANA
FT                   SRNVCEVCHHKTLYHQYSSTKIANRSTDPHYNRQDCAASCHPHSAGFKGSGCDGCHGNP
FT                   PTSTATLVTSPEATLALGAPPTSGGSHSAHVTGEGMKCTTCHSGNTMPSVSKTIQIGFD
FT                   INNSNWPGFAGPVAFGSFSGRSPLGGTPAYSFVSSKTGTVVNTSASYRTSCNVYCHGQW
FT                   TGANGSINPSWIVTDGSQSACGTCHAASAANVPATGKHTTHASSSAGNYGFSCTKCHPG
FT                   ASSFNHVNGSVQWRLSSSTTGLIGSTSSYSPAVTGADPAGISGNTNKLAPSATYGTCTN
FT                   IYCHSNAQSNTGAATPVAYTSPGWNDASLGCGGCHLDMDTNASATGDHVKHAQTYAISC
FT                   VTCHNGYTETSVTTATHVNKVIEISFSGNGAGTTYSQANQAPGNGYGTCSTSYCHSTAQ
FT                   SSTGGATPTYPGTAPTWGSSTMNCGSCHLNMDSNTSAPGDHVKHAQGTANFTCATCHNG
FT                   YTETSVTTSTHVNKTIELSFSGTYATGTVYSQGNGAVGNGFGNCTASKCHGQGAPVWGG
FT                   GLYSATVPCENCHGSAATSPFYSTAATGAAPTKVTAENDSKVGAHVPHLTARAAYTGIV
FT                   ACGDCHTVPATITAVGHMNGVSAPVFSGDAVLNTANPTYASSTCTATYCHGGKMINGSS
FT                   NGSDTSPTWTNTAYLTGTPSNTGDCAMCHGCPPTGYTGSSHSGTEALSACNGCHSHVNA
FT                   DGTFTAGANRALHINGIVEASGGDCLGCHAGLKNNTGNADIDNNGVRIITAEFSRTSHH
FT                   VTGVTLTVRHCAMCHMEGDTSGVKGTLHENGQIDLRNVDTNTAIVWTGSEHANMDNFCF
FT                   ACHDNNGVNNTTVQSITGGTATNPFNDTLRNSYDQVTRPGVIDVKTQFTTTNYSHHAVS
FT                   GQKYTSSTPLFSASPNRFVSTFTPLGGSVSIRDTSTIHCGDCHTSGKWATSGGIGAHGS
FT                   TNEYMLQTASGTDTTHTSTDYVCFKCHVGSIYNDLGGKTLGGTAAHITGGNGSDYTHTA
FT                   GTTGLSARTNGDGHITGMTCSGCHNCGQTGWGGIHGGNASYTDGNNTSQQTRRFMPGMG
FT                   NSKYIPGGWTSGTGATCYTLNNSSWSTCNQHPSGGKSVTRTPRAITY"
FT   misc_feature    67286..67449
FT                   /note="conserved nucleotide sequence; Geob_R6001"
FT   gene            67467..68660
FT                   /locus_tag="Geob_0054"
FT   CDS_pept        67467..68660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0054"
FT                   /product="ResB-like family cytochrome c biogenesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18431"
FT                   /db_xref="GOA:B9M7X3"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7X3"
FT                   /protein_id="ACM18431.1"
FT                   /translation="MMTRIRLLFPLVVTSPLAFGVFLIIPLVVVLQRISGGSSISPIIL
FT                   LINNLLCLAWLLARLFIDVRRFRSGKRYGSEALFRGRAATVPFGREQLREHLVRTGYIL
FT                   DESGRYGERPDRGYWGRLLLLTGLSFTLLVGTYDNVRQFSGTILLGVGGPLKLFEASSY
FT                   GILTKGALSSFDELPVKLQITRQILPDGKYPKGATDIVICDPDGKELQRATIRPGSPLS
FT                   IGAFEIHMARFLFDAWLVVTTTSNHIVFTNFVKLLPLDKPKEGYTFHGEIDDDHFEKVK
FT                   GEVWLRPQDKAMKVAVDYKGSRIVDTELFLWGENKKESAGYVAKLEGLGQWSEIHVTRR
FT                   RHKSALFAGVWTALLGLLIRLSWRPRRVWITETPDGISLRTTDAKVLKAINDSTVDI"
FT   gene            68699..69769
FT                   /locus_tag="Geob_0055"
FT   CDS_pept        68699..69769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0055"
FT                   /product="KWG repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18432"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7X4"
FT                   /protein_id="ACM18432.1"
FT                   /translation="MTFRCLVSFLLFITMALAACRQETEPPLQKGEAVRLLVRQNGKFG
FT                   YIDQSGKLAIPARFENASLFSEGLAAVRIGGKDGYIDTSGKIVIEPRFKAASIFNEGLA
FT                   AVLVGDRWGYINKAGKMVIPSSIVSTFAFTEGLAVVVAVTKDGYKAGYMDATGKMIIQP
FT                   LYEDARFFSEGLAPVKKGKKFGFINRSGTMVIQPMFDDATPFREGLAAVKINGKYGQWG
FT                   FIDTNGVWVVEAKYKNCLRFKEGVAAVEQEGTWRFIDRRGKDAVPLTMDGPSLFSEGLA
FT                   PVKIRGKVGYIDRQGREIIPPRFEAATIFIKGLAAVRQGDLCGYIDKKGNLVVPPTYEW
FT                   YQPIIDQVVTFAAEIE"
FT   gene            69882..70715
FT                   /locus_tag="Geob_0056"
FT   CDS_pept        69882..70715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0056"
FT                   /product="ResC/HemX-like cytochrome c biogenesis membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18433"
FT                   /db_xref="GOA:B9M7X5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7X5"
FT                   /protein_id="ACM18433.1"
FT                   /translation="MAPLESIFVWISLCGYGIISSLYIYAFVFRKENILQKIIYPIAAV
FT                   FLIHTASIIARYVAVGNLPWAGDYESATAGSWFVVLFTIIFIWKHRSLSAIGVGTIPFS
FT                   LLLFGFGVMRSPQLIPMSVSLKSFWLGIHVLFAWLAFGAFAIAFGLGIIYLLKEKNPRK
FT                   EFYAKFPDLPMLDELMFKYVVFGFITDAVMIPSGAIWAKDLWGNYWSWDPVETWSLVTW
FT                   LIYGCAIHLRLTMGWRGRRLAWIVIWALAGMVITFFGINFFVTSSLHLFRAMQGQ"
FT   gene            70724..72121
FT                   /locus_tag="Geob_0057"
FT   CDS_pept        70724..72121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0057"
FT                   /product="ResB-like family cytochrome c biogenesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18434"
FT                   /db_xref="GOA:B9M7X6"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7X6"
FT                   /protein_id="ACM18434.1"
FT                   /translation="MLKNLLAALKSLKVTAALIIALAMLCLLGITVPQKSILGREAYLA
FT                   WQQDHPTLVALLETFNLTEFHSSPLMMTLWVLFFGNLLLVMIDRLPGIWKLCREVRLPD
FT                   NAGFVQSYRCSAELKGASLDNIASVLDSHGYRVMRDGAALAGIRNRYAPLATLLFHLSF
FT                   LLLLAGGVLTIYTKFRAEVDLAVGEQFDGNYKQIFTRPKFGTVPSSKFTVTAVKPTYYN
FT                   QAVPVDLAVDLETRQGRKSISINRPYYDGRLSFLIKTVDVAPLFVVQDSAGKEIDGVFV
FT                   KLKILNGDEDGFSLQGYTVRARFHTDIVAEQSRTRGLSSNLPQALKQQPNDSSSKQTRE
FT                   IVNPAMTLSLEKDGQRLQTVTLRPHESVLFGNGQRLVWQDYTYWINFYVGQERGLMIIY
FT                   AAFVLMTIALVIRFGFYRRDIRALAEEETVFLAGRSEYFPVMFREEFAGLKAAMQFSGT
FT                   IEVQDEP"
FT   gene            72118..73461
FT                   /locus_tag="Geob_0058"
FT   CDS_pept        72118..73461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0058"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobamide-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18435"
FT                   /db_xref="GOA:B9M7X7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7X7"
FT                   /protein_id="ACM18435.1"
FT                   /translation="MKLILVSPPFGEKGQKSKGLPIAPPVLEYLAGLTLQVRPDVTVEL
FT                   VDANKEQFNPDQADADLISFTVLTPQAPWVYRMADRLRQMGRQVLLGGIHVTALPDEAG
FT                   RHADAIVLGEAEEIWGALLDDAEKRRLKPVYQGGFPELKGLSRPITNLWKTNYVYGYFQ
FT                   TSRGCPHRCTFCSVHEFFGGRVRTRPIDEVVAEIAQSKRRLFWGIDDNVWGVNMDYTIE
FT                   LYLEMGKSLRGKSWFGSGDLVSVDHPRAGELLTNARKAGLTAVLVGWESNNIGSLEEYK
FT                   AVTKQGRQRRDAIKKIRDHGIEVMLFMMIGGRQDRREDYEGILKLCDELKVSAHPVMTT
FT                   PFPGTQLYELYKPYLVPGLDWDSFDGNHAVFTHDDPLMSIDYREEAIVKLRAELFTIPR
FT                   ILGRIPQISWRGFPMSHITSWMIQYPQGRAFTQFAREREALKKTEAPG"
FT   gene            73545..75164
FT                   /locus_tag="Geob_0059"
FT   CDS_pept        73545..75164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0059"
FT                   /product="spermine/spermidine synthase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18436"
FT                   /db_xref="GOA:B9M7X8"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7X8"
FT                   /protein_id="ACM18436.1"
FT                   /translation="MLDKRKISAIVLGASFFSGAAALIYEVVWSRAMSLVLGSTVYALS
FT                   TMLATFMAGLAVGGFIGGRLGDRMDPVKALGLCEIGIGIGGIASIPIIHALPELYARMY
FT                   QSLHLNPPLFFTVQIALCALVMFWPALLMGATFPLVTKSITGELSEVGRKIGIAYGTNT
FT                   LGAVFGSLSAGFFLIPTLGIKGATFLPAGINVILGIVLLLTARSGLRPAIGIFTLFLAV
FT                   AAWSAETKERTTLVNFYTANRGSSWAELPLVQSPFLESARVFHEENASGSVRAFRMPDG
FT                   NLMLQVGGKIEGTLQPDIANTRLLAYLPLAAHTEPQKALIIGLGAGITVAAAKGHVPVT
FT                   DLVEINPAVVRAVAHHGKKGLLDGVKVIVNDARQFLTMNDVRYDVISSEPSYPTESEVA
FT                   SLFSSEYYRIAAGRLNEGGVYCQWLPYYVLANDDVTMMIKTFATAFKHVMLWKVPESLD
FT                   LIMLGRNIPFERGEGEIRERVHRMAGEDLDFVLSRTPEQVAELVKDGRIPINTDDRPIL
FT                   EFLLARNFLMGDIARIERDENH"
FT   gene            75247..75654
FT                   /locus_tag="Geob_0060"
FT   CDS_pept        75247..75654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18437"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7X9"
FT                   /protein_id="ACM18437.1"
FT                   /translation="MQISPELGVAIMMNNYFHDVATALLAASAFVIHAIVRTQAVMASR
FT                   EASLFFLRTYDQMVKFFRFALWWIIIGGIPRTVFYTSFEWANAADKLQVPALMVKHVVM
FT                   AVLVIWGVYAWRRLKVKVAALRQSVQAVAQG"
FT   gene            75661..76890
FT                   /locus_tag="Geob_0061"
FT   CDS_pept        75661..76890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0061"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18438"
FT                   /db_xref="GOA:B9M7Y0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Y0"
FT                   /protein_id="ACM18438.1"
FT                   /translation="MLLRILKSSFLKRPKAVLFLLLSITMGAAVATAFLGIYGEVSHKM
FT                   ALELRSYGANILVEPSVTDDGGELVEADLKNIKTVFWKYNITGFAPYLFGIVELEAAGR
FT                   KERGVVSGTWFAKELQVEGAEPSTQGVRQIAPWWEIAGEWPQAADEAIVGVSLAKRFAL
FT                   NPGSEIIARKDGRSRRFKISGIVTTGGYEEEQLFAPLATVQGLLAKEGRISRVLVSALT
FT                   VPMDEFGSRDPATMNKLEYEKWYCTAYVTSVAKNVEEVMTGSRAKPIWQIASAEGSLLK
FT                   KFNLIIILLTSLALAASAIAVSTSLMASMAERQTEVALMKTLGADRFQVIAIFIGEILI
FT                   ISVIGGLLGYLLGDQLAELISRVVFNSKIKSPLWLFPTAILSAFAVAVAGSVAPLQRAL
FT                   LIKPVQVIKG"
FT   gene            76892..78055
FT                   /locus_tag="Geob_0062"
FT   CDS_pept        76892..78055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0062"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18439"
FT                   /db_xref="GOA:B9M7Y1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Y1"
FT                   /protein_id="ACM18439.1"
FT                   /translation="MSRKRWFFHVVTRSLAHRKGGTLLLLLVLAMASSLVTALGIVSFS
FT                   MEKKIAEEIRRYGANLVVVGDSAGMEVGSGGMNFGMIAEPAYVAQGQVEQALLQDRTVR
FT                   ADYSPSLRGAFNLKGRNVAADGVEFSTVRRLFPWWRVSGGWPQAHECLIGNDIALRHSV
FT                   KPGDELTLAGSAGNLVVRVAGIVSSGGEEDGLVFVNLQALQKALGVPGQVTAVRVLASA
FT                   SGEDLRRFAGNLQKRLNGAKVKEVRQVARTSESLLKKVQLLMLLVTAVVLTACGGSVAG
FT                   TMGSSVLERGKEIGLLKAIGASRKEVLLLFGAESAFLGLVGGLAGYVAGYAIAILVTET
FT                   VFSVAADFLPALFPVALAASCFLALLGSTGSMIAVYRLDPVCSLRGE"
FT   gene            78058..78753
FT                   /locus_tag="Geob_0063"
FT   CDS_pept        78058..78753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0063"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18440"
FT                   /db_xref="GOA:B9M7Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Y2"
FT                   /protein_id="ACM18440.1"
FT                   /translation="MTSVKTESSIIKTVGLTRSYGEICALAPLDLQVTEGEWLTIMGHS
FT                   GSGKSTLLNLLGGLDRPTAGTLLVDGENLLSLSEDQLARFRRESVGIIFQQHHLIPYLT
FT                   SLENVMMAQYFHSIPDAVEASLALEKVGLGKRLANRPRELSGGEQQRVCIARAIINNPK
FT                   LLLGDELTGNLDHKSTHLVMELLKELHETERFTLVLVTHNQEVAGWGQRTIFMDDGTVV
FT                   KDVRQGRSN"
FT   gene            78753..80096
FT                   /locus_tag="Geob_0064"
FT   CDS_pept        78753..80096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0064"
FT                   /product="membrane protein, DUF2318-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18441"
FT                   /db_xref="GOA:B9M7Y3"
FT                   /db_xref="InterPro:IPR018758"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Y3"
FT                   /protein_id="ACM18441.1"
FT                   /translation="MPLLVKGLTLLILWGVLVVGLTRAFAARKSALTAGSVLGLITGTV
FT                   AGFLLFGSFTGELPFAIIKSLVAVAFISLFIVAAFAWHKAPAPAITVFSPSLSDHPAVT
FT                   AMAAFLTATVFAILAVFRLSNSGDNATVLAVGFILLAMVELWLVVYRLEPLLPSVLKMP
FT                   RGGLPLLAVSLFLFIASSSPRLDLFSPLSMKVMKLIHDFVHQFFESMLIPDHPFFRTDV
FT                   WDYIGMLFSNGVGFWGGLIIWFIPAALIAIAVFRQPLPSVAHVRQAATRRKLIAGHLRE
FT                   RRCLLFFPFFATILMAVAVYESGHPSVEYWDPKPIAVKADGAGTIHIPVKDGETDLKDG
FT                   KLHKYIFLQGAKKVRFFVLYRSDELTVVLDACSICQPEGYGQSEGTVICYYCKTLIPLE
FT                   TVGKPGGCNPVPVSFTADAGGVHLSAVSLINTWNEQVQSAKKVPGGPE"
FT   gene            80093..81331
FT                   /locus_tag="Geob_0065"
FT   CDS_pept        80093..81331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0065"
FT                   /product="ResB-like family cytochrome c biogenesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18442"
FT                   /db_xref="GOA:B9M7Y4"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Y4"
FT                   /protein_id="ACM18442.1"
FT                   /translation="MRRLLRGFHSIIASRAVTPIILGCFALIYIIIAFYTDETLVALMA
FT                   LVRSNSPLILLLSCIPVNLLAILCRETAQFSDRRHAVRLSAKGLPVGTYQERVFLGTVQ
FT                   TGLLEKKIEQSGYHYRIKGDSCAAWKGISIFPARFLFLMGSFCLFAGILVSLTTKVSLR
FT                   DVVIEGEPLPEAVGVRGRVEQITLRQHNGIILSHSLDMDITLGEGDEASVRKFGVYPPG
FT                   RINGIFFYPRYLGLAPLIEFTPPESGQVFSSYIKLMIYPPGKEDGVQIPRSPYRISFTI
FT                   IEPMTGAEPYITGKFNLRFKVLKGNDQVSEGTLPLGGTVSRGGYTLSFPDAKKLVAVDF
FT                   VKDPGLPLLWIAGLLFLGAIVAYIPIRMFAPRREIIFIQRNGSTEVFSRAEGRAAKHRG
FT                   ILHNMLDHLCQSQ"
FT   gene            81482..82948
FT                   /locus_tag="Geob_0066"
FT   CDS_pept        81482..82948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0066"
FT                   /product="anaerobic magnesium-protoporphyrin IX monomethyl
FT                   ester oxidative cyclase-related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18443"
FT                   /db_xref="GOA:B9M7Y5"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Y5"
FT                   /protein_id="ACM18443.1"
FT                   /translation="MEASRAKKILFVTPPYHCGVVEVAGRWIPLNFVYLAGVAREAGLD
FT                   AEIYDAMTKDHGYPEIEQRLQASTFDVVATTAITSTINDALKTLQLAKQINPNAVSIIG
FT                   GVHPTFCYEEVFNTTDAVDYIICGEGETTLKALLMALEKGTDVAEVPGVAFKRDGRVIK
FT                   TAKRCFRENLDDLPAAWDLLDWSDYKYFVIPNSRLGAISTSRGCDHDCIFCSQQKFWEQ
FT                   SWRGRDPQKVADEIQYLFEIYGVNVFLIADEYPTKDRERWEALLDMVIAKDLPIYLLME
FT                   TRVPDIIRDREILWKYRKAGVVHIYIGIEATDQETLDFIKKELDVDQSKLALDLIHEHG
FT                   IITETSFVLGFPDETKKSIEKTLKLAQYYNPDNAHFLAITPWPYADMFNDVKDYIKVHD
FT                   YAKYNLIDPIIEPKRMSLLQVDVAIVDCYRRFYMKKLPEVFNMKDPFKRDYLMKAMKLI
FT                   MNSSFIIKKLGKGTLGKVPAMIEEMMAKMS"
FT   gene            complement(83059..84579)
FT                   /locus_tag="Geob_0067"
FT   CDS_pept        complement(83059..84579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0067"
FT                   /product="protein of unknown function, DUF830-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18444"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Y6"
FT                   /protein_id="ACM18444.1"
FT                   /translation="MKHRLSALSLLTTLFLSIPAFAADICKDHLVRNHGTTNASVEKTL
FT                   QEELNDFRFLAERALMLRAETIKVGNSIKNKQEQGKPLTGEDLDLLNQGIVEHLALRKE
FT                   LLAVAESHECWLDRSEKDLAQLGITPEARLKGIMLSLSSALVLYDNYLLAISLFEGDSK
FT                   LRRLLNERDPGYAVNSAALAKVTLHYDSVANRQRVRKAIKFYEKESVRLNRSMAKSSEI
FT                   EYVSTLIQQSPSYTMVRKWSPLYVIGRKLGFFGAVTTDTLSSFERGGMNLFSMFFGNAV
FT                   GLVETRKGKLYGKSEMLEEVKATLQAGDILLEKTPFRLTDKLIPGYWGHAAVWVGNETE
FT                   LKELGIWENPVVKRYHDQIRQGRLVVEALRSGVEMNTLDHFFNIDSFGALRKPELTRES
FT                   RAKTVIQTLRQVGKPYDFNFDVESKERVYCSKLVYLSYSGVEWPTKRSLGRTTFTPDDV
FT                   AMKAAKDGALQLVTFYHDGTRVNKTPLARMTELMRVKTVKQAALGKVQ"
FT   gene            complement(84635..85237)
FT                   /locus_tag="Geob_0068"
FT   CDS_pept        complement(84635..85237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0068"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18445"
FT                   /db_xref="GOA:B9M7Y7"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Y7"
FT                   /protein_id="ACM18445.1"
FT                   /translation="MRFPGLNHHRPCARLMTFSWLIVSCLVLGGTPGLARQTVASAPAS
FT                   PRAAEGLANLPGLTNVGHIAPGIYRGAQPGADGYATLKKMGIKTVIDLRTSESEKAQVE
FT                   AAGMRAIAVPIAMSRDGLKEKVDGVVALLADPANQPIFVHCRHGQDRTGIVVAAYRMKV
FT                   DKWSLAEAEKEMQAFGFNDIWINFKKFIRRYGSELKQ"
FT   gene            complement(85339..88248)
FT                   /locus_tag="Geob_0069"
FT   CDS_pept        complement(85339..88248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18446"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Y8"
FT                   /protein_id="ACM18446.1"
FT                   /translation="MKRITLLLIIPIVVGFSLAAVAAIGVATVPTKPVIPEVHRSGDDG
FT                   YFRLQVPLPKDTPAGPMGLGVTVESGDCWLVAAQAQYENKPPADRDDDAEDSPAESATE
FT                   RTFTVTGRYDHGGPIRLTITARTAGESHRPLVKLSFQLPDAPQENPEVRRAWAQQQQIS
FT                   LALADPHGEDSFSHYWNLAIAPRYGLPPNLNEATARFRREPPDLYSVFTGAAAIQESLQ
FT                   LELLGTGPESPAQRNAILKTEAAPEAELPLSSLSGPTIKSHPFQDMLQGRNPQLPPLAA
FT                   AIPQDHYAVFFADINKEIELADLLDEWGGNLLHQVETSARDFQVRRKVSSQLCLENSQL
FT                   TRWFGDRVVADMAFTGSDPFLKEGTAFTVLFSLKDRDRFRKQLDKHYAEAVAKRGAVRS
FT                   PFAIGGHRGVAVVSPDRRVSSCALIVGNTAIVSTSKKEIEKIAAVLAGRLPSLAQAEDF
FT                   RYMRTIFPQNAKDEDIFIYLSDAHIRNLVGPRSKIVEARRMRCSGNMALIANARLWFKA
FT                   EKRREPTMKELVDGGYLGEHPTICPDHGDYDIDGHGEPHCSLHNRQGVLTPVDELPLVS
FT                   VTPLEAARYKAFVENYNRYWTRFFDPIGIRVKMGKDIRIQTCILPLIENSWYDGLAAFS
FT                   GRSPGTLTESMVLPRTILSLRGHMSTEWLNGLTPLHELSKRGNLPTGWLGDEISLNLCD
FT                   GQVLFSAGHNALGLMGQEMGRSSLEPLVIGYLGSALNLPTYMSVKVTDSQKAARAIPQL
FT                   FRALGPRHSRSDDLGVETYSIEDHRGKPLYVAAFNLWVIKLRLYSAVVDDRLVIASRRD
FT                   IVTELMDAGAKGSAKKVVKQEGNMEMSVYRSAFKQLEETVSLGWQEDLRHACQKNLPLA
FT                   SILLKTIGVPAEGLESTVTGLRGYQPYCPSGGRYMIDDMSGSVTCTVHGNVWQPKQPAA
FT                   GNRSSKTLSLVNSLERVNARLAFTPEGLMTTVDIRRKGK"
FT   gene            complement(88290..90971)
FT                   /locus_tag="Geob_0070"
FT   CDS_pept        complement(88290..90971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0070"
FT                   /product="protein of unknown function DUF2339"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18447"
FT                   /db_xref="GOA:B9M7Y9"
FT                   /db_xref="InterPro:IPR014600"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Y9"
FT                   /protein_id="ACM18447.1"
FT                   /translation="MPTLFYVLIGAVIGGATDRFPGAIFGACVGWLMGSLTELREKFAA
FT                   LEKEVGWLRRKLAEHTQRQEKVTAEATMPMAAAPGFEPAQAKASPPVKGPVPAAQTVQK
FT                   PAPAVHPPRPVYVAETPPEPSPIMDAITNFFTGGNLLVKLGIVILFFGVSFLVKYAAAH
FT                   GHFPIELRLVLTAMGGLALLGTGWRLRDRRAEYALALQGGGIGILFLTTYAAFRLFALL
FT                   SPTASFILLVAISGLCGTLAVVQSSRTLALFGISGGFIAPLLASIGTGSPAFLFGYYAV
FT                   LNAIIVGIAWYRSWRPLNLAGFAYTFVLGTIWGVQFYHPAHFTTVEPFLILFFLIYVGI
FT                   AVLFAFRQPPELKGIVDGTLVFGTPIAAFALQAGLVENFRYGLAWSALAAGMLYLVLYL
FT                   FLSDDRLRTLADAFLTFGAVFLTLAVPLAFDGRWTSAAWAVEGAALIWVGFRQKRQLAR
FT                   ALGIILQFAGGIAFIADLPSSTGYLPILNGLYLGGILISMAGLLSSWTIRQHQRQAAAW
FT                   EQPLGHLLTAWGLIWWFAGGLHEIHLHTAADLAYGFSLVFVTASCLACHLLQRRLSWQD
FT                   LSYPPLLLLPAMVCFLLPDLPRHPLAHGGWFAWPAAFAAHWWLLYQQEDELQPINRTLL
FT                   HGGAVWLAAYLATWELGWQVHFFFGKTGSWLTISRGIVVIIMLAGITSGKRSVWPLRKH
FT                   EELYLGIVALPLAVVSLCWAVIVSLGCSGDPWPFPWLPILNPLDLAIVTTFTTLLLWIK
FT                   RLLQLPHLAELVDGNRTVLTAAGSLTIFIWLNSILARALHHWRGIPFTPEALLHSGLAQ
FT                   TAFAIFWSLLALCTMVTATRRGLRAAWLAGAALLGMAVLKLFLVDLAGHGTVERIVSFV
FT                   AVGLLLLVIGWFSPVPPHREEH"
FT   gene            complement(90985..91161)
FT                   /locus_tag="Geob_0071"
FT   CDS_pept        complement(90985..91161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18448"
FT                   /db_xref="GOA:B9M7Z0"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Z0"
FT                   /protein_id="ACM18448.1"
FT                   /translation="MKSLLVHIAVAVLPFLALVFSTTLFYTLHRRRLAHRPLSYHRIRR
FT                   AMERALGTGVMLR"
FT   gene            complement(91421..95923)
FT                   /locus_tag="Geob_0072"
FT   CDS_pept        complement(91421..95923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0072"
FT                   /product="serine protease, subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18449"
FT                   /db_xref="GOA:B9M7Z1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034204"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Z1"
FT                   /protein_id="ACM18449.1"
FT                   /translation="MRPDSILPQVFFVAAIVASFIAFPATSSALTLEDAPVQATRGRAP
FT                   FLLFPDNQPRQDHLQGELILKFRDDASVGAVAADLVKGGQPFAPVTGDGNLDRLNSRYK
FT                   VKAMHRVFGEAPALNASGRMDAGAAELRHRRQREKFRKDVAALREERLKKKGLPPGAPG
FT                   PDLPYLGSIYRVEVDPETDVNVACAAYSRDPSIAYCQPNFRMEAQWIPNDPFYASFSSW
FT                   GQGYDDLWGLKKMQMADAWDVTKGAGIVVAVVDSGVDYNHVDLATNIWTNSREIPGNGI
FT                   DDDGNGYVDDVRGWDFYNNDNDPMDGHGHGTHVSGTIAAVGDNNTGIVGVAPLAKIMAV
FT                   KGLSDTGSGSSAGLAAAIKYAAYNGAEVINNSWGCSSPCSSNAVAEDAVAYARGLGAVV
FT                   VFAAGNSQADVTLYSPQNQSNNVITVAASSEVDSRSYFSNLGPLIDVAAPGGGSDDTSS
FT                   NRIGRNILSLRAGSTDLYKDGLCIVDTYYYRARGTSMAAPNASGVAALVLAAHPTFTPD
FT                   DVSQALRVSADDMESTGFDLLSGTGRLNAKKAVAVTSVPRVRITSPMKSVNVTKPGTVT
FT                   VQGDAYGTKFAGYRLFYAPIDKVLGQTPYTPTVGSWQPLGSESTEAVTEGVLATFSTEL
FT                   FQAGKSYLLKLEVTTTDNEVFTDVKEILFFKEDPKFYILATGQLGKRGPQSEGDRFSWI
FT                   ETEPQQQESGTKRDIGKVYDGATNRLITIYPDPTKTGAWIDQIFLTGGKIVWYETNYSY
FT                   GKTSVGSISPTGELVVEDSFFYPILSYDNGKILLNQGRAAFYGLLVYVYDVNTHTLSQE
FT                   YAMPQGDPSQSGVYLKDNSVVTNMWYPGGSNNDVTINLTDLGTGVNEVVKTVVGGGAGS
FT                   VRQALNGSGVVVWTEENEFNLTYPMYVFNKITKQETHVTDASHPYSYATDGTSIIFSAF
FT                   GSETGETKLNLYSYDIATATTSFYASNYVAGATNNMWPSFGTRHVQWWADPLVMVRNDV
FT                   PTVGGVSDTAVALNSLFSLTMTAADPEGDKVDISAVGGTWPDAATALPEGATFTDNGNG
FT                   TGTLHWTPTTLGNYTISFLARDFSGRKEGSWNAVKTASFMVYDANEPSQPLGVTVVGNG
FT                   TVNSSPSPDLNCSGGTCSQSYTRNTVVTLTASPGTDSGFGGWTGACSGFGACSVTMDQP
FT                   RMVTATFIPSYILSVTIWGNGSVHSSPGPDIACSIGTCSQTFNSVTTVTLSATPAPGYA
FT                   FTGWSGACSGGGSCVITTNQLCAVTATFVPTYSLDVTISGSGTVHSTPTPDINCSTGTC
FT                   SGTYNSGTTVTLSATPAKGFAFTGWSGACSGTGSCTVVMDAVKNATATFTRTSAVLSLN
FT                   FPLTIGNVHSSPSPDISCTSGGCTQTYGVDTVVTLTASPGATSYFGFWSGACSSNGTTC
FT                   TLTMSEDRSVNAYYYGCGSMVSSACYAYIQEALTDSPDGSIIKARDLNLGQSLVMDRPV
FT                   SLTLQGGYDSSFTTLTGTAIIPVLTIKSGTLTVSDITLK"
FT   gene            complement(96190..97740)
FT                   /locus_tag="Geob_0073"
FT   CDS_pept        complement(96190..97740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0073"
FT                   /product="Fic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18450"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Z2"
FT                   /protein_id="ACM18450.1"
FT                   /translation="MKVSPAQRQLAEALKALKKLQDSGKTVIKTGDLTRLQREALLKNG
FT                   FLRQIIRGWYMPSRPDEDPGDTTSWYAVAKDFIREYCDDRFGDKWHASPEYSILLHAGN
FT                   TITPNQVTIYSPKATNGVIQLPAGCSILDYRKNEEWPEQRKQIIGGIRVMPLTLALIRV
FT                   SEAFFKNFPRDAQIALHQLDPSELFGDLLEGGHSSIAGRLAGALRVIGREESGEELINT
FT                   LRAAGYTVAETNPFSVVTPELKFERAQSPYVLRIRLMWKEMRDTVLTTFPKEPGPPASI
FT                   EKFMENLEIIYKNDAYHSLSIEGYRVSDDLILRVANGDWRPEVNASDSEAKNAMAARGY
FT                   WLAHNEVKETIRKIFSGVNPGEAYRVDHATWYRKLWEPSVTAGLLRPADLAGYRNYPVY
FT                   IKNAAHVPPSKEAVREMMPELCDLLKSEASAAVRAVLGHFIFVYIHPYMDGNGRLGRFL
FT                   MNVMFASGGFPWTVLNVERRKEYMTALDAATSRGDLKPFAQFIYESMTESANLPGLKR"
FT   gene            complement(97869..98015)
FT                   /locus_tag="Geob_0074"
FT   CDS_pept        complement(97869..98015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18451"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Z3"
FT                   /protein_id="ACM18451.1"
FT                   /translation="MRKLKSGNTDICNQTTGVVLYDGETTVQRDKEVAIGCQGSAATEH
FT                   HFI"
FT   gene            complement(98121..101501)
FT                   /locus_tag="Geob_0075"
FT   CDS_pept        complement(98121..101501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0075"
FT                   /product="(acyl)-sn-glycerol-3-phosphate acyltransferase
FT                   and acyl-(acyl carrier protein) ligase, major facilitator
FT                   superfamily domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18452"
FT                   /db_xref="GOA:B9M7Z4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Z4"
FT                   /protein_id="ACM18452.1"
FT                   /translation="MTSHEKHQSLLWLNTTQFLGALNDNILKLLIIFFLIGSQGVAKAG
FT                   VITACVGAAFVLPFLLFSAPAGCLADRLHKSRLIKIIKAIEVAVTLLAVVAFAFKLEWG
FT                   LYAVVFLMATHSAFFAPAKYGIIPEIASRDDLSRVNGLIESFTYLAIIVGTALASVLAQ
FT                   ATGGRFWIAALVCLVVALVGLASASRLETTRQEDASRKVSLFPSEILRTVLAVRHDRDL
FT                   MLAIIGLAYFMFVGAFAQLNLISYGMQQLGLSEAGSGYLFLAAALGIGGGSLLAAKLSG
FT                   RDVEFGIVPIGAIGLTASAILLHTVPSTIASCVFILVLFGISAGLFSLPLQTFIQFRAE
FT                   PDKRGEVLAASSFINWVGILLASALTWLFSGPLQLSAAQGFSVIGIMTLALTIITLWLL
FT                   PDFLLRFMGLVTMRIFYRLRIIGAENLPVEGPALLIPNHVTWVDALLLSATCQRRIRFV
FT                   MERRIYNTPLLRWLFRMMGVIPVSSKDGRKEMVEFIKRARTALDDGYMVCIFAEGALTR
FT                   NGMLREFRGGFERIVKDSGYPVIPVYIGGAWGSILSYAHGKLLSRPPALAPYQVSILFG
FT                   TPMPATSTALEVRQAVMELSCDYFNSRKAERKPLAEYFVLAAKQNWKRHAVSDTSGKEL
FT                   SYGETLAGALALAGKLDKCIGEAEYVGLLLPPSAGGALANLALSLLGRVPVNLNYTAAE
FT                   ASLRSAIAQCGITTIVTSRAFLEKLPTLPQVEGMLFLDDIAPTISKGEKLQALIRGRLL
FT                   PPRLLCNRQGFHADRTATVIFSSGSTGEPKGVMLSHHNIMSNIEALRMVFRVNLNDNIC
FT                   SALPFFHSLGFTGTLWLPLLSGFSAAYHPNPMDGEKIAQVVREHRSSLLIATPTFLLAY
FT                   LRRAKKEDFASLRLVITGAEKLKAKVADSFEERFGIRPLEGYGATELSPVITLSLPDVK
FT                   IDGVAQHGSKEGSVGHPIPGVAIRVVDPDSGTALKPGEPGLILVKGPNVMHGYLGQPDK
FT                   TAQVVKDGWYVTGDIGIMDDDGFIRITDRMSRFSKIGGEMVPHGVVEDELHGRLGQTQV
FT                   LAVTAVPDEKKGEKLVVVYAKDAADGETLHRLLAESNIPNLWKPGRDCYVAVEDLPMLG
FT                   SGKLDLKGLKEIALTALGG"
FT   gene            complement(101536..102528)
FT                   /locus_tag="Geob_0076"
FT   CDS_pept        complement(101536..102528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0076"
FT                   /product="metal-dependent hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18453"
FT                   /db_xref="GOA:B9M7Z5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Z5"
FT                   /protein_id="ACM18453.1"
FT                   /translation="MQQSIIDIHCHAAGIGAGNSGCFISPAMRRSFKFHIYLRAFGVSE
FT                   RELLVQGDHLIVERLSALLAGAERVQQAVVLALDGVIDQNGELDMARTEAFIPNEFIAS
FT                   AASRHDNILFGASINPYRHDAIERLHQAVAQGAVLLKWLPSIQGIDPADERLVPFYECL
FT                   RGQGLPLLTHTGEEESFTCKQDHLGDPERLRLPLRVGVTVIAAHAASSGKNDGEANFNR
FT                   FLRLCAEFPNLYADVSALTQLNRLNHLPRLLKHRELHGRLLYGTDMPLLQTLIVTPLAF
FT                   AHRLSPRKVLAISHIRNPWDQDIALKEALGLPENVLTNAARILRLPAGA"
FT   gene            102697..104184
FT                   /locus_tag="Geob_0077"
FT   CDS_pept        102697..104184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0077"
FT                   /product="sigma-54-dependent transcriptional regulator"
FT                   /note="domains: sigma54 interaction"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18454"
FT                   /db_xref="GOA:B9M7Z6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Z6"
FT                   /protein_id="ACM18454.1"
FT                   /translation="MNKKIKINQEDRVFFETVAKAAFANPFGGKRDELDALIGGVKAGI
FT                   SPEKLLAAVVGQIRQRIIALKEKDAANLRHWEGEDREAFRIVVLFHLFHRHLEDFDRLT
FT                   QNQLKSGEASCPVPFARTVLGELHDFGFAEHEALRFLAVFYQLRRAFYFIKNGLVGNSP
FT                   SMRTLRKHLWNCVFTHDIRWFESRFWDRMEDFSVLLLGATGTGKGAAASAIGRSGFIPF
FT                   DVSRNCFSESFTRNFVAINLSQFSEGVLESELFGHRKGAFTGAMDNYEGLFSRCAPHGV
FT                   IFLDEIGDVSLPVQIKLLQVLQERQFSPVGSHERKRFSGRVVAATNRPLEELRREGKFR
FT                   DDFYYRLCSDVVHLPSLRQRLQESPQELDLLLTSILARLAGNVTPREQQLVKKVLERDL
FT                   GGDYAWPGNVRELEQAVKRIIITGRCQRPDNGQSVKKSSDLLVDGIKEGNLDAESLLAQ
FT                   YCSMLYSRYGTYEEVARRMKLDRRTVKKYISSSDSNE"
FT   gene            complement(104324..105220)
FT                   /locus_tag="Geob_0078"
FT   CDS_pept        complement(104324..105220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0078"
FT                   /product="helix-turn-helix transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18455"
FT                   /db_xref="GOA:B9M7Z7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Z7"
FT                   /protein_id="ACM18455.1"
FT                   /translation="MERALEALATSIARLTEEGEQHITAIHGLSLYRREEPTEPMTGMY
FT                   EPSICLVAQGAKRVLLGDEVFVYDALHYLITSVHLPTVVQIVEANREKPYLGLKLKLDQ
FT                   REMSQLMADSNLPAPRVQQSSRGMATGVMTLALVTAFHRLIGLLDDQQDIPILAPIIQK
FT                   EIIYRLLVGDQGTRLRQIASAGSQSHQIARAIDWLKTNFTQPLRVEELAEQARMSSSTF
FT                   HHHFRSMTALSPLQYQKQLRLQEARRLMLSERMDAANAAFQVGYESPSQFSREYNRLFG
FT                   APPLRDIINLRQMAAAE"
FT   gene            105422..106432
FT                   /locus_tag="Geob_0079"
FT   CDS_pept        105422..106432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0079"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18456"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Z8"
FT                   /protein_id="ACM18456.1"
FT                   /translation="MQKRALGKNGLEVSALGFGCKGMSFSYGPPKDKNEMIALLRTAVE
FT                   RGITFFDTAEVYGPFTNEELVGEALAPLRDRVVIATKFGFNINSGNDPRGMTGNMPALN
FT                   SRPEHIREVAEASLKRLKTDVIDLFYQHRVDPDVPIEEVAGAVKELIQEGKVKHFGLSE
FT                   AGIQTIRRAHAVQKITAVQNEYSLWFRRPEEGLLQTLEELGIGLVPYSPLGKGFLTGKI
FT                   DETTAFDSTDFRTTLPRFTPEARKANQALVDLLGRIAAQKKGTPAQIALAWLLAQKPWI
FT                   VPIPGTTKLNRLDENIGAVSIELTAGDLSEIDNAAAKITVQGNRYPEKLEQLTGL"
FT   gene            106550..107611
FT                   /gene="mtd"
FT                   /locus_tag="Geob_0080"
FT   CDS_pept        106550..107611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtd"
FT                   /locus_tag="Geob_0080"
FT                   /product="mannitol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18457"
FT                   /db_xref="GOA:B9M7Z9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M7Z9"
FT                   /protein_id="ACM18457.1"
FT                   /translation="MYKAKAYSVTSATAPFASNTITRRETTERDVQIEILFCGICHSDL
FT                   HTVRDEWHSVMPTAYPCVPGHEIVGKVTKVGAAVSRFKPGELVGVGCLVDSDHTCPNCK
FT                   TDMEQFCPGATFTYNSPDKHGTAPVTYGGYSESIVVDEHFVLRVPANLDLAGVAPLLCA
FT                   GITTYSPVRRWGDIKGKKVGIVGLGGLGHMGVKFARAFGAHVVVFTTSLKKKEDALRLG
FT                   AHEVILSTDPVQMKQHAGTFNFILDTIAAEHDINAYITMLGLEGNITLVGAPETPLQVS
FT                   AFALLFGRKSISGSLIGGIKETQEMLDFCGEHNITSDVEVIPIQKINEAYERLVKSDVK
FT                   YRFSIDMASLKSE"
FT   gene            107813..108055
FT                   /locus_tag="Geob_0081"
FT   CDS_pept        107813..108055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0081"
FT                   /product="helix-turn-helix XRE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18458"
FT                   /db_xref="GOA:B9M800"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9M800"
FT                   /protein_id="ACM18458.1"
FT                   /translation="MSGIRSPKELGEALRQKRKAKGLTQTAAGKPVNLVQSKISQIENG
FT                   TLAIELSTLFRLLAALDLELVVQPRQKHEIKGDEW"
FT   gene            108055..109365
FT                   /locus_tag="Geob_0082"
FT   CDS_pept        108055..109365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0082"
FT                   /product="transcriptional regulator HipA"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18459"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8C4"
FT                   /protein_id="ACM18459.1"
FT                   /translation="MPRNLAVYLNGTRVGTLTHAARVLQFVYATSWITSSVSRPLSLSM
FT                   PLRREPYSGDVVENYFDNLLPDNQAIRNRIQTRFGSPSNRAFDLLWHTGRDCVGAVQLI
FT                   PDGAEAVDVRRVEATPVSDVKIAAILNNYRTMPLGMRPDIDFRISLAGAQEKTALLRLD
FT                   GRWCIPSGVTPTSHILKLPIGTIAHSGMDLTDSVENEWLCHLILKEFGVPVANAEMEVF
FT                   EGVKALVVERFDRRWAEDGSWLIRLPQEDMCQAMGVAPALKYESDGGPGIQKIMTFLLG
FT                   SADALGDRRVFMQVQVLFWLLAAIDGHAKNFSIFIRPRGEFSLTPMYDVLSAYPLVVKG
FT                   QLDPHRLRMAMAVSGKNRRYEHISIRYRHWLATAQRNNVSPEEMALIIEELLDRVDSIT
FT                   AAVASRLPHNFPGDVAESIFEGMRQSRDRLASQKHER"
FT   gene            109657..109806
FT                   /pseudo
FT                   /locus_tag="Geob_0083"
FT                   /note="flavodoxin, putative; C-terminal fragment"
FT   gene            109844..110569
FT                   /locus_tag="Geob_0084"
FT   CDS_pept        109844..110569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0084"
FT                   /product="iron-sulfur cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18460"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8C5"
FT                   /protein_id="ACM18460.1"
FT                   /translation="MDNEQKETHGPDGPVNLTRRDFIKGVGIGGGALVLLGQFGINGLA
FT                   WALSGDPELKMVLVDYTKCTGCRTCEAACSSRNRPATIGGREVPGLGNPCFANIRVHSF
FT                   NPDVDVPSVCAMCADNPCVKACPVEPDPRTGRRALYRDAKTHGIRNDAGRCLGCRSCAK
FT                   ACASQRTGVISPNLATGKPERMCTLCGGDPQCVKRCPFGALTYVEVRRDRKFYGLGPEK
FT                   IAAELAKNWYGTADFGGAK"
FT   gene            110566..112368
FT                   /locus_tag="Geob_0085"
FT   CDS_pept        110566..112368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0085"
FT                   /product="aldehyde:ferredoxin oxidoreductase,
FT                   bis-(molybdopterin)-oxotungsten-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18461"
FT                   /db_xref="GOA:B9M8C6"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8C6"
FT                   /protein_id="ACM18461.1"
FT                   /translation="MSRKPGYHGTILNVDLSTGKIEKLAVPSEDLDKFVGGQGLGMKIL
FT                   WDRLKKPGVDPLSPENPLIFMPGPFSGLPVPSSSRTCVVTKSPITSPVKSDYPHASTVS
FT                   YSNMGGFFGPEIRFAGYDGIVVTGKAKELSYIVIDDDKVEIREGKKFKGMRTDAFDKAI
FT                   LTELGDRRFKTVYIGPAGENLVPYSSILHTAGRAAGRGGMGCVMGSKNLKAIAVKGSGQ
FT                   PSVADHTRFLAALEKARSVLYGSAYAKSWAEQGTARAIVANSNAGTEAVRNYREGTFPE
FT                   ADKIGGDAARRDVWVKDIACYCCPLACKKSGMTKGKYGGIVHDGPEYETGVMLGSNLLI
FT                   ADMPGLLKAIYTIDDLGLDQISTGNVIGFLMEAYEKGLIDRGFLDGIDLKWGNVDATLA
FT                   MIEKIAAKEGVGALAAEGVRALSWHIGKGSEKFAIQVKGLELAAHNIQANQPRGLSYAT
FT                   AERGACHMSGDDIATQNRRAMIDSIGLCLFPTFEPALEEPMLALLSAITGRDYDKAAFE
FT                   KTGERIFNLEKMFNYREGFRRADDCLPDRFFEDAFTIGTKKGAVLDRSKFEEMLTRYYK
FT                   DRGWDPETTKPGKAKLQELGLVKA"
FT   gene            112652..114049
FT                   /locus_tag="Geob_0086"
FT   CDS_pept        112652..114049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18462"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8C7"
FT                   /protein_id="ACM18462.1"
FT                   /translation="MKKVTVLLLSLLLLTAAFSSSAQSVCTTTGGTWVAAWTDPYGQTT
FT                   YSLEAPCVAYVGVPFNITATVSDSVYPNSNVGASWSILDNQLAIASGFWITTANGIWQK
FT                   VQQQSYSDDTMQHTIDFKYIDLGQGSGAHYWTRNSIGDVTVVARPLNNPPVANAGIDRV
FT                   LSRESQQQTVLLGTATDADDNALTYRWLEGATELQDWQSADAFGNAPLNLASLPPLALG
FT                   SHILTLQVSDGTATAADEVAVVIENTPPVAAPFAGGTYQVGQDIRLNGSVADYDGDLLT
FT                   YKWFEGTIVLAEGTVPSPAGGAPVLLPEHAVPGGLALGSHTLTLQVSDGINTVVATTSV
FT                   IVIDTAAPSITPVASDMILWPPNSTMRTVTIDTQAYDNSGEPVMLSVLITSNEPAETDK
FT                   DGNIIPDFSVANIDQATGVITLQLRAARQGNGGGRTYSVTITAVDGSGNSSSTEVLIRA
FT                   PHDMARQ"
FT   gene            114066..114242
FT                   /pseudo
FT                   /locus_tag="Geob_0087"
FT                   /note="toxin, PIN family; C-terminal fragment"
FT   gene            114257..114404
FT                   /pseudo
FT                   /locus_tag="Geob_0088"
FT                   /note="hypothetical protein; N-terminal fragment"
FT   gene            complement(114769..116256)
FT                   /locus_tag="Geob_0089"
FT   CDS_pept        complement(114769..116256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18463"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8C8"
FT                   /protein_id="ACM18463.1"
FT                   /translation="MKRNSMMWLVSLVLVTVVALLPGCGSDTNVYTSTGAKTGIVTGRV
FT                   VDSSTMQPIANADVTLVANGEKMAGKTSASSDPDLAGTFVFTGVSSTAPYVSSHTLKIS
FT                   ASGYATMQMGLIVSSSADNAPTTTSLGNISLAKGFDLTVVATDEGTPVAGVTISAASSG
FT                   VPITAVTDAGGKAILKGLSQEASYTIASAPFYDNNGALKYLSTTTSYTASSSHTLSMSL
FT                   IPANSTSDINIVGSNLLRDGSKNYYSYPSTYNHRVILPESVIKLVFNYPVTLSGAITAS
FT                   YLNDQVASSDPDYRKIINVPTISAALDETGTILTITNSAPYLKNQTYIFNGTVTAVINS
FT                   VSRSLSLSEVSASNPYFSNKVYVADNSSTGLSSTTAVKADNFNGTTGTTGTTQPNQVWL
FT                   VFPEKVYGTYSIIATRISSSGSWPNSSPVSFGFADGDVTYAENSGGADQASLFKLRVSG
FT                   LTLADNTGSNINEVTIDLKATDAEGNVLNRTLTLPVQ"
FT   gene            complement(116295..116762)
FT                   /pseudo
FT                   /locus_tag="Geob_0090"
FT                   /note="hypothetical protein; C-terminal fragment"
FT   gene            complement(116808..117932)
FT                   /locus_tag="Geob_0091"
FT   CDS_pept        complement(116808..117932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0091"
FT                   /product="Fic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18465"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8D0"
FT                   /protein_id="ACM18465.1"
FT                   /translation="MNQYIWQHKNWPRLTWDSERLIVPLGECRLRQGRLFSKVAGLGFN
FT                   LDPQAQAEILVEETLKTSAIEGELLDARSVRSSVARRLGLPSAGMPVDRRIDDLVAVLL
FT                   DATLNFDQPLTRDRLWGWQAALFPSGYSGMHRIKVGGWREGAEPRQVISGPVGREKIHF
FT                   QAPPADRLDQEMKRLLSWWDESNGKVEGIIRAAVAHFWFVTIHPFDDGNGRIARALTDL
FT                   ALAQDDKQRVRYYSLSAQIMAEREGYYDILERSQRGKCDITGWLEWFLACFARALERSD
FT                   EILNGVFSKSAFWRLHAQDSLTERQKKVINRLLDEGPGGFEGGLTTQKYASMSHCSRAT
FT                   AFRELDQLSQLGILTRMGQGRAVKYELKLGEKAR"
FT   gene            118362..118730
FT                   /locus_tag="Geob_0093"
FT   CDS_pept        118362..118730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0093"
FT                   /product="protein of unknown function DUF3135"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18467"
FT                   /db_xref="InterPro:IPR021482"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8D2"
FT                   /protein_id="ACM18467.1"
FT                   /translation="MDSESKLGFSSYTPTELMELCRKNPDLFDEMAADAIRQACLGGTP
FT                   EQTLKLRQMQWIIDAKLQKGKTPLERLRIMENIFYDQVYSDKGQLYKLIAGWAEVLGAI
FT                   NPRRPVSGKKSHMRLLKK"
FT   gene            118890..119618
FT                   /locus_tag="Geob_0094"
FT   CDS_pept        118890..119618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18468"
FT                   /db_xref="InterPro:IPR025245"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8D3"
FT                   /protein_id="ACM18468.1"
FT                   /translation="MKVITIFALAASLMLLAACQDLMLENVARDFGLSGLTLNQGILDD
FT                   GTIIKGLKEALSVGTERAVGVVSRQNGYFGNQVIKVLMPEKMRNVAELLGKVGFQRQVD
FT                   EFVLSMNRAAEKAAPVAVEYFVVAIREMTFADARQILKGGDTAATEYFRAKTATRISDA
FT                   FKPSVAKSLTDVGATRTYKSMMATYRSLPFTSTTSFDLDQYVTAKAVDGLFTMLGEEEK
FT                   KIRSNPAARTTELLRKVFAG"
FT   gene            119897..120673
FT                   /gene="bamO/etfB-4"
FT                   /locus_tag="Geob_0095"
FT   CDS_pept        119897..120673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamO/etfB-4"
FT                   /locus_tag="Geob_0095"
FT                   /product="electron transfer flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18469"
FT                   /db_xref="GOA:B9M8D4"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8D4"
FT                   /protein_id="ACM18469.1"
FT                   /translation="MKILVCIKQVPDMESRFKVNSSGDWFSDADLAFRINEYDEYAVEQ
FT                   AVQLREQLGDSSELTVLSIGPDRVQEAIKKALAMGCDRGVHIQDPDVHKKDPWQVASII
FT                   AAYAKGKNFDIIFTGFQSQDRGSAQVGVTVAELLGHACATTLVGFEYADGAVKAKRELE
FT                   GGVKGVVRLKVPALVTCQLGLNIPRYPTLPNIMKAKKKEIEAIGVADVLTEQPLSVTAS
FT                   FYPPAKKGGGIVLEGDVADLSDRLISILKDKTSVLR"
FT   gene            120683..121594
FT                   /gene="bamP/etfA-4"
FT                   /locus_tag="Geob_0096"
FT   CDS_pept        120683..121594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamP/etfA-4"
FT                   /locus_tag="Geob_0096"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18470"
FT                   /db_xref="GOA:B9M8D5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8D5"
FT                   /protein_id="ACM18470.1"
FT                   /translation="MKALLVGEYREGKLQDNIYELVAFAGKLGADVSMALVGDAANVPR
FT                   CNGTLHLADVAKYGEYNPGLHRDLILEAVKKEDPDYIVFAHSSYGWDLAPRVAAKLKAA
FT                   QISEVIGLNDGSLEVGCCNAKMRRTVKPAAGKAVVTLQAGAFSFQGEQGTPAVVALEVA
FT                   GAPDVEFLGYEPAEAKDVDLTKAEIIVSAGRGVGKKDNIPVIAALAKAFGGELGASRPV
FT                   VDAGWVEHSHQVGTTGQTVSPKLYVACGISGAIQHLAGMKKSDFIVAINKDKDAPIGEV
FT                   ADVLVVADVLQFAPALTAKLQG"
FT   gene            121681..122754
FT                   /gene="bamQ"
FT                   /locus_tag="Geob_0097"
FT   CDS_pept        121681..122754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamQ"
FT                   /locus_tag="Geob_0097"
FT                   /product="6-hydroxycyclohex-1-ene-1-carbonyl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18471"
FT                   /db_xref="GOA:B9M8D6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR017614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8D6"
FT                   /protein_id="ACM18471.1"
FT                   /translation="MSEVGYRWSMTAVGEPLVRSEFNPFPPAAGEVVVEVAGCGVCHTD
FT                   LGYYYDGVRFNHPAPLALGHEISGRVVAAGAGAEEWQGKAVLIPAVIPCGTCDLCLSGH
FT                   GTICRQQLMPGNDIQGGFASHIKVPARGLCPVDEKKLSAAGFELADISVVADAVTTPYQ
FT                   AVVQAEVAKGDLAIVIGIGGVGSYAVQVANAFGATVIAIDVDQAKLDNMAKYGAALTIN
FT                   SREVQGKDLKKVIQTFVKEKGLPATCWKIFECSGTTPGQDTAFGLLTFGATLSVVGFTM
FT                   NKIELRLSNLMAFHARALGNWGCLTELYPAALDLVLDKRIALAPFIEKHPLDQINEVFA
FT                   EAHAHKLTRRAILVPKK"
FT   gene            122819..123589
FT                   /gene="bamR"
FT                   /locus_tag="Geob_0098"
FT   CDS_pept        122819..123589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamR"
FT                   /locus_tag="Geob_0098"
FT                   /product="cyclohexa-1,5-dienecarbonyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18472"
FT                   /db_xref="GOA:B9M8D7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR017602"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8D7"
FT                   /protein_id="ACM18472.1"
FT                   /translation="MSESPLKVSLERDGMLLRLTLARPKANIVDAAMIAALQSALTEHL
FT                   PKPKLRAVLLSAEGPHFSFGASVDEHMPDCCAQMLKSLHALVLQLVESPVPVLVAINGQ
FT                   CLGGGLEVAAAGHLLFAAPGAMMGQPEIKLAVFAPAASCLLPERIGQAQAEDLLFSGRS
FT                   ITAEEALRIGLVTAIAEDPDKAALDYFDKNLASVSASTLRFAVRAARGDAMQRIRAKLA
FT                   AVEKMYLVELMSTHDAVEGLKAFVEKRPAVWQDR"
FT   gene            123639..124382
FT                   /locus_tag="Geob_0099"
FT   CDS_pept        123639..124382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0099"
FT                   /product="oxidoreductase, SDR family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18473"
FT                   /db_xref="GOA:B9M8D8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8D8"
FT                   /protein_id="ACM18473.1"
FT                   /translation="MDLKGKNAIVTGASLGIGSAIALDLAKNGANVAINYRKHSEEANA
FT                   ICAEIQKMGQKAIAVQADVASFKDAQAMVDKVVAELGSVDILVNNAGVNRDAVIWKMTE
FT                   EQWDECLAINLKGYFNYCRAVAPVMKDQGSGKIVNVTSINGMRGKFGQTNYSAAKAGII
FT                   GLTKALARELAKSNVNCNAIAPGLIETEMMAALPEDVKQKSLADIVLGRMGKPEEVAWL
FT                   VTFLCSEKSRHITGECIKVDGGQYI"
FT   gene            124557..125756
FT                   /locus_tag="Geob_0100"
FT   CDS_pept        124557..125756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0100"
FT                   /product="thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18474"
FT                   /db_xref="GOA:B9M8D9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8D9"
FT                   /protein_id="ACM18474.1"
FT                   /translation="MREAVIVDAVRTPVGKWGGALKNVRSDDLAAHCIAELVKRTKIDP
FT                   NLIEDVVLGCTNQAGEDNRNVGRMAALLAGLPYSAAGQTINRLCASGLNAINSAAQAIK
FT                   VGEGDVFIAGGTESMTRAPFVMAKSESPFSRDVKVFDTVIGWRFTNPKMTEPYAKEGMG
FT                   ETAENVAVRYGLTRQEQDEFALDTQKKWAAADAAGKFNDEIVPVVIPQKKGDPIIVSRD
FT                   EFPRGNDVTMEQLAKLPAAFRKDGTVTAGNSSGINDGAAALLLMEAETAKKLGYKPLAR
FT                   VVASAVAGCDPSYMGLGPIPAIQKVLKRANLKIEDIDLFELNEAFAAQSIPCIRELGID
FT                   PAKVNVNGGSIAIGHPLGSTGARITATLVHEMKRRNARYGIVSLCIGVGQGIATVFERV
FT                   "
FT   misc_feature    125811..126039
FT                   /note="conserved nucleotide sequence; Geob_R5001"
FT   gene            126053..126892
FT                   /gene="bamU"
FT                   /locus_tag="Geob_0101"
FT   CDS_pept        126053..126892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamU"
FT                   /locus_tag="Geob_0101"
FT                   /product="metal-dependent hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18475"
FT                   /db_xref="GOA:B9M8E0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8E0"
FT                   /protein_id="ACM18475.1"
FT                   /translation="MSEKTRKLRIDFHVHLSQYTYHKPWVTEWMSRQHPEGYEAFIRRY
FT                   SDPGAFEELLSAEGVDYACILAELSYVTTGVCTNKQVREFCAGRKRLIPFCDLNPHLYT
FT                   DLGAELHRKVETEGFRGIKLYPTYQHYYLNDTRMYPLYRAAEDLGIPVLIHTGSSVFTG
FT                   SRMKYGDPLHLDDVAGDFPSLNLVMAHAGRGFWYDRAFFLSKLHANLYMEISGLPPAKL
FT                   TTYFPEFSRNTDKIIFGSDWPAVPSLSGNMKAIGELPISKEGADNILGGNAARILGL"
FT   misc_feature    126914..127076
FT                   /note="conserved nucleotide sequence; Geob_R5002"
FT   gene            complement(127108..127761)
FT                   /locus_tag="Geob_0102"
FT   CDS_pept        complement(127108..127761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0102"
FT                   /product="molybdopterin-dioxomolybdenum
FT                   cytidylyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18476"
FT                   /db_xref="GOA:B9M8E1"
FT                   /db_xref="InterPro:IPR017696"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8E1"
FT                   /protein_id="ACM18476.1"
FT                   /translation="MSTPQRRMVRATRQTGLFHQPEPKVAGIVLAAGSSRRMGQPKQLL
FT                   PFRGRTVIERVVENALASSLQRVIVVLGHEAERIKPLLEQKSVTTVINSAYETGQSSSL
FT                   KAGLNAIPVNFDAALFLLGDQPLVTAETIDLIMAGFADSHAPIVIPTFDGQRGNPVLFS
FT                   RETFPLMDTLNGDCGARTLFQEYAGRIRSIEVQTPAILMDLDTEEDYRRLLARL"
FT   misc_feature    127698..127826
FT                   /note="conserved nucleotide sequence; Geob_R6101"
FT   gene            complement(127832..128617)
FT                   /gene="pcmW"
FT                   /locus_tag="Geob_0103"
FT   CDS_pept        complement(127832..128617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmW"
FT                   /locus_tag="Geob_0103"
FT                   /product="4-hydroxybenzoyl-CoA reductase molybdenum
FT                   cofactor biosynthesis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18477"
FT                   /db_xref="InterPro:IPR017587"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8E2"
FT                   /protein_id="ACM18477.1"
FT                   /translation="MKSFAEIVGIGPNGVVSIVGAGGKTSLMFHLARQLAYSGKRVLTT
FT                   TTTKILIPTAEQSETLLIDQDPQVILRQAKTHQAAGMHISAAAAYLPQTDKLNGFPPDA
FT                   IRTFEDSGLFDWVVVEADGAARKPLKAPAAHEPVIPENTSIVVALAGLEVLGRPLGEEM
FT                   VFRSELAGELMQLSPGETITVPALARLLAHPSGAFKGAPAQARRFIFLNKADTLELEEK
FT                   GAAVALQLNGASPSVAEAVMVGQLLEGINVHRVYVGGSQ"
FT   gene            complement(128622..129428)
FT                   /gene="pcmV"
FT                   /locus_tag="Geob_0104"
FT   CDS_pept        complement(128622..129428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmV"
FT                   /locus_tag="Geob_0104"
FT                   /product="4-hydroxybenzoyl-CoA reductase molybdenum
FT                   cofactor biosynthesis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18478"
FT                   /db_xref="InterPro:IPR017695"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8E3"
FT                   /protein_id="ACM18478.1"
FT                   /translation="MKALKERVIIMKGAGEMASGIACRLHRSGFSRLLMLETSFPLAVR
FT                   REVSFCEAVHDGQMAVEGIEAVRIEDGAGLAHAWETGRIAVMVDPKGDTVGRMQPDILI
FT                   DATIAKRNLGTAITDAPLVIALGPGFTAGTDCHVVVETNRGHNLGRLITAGQAEANTGI
FT                   PGNIGGFTKERVLRAKANGPFTTDRKIGDQITKGDVIGQVGTEAVTAPIDGILRGLIRP
FT                   GSQVTTGLKIGDIDPRGDAGYCHTVSEKARALGGSVLEAILAVYNR"
FT   gene            complement(129433..130194)
FT                   /gene="pcmU"
FT                   /locus_tag="Geob_0105"
FT   CDS_pept        complement(129433..130194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmU"
FT                   /locus_tag="Geob_0105"
FT                   /product="4-hydroxybenzoyl-CoA reductase (molybdopterin
FT                   cytosine dinucleotide)-dioxomolybdenum--sulfide ligation
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18479"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8E4"
FT                   /protein_id="ACM18479.1"
FT                   /translation="MWDWIGKLDELRRSNQLAVLVTVTKSSGSTPRKGGAKMIVLPDGT
FT                   FFGTVGGGTPEYYALEDARQCFESMQGGTGTVPLKPRGEFPACGGTMEYHMELINDNPV
FT                   LYIFGAGHIGQSLAHVLEGTPFRVHLIDERDEWINAPTLPGTAIRHQCHYSDFIGKANW
FT                   CDKRTFVTIMTYSGTMDQQVLEDVLPHHTRYVGMVGSKSKWAGIKKNLGEKGLDLSLVR
FT                   CPIGHDNGGNSPREIAISIASQLLATYYGRE"
FT   misc_feature    130234..130270
FT                   /note="conserved nucleotide sequence; Geob_R7301"
FT   misc_feature    complement(130295..130325)
FT                   /note="conserved nucleotide sequence; Geob_R7302"
FT   gene            complement(130332..132635)
FT                   /gene="pcmT"
FT                   /locus_tag="Geob_0106"
FT   CDS_pept        complement(130332..132635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmT"
FT                   /locus_tag="Geob_0106"
FT                   /product="4-hydroxybenzoyl-CoA reductase, (molybdopterin
FT                   cytosine dinucleotide)-oxothiomolybdenum-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18480"
FT                   /db_xref="GOA:B9M8E5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR017607"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8E5"
FT                   /protein_id="ACM18480.1"
FT                   /translation="MSDTHKVIGRSVPRIDGPDKVTGGAKYTGDLKFPNMLYGKILTSP
FT                   YAHARIVSIDTSAAEALPGVKAVITHKDVPELKYGLSPARWDENIFCIDKVRFVGDKVA
FT                   AVACVDEETCYKAMKLIKVEYEELPAVLDFRHAMDEGQPLVHEEYERNINTEIHQEFGD
FT                   VEKALAEAHHVRTDVFVGQRTYQTPIEPHSSISMWEGEKLTIYASTQSPHYFQYYIARE
FT                   FGMPMGDVRIIKPYLGGGFGGKLEPTGLEFAGAVLAKRTGRPVRTFYDRAEMFAHNRGR
FT                   HAQYMEITTGVDKDGKILAAKANFVMDGGAYTSLGIASAYYAGALLPMTYEFDNYQFDM
FT                   FRVYTNLPACGAQRGHGAPQPKYAFESHLDNVAADLGIDPMDIRIRNARRADTVTPNDF
FT                   QVNSCKMRECLERAREISGWDEKKKNLPHGRGIGVATGSFVTGAGYPIYRTDLPHAAAF
FT                   IKVHEDGTAATLYTGSVDIGQGSDTILCQMAAEAMGYRYEQMKIVAADTEITPLDFGAY
FT                   ASRQTYMSGAAVKQAGEEIKKQLLEMASTMLSLPADDLECEEGVIFSKSRTGKSVTFEE
FT                   AARRHFVLKGPLLGRGAYTPPKLGGSFKGAAVGTSPAYSFGAQVGEVSIDKETGEISVV
FT                   GIWDVHDCGKVINPRLLHGQVHGALYMGMGESVWEEVLFDDKGRIKNAELANYRLLTAM
FT                   DMPPIQSEVVDSIEPSGPWGVKEIGEGSTNPTLGMFSNAIFDAMGVRVNSLPLTYEKVW
FT                   RALKEKREREEAKA"
FT   gene            complement(132739..133254)
FT                   /gene="pcmS"
FT                   /locus_tag="Geob_0107"
FT   CDS_pept        complement(132739..133254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmS"
FT                   /locus_tag="Geob_0107"
FT                   /product="4-hydroxybenzoyl-CoA reductase, iron-sulfur
FT                   cluster-binding subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18481"
FT                   /db_xref="GOA:B9M8E6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8E6"
FT                   /protein_id="ACM18481.1"
FT                   /translation="MPQMITDKDGVQRYLITLNVNGDAKTVLVKGNAILTNVLRDQLDL
FT                   TGTKKGCELGDCGSCTVLLDGKPVDSCLMLAVEVDGREITTIEGVAANGKLDAIQESMI
FT                   NHAAVQCGYCTPGMVLSAKALLTRNPHPTETEVREAIAGNLCRCTGYVHIVEAVLAASQ
FT                   GRTAPEDH"
FT   gene            complement(133266..134135)
FT                   /gene="pcmR"
FT                   /locus_tag="Geob_0108"
FT   CDS_pept        complement(133266..134135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmR"
FT                   /locus_tag="Geob_0108"
FT                   /product="4-hydroxybenzoyl-CoA reductase, flavoprotein
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18482"
FT                   /db_xref="GOA:B9M8E7"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8E7"
FT                   /protein_id="ACM18482.1"
FT                   /translation="MYMPDFAYHAPQTLDEACTLLAELGNKAIVLAGGTDVLHKMKVGK
FT                   LAPENLVSLKHLDDLRTIRHEPGRGIVMGALTSHNAIYTSKLLQERFLSLPMAAHTMAS
FT                   NQICNMGTVGGNIVNGVPSADLPPILIALNASIRLVSVKGERTMPLEDFFHGAAETVIA
FT                   PGELLADITIPDQPTTGSTYMKFGLRRSGALAVVGVAVSVRVAGDILEDARVVLASAAP
FT                   TVMRAKGAEDFLRGKKINDDLLAEAGEKAAAASRPRDSIRGSAEYRRNLVGVLTKRALR
FT                   KAIDEGHV"
FT   gene            complement(134237..134671)
FT                   /locus_tag="Geob_0109"
FT   CDS_pept        complement(134237..134671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0109"
FT                   /product="winged helix-turn-helix transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18483"
FT                   /db_xref="GOA:B9M8E8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8E8"
FT                   /protein_id="ACM18483.1"
FT                   /translation="MQEELTRMISYRDNIVFLFAKAHQRAQGTLKGRLQTFALTPMQCL
FT                   FMEALWEEDGLSVGEIGRRISLDTATLAGILDRLVTSGWVRREADAQDGRVARVYLTEK
FT                   GTAAIGQLAATMEQTNDELLKGFSPEERLLLKRFLKDFRE"
FT   gene            complement(134749..134943)
FT                   /gene="pcmP"
FT                   /locus_tag="Geob_0110"
FT   CDS_pept        complement(134749..134943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmP"
FT                   /locus_tag="Geob_0110"
FT                   /product="twin-arginine translocation pathway protein,
FT                   TatA/TatE family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18484"
FT                   /db_xref="GOA:B9M8E9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8E9"
FT                   /protein_id="ACM18484.1"
FT                   /translation="MFGFGMPELIIILVIMLVAFGPAKLPQLGSALGGAIRNFKKGSEE
FT                   PAALTDNGKSDNEKEPSSL"
FT   gene            complement(134966..135811)
FT                   /gene="moeB-2"
FT                   /locus_tag="Geob_0111"
FT   CDS_pept        complement(134966..135811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeB-2"
FT                   /locus_tag="Geob_0111"
FT                   /product="molybdopterin biosynthesis sulfur carrier protein
FT                   sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18485"
FT                   /db_xref="GOA:B9M8F0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8F0"
FT                   /protein_id="ACM18485.1"
FT                   /translation="MDELRQFLAERAENGLISWASQVAAAERFRTTLAQVEETALLLEI
FT                   LPARYQRNRQAINIAQQLTLFQGVVAVAGCGGLGGYIIEELARLGVGTIVAIDPDVFEE
FT                   HNLNRQLLSSPARLGEAKVESAAARVAEINPAVALVPVQIAYAPKNAAQLFHGVQVVVD
FT                   ALDSVSTRLALSDSCDSLGLPLVHGAIGGWFGQVVTQFPGDGTIRQLYSRWVEGKGLEQ
FT                   RLGNPSFTPALVASIEVAEVCKILLGAGNTLRNRKLSINLLDMEFEEIRLDGQDKAVGQ
FT                   "
FT   gene            complement(135813..136037)
FT                   /gene="moaD-2"
FT                   /locus_tag="Geob_0112"
FT   CDS_pept        complement(135813..136037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaD-2"
FT                   /locus_tag="Geob_0112"
FT                   /product="molybdopterin biosynthesis sulfur carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18486"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8F1"
FT                   /protein_id="ACM18486.1"
FT                   /translation="MDITVKLFATFRFGRFAAATRQYPPSTQISEIIDELQIPVSEISM
FT                   IMLNGRHADPDQRLRDGDSLALFPLVAGG"
FT   gene            complement(136060..137790)
FT                   /gene="aorA-2"
FT                   /locus_tag="Geob_0113"
FT   CDS_pept        complement(136060..137790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aorA-2"
FT                   /locus_tag="Geob_0113"
FT                   /product="aldehyde:ferredoxin oxidoreductase,
FT                   bis-(molybdopterin)-oxotungsten-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18487"
FT                   /db_xref="GOA:B9M8F2"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8F2"
FT                   /protein_id="ACM18487.1"
FT                   /translation="MNKILRVNMTTLTTGTESVPKEWAALGGRALTSTIVAKEVPPTCH
FT                   PLGENNKLVFAPGLLSGTTAANSGRFSAGAKSPLTGTIKESNAGGLAAQMFARLGIKAL
FT                   IIEGLPKGNNWHSLHVNKDGVSIAEESELIGKGNFAVVETLEKRLGKKTGVITIGPAGE
FT                   MKMLAANISVKDSDSKLRSHGRGGLGAVMGSKRIKFISIDDSDAPGIKLADPTKFTTAA
FT                   RVFAKAILEHPGTGQGLPTFGTAEMVNIVNEAGGLPTRNFTYGRYEGHEKISGETLRET
FT                   IIERGGKPKHGCQPGCIIQCSQVYHDKQGNYVTSGFEYETIETLGANAGLGDLDQIATA
FT                   DSIMDDIGVDSIETSIAFGVAMEAGVLPFGDGEGVLRILKEDIGKGTPLGRIIGSGAGH
FT                   VGKVYGVTRVPVVKNQAIPAYDPRSIKGIGITYATSTMGADHTMGYAVATNLMGVGGGI
FT                   VDPLKKDGQVELSRHLQIVTVMLDSIGLCLFIGFPAADIPTCVPALLDMLNARFGLELT
FT                   PDWIGGLGVNTLKTERAFNLAAGFTNKDDRLPEFFREPLPPHNAVWDFTDEEIDAFWNF
FT                   "
FT   misc_feature    complement(137822..137864)
FT                   /note="conserved nucleotide sequence; Geob_R9035"
FT   gene            complement(137935..138702)
FT                   /gene="pcmM"
FT                   /locus_tag="Geob_0114"
FT   CDS_pept        complement(137935..138702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmM"
FT                   /locus_tag="Geob_0114"
FT                   /product="oxidoreductase, SDR family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18488"
FT                   /db_xref="GOA:B9M8F3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8F3"
FT                   /protein_id="ACM18488.1"
FT                   /translation="MGRLSGKVAIITGGAQGIGAAYAVGLAKEGAKIVIADVLDGQKAV
FT                   EAVKKAGSDAIYVKTDVSNQEQCDAMAKAAQEKFGSVDILLNNAAIFGSIVLKPFTECT
FT                   SQEFMKVLEINVLGQFNCMKAVFPHMKAKGGKIINIGSSSINEGVPGMPHYVASKGAIM
FT                   ALTRSMAREMGDYKINVNTIAPGFTHSDGGNNFDKNKKLDLPPLEELQLQARCLKREAV
FT                   PEDLVGLALFLASDDSAFITGQMIVHDGGLSFH"
FT   gene            complement(138845..139936)
FT                   /gene="buk-2"
FT                   /locus_tag="Geob_0116"
FT   CDS_pept        complement(138845..139936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="buk-2"
FT                   /locus_tag="Geob_0116"
FT                   /product="butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18490"
FT                   /db_xref="GOA:B9M8F5"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8F5"
FT                   /protein_id="ACM18490.1"
FT                   /translation="MTTDKKILIVNPGSTSTKIGVFTQGKMVINQSVKHDDAELRKFPT
FT                   IWDQYDFRRDAIFKVLQDNDLSMGEMDAIACRGGNVRPLPGGIYRICPKMIEDMKSGIY
FT                   GGHPINVGGLVAFDLGNQFNIPVLTADPPMTDELCTSARYSGIPQISRQSSFHALNQKA
FT                   TARKIAAELGKKYEEANLIVTHLGGGISVGAHRRGKIIDVNNALDGDGPFSPERAGSLP
FT                   AGDLVKLCFSGEYSKKEVLKMLTGGGGLYAYLGTTDAQEIERRIAAGDQKAAQVYEAMI
FT                   YQVAKEIGACAAVLEGEVDAIALTGSLVYSKMLLNSLQKKISFIAPVLLNPGENEMEAL
FT                   ADAAMRYFNNEEALSIYKQEQAA"
FT   gene            complement(139990..140907)
FT                   /gene="pcmK"
FT                   /locus_tag="Geob_0117"
FT   CDS_pept        complement(139990..140907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmK"
FT                   /locus_tag="Geob_0117"
FT                   /product="p-cresol transport outer membrane protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18491"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8F6"
FT                   /protein_id="ACM18491.1"
FT                   /translation="MKLVKGLVFVCLATLVLLQPAWAFNSSSFNGTADFYAGAAPPPGL
FT                   HLIDYNVYMDIRKVENKGQGLTDGTGTLTALAFRPIYVAEKGLLGGNLLFHSIIPLLSM
FT                   EANVTAQTPGGPITVQGHDGGLGDIYFGIGNAWHTPVWHWLTVLDIITPTGHFDPNKPM
FT                   NAGNNAFVIEPVVAVTGLFANGFETSAKLMYSIPTKNGDYVEPGTLLKGYKTGQAIHMD
FT                   YNVNYALTKDFKLGVTGWIWQGLESDEIGGVKRHDTKDFEFSMGPAMRYQNGKFGLVGK
FT                   YVVPISAENRIEANQLWVDLIYSF"
FT   gene            complement(140939..142504)
FT                   /gene="pcmJ"
FT                   /locus_tag="Geob_0118"
FT   CDS_pept        complement(140939..142504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmJ"
FT                   /locus_tag="Geob_0118"
FT                   /product="p-cresol methylhydroxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18492"
FT                   /db_xref="GOA:B9M8F7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016170"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8F7"
FT                   /protein_id="ACM18492.1"
FT                   /translation="MSSFIALPQGLKEEIFARAIREYRSLLGENKVRTDQASLQPYMRT
FT                   TIAENGTSRKPSAVIYPSAPNDIQRIVKIANKFKTPLWTYYGGENEGYGGATPATNGQI
FT                   VLDLKNMKKVIEVDKELGYCLVEPGVTYGELQQYLKNNKIDLWLDAPASAAGMSVVGNI
FT                   LERGAGYTPYSEDFLFSCGMEVVLADGNLFRTGMGGIPKSTSWQVFKWGFGPYVDGLFS
FT                   QGNNGIVTKLGTWLMGAPPPGGYMPFCIKFPKVEMISEIIKPLMFLRETQIVPNAAALV
FT                   NAGWEAATVFSANGKSNGSFVRNGGGPVPTKKLMDSYRVGAWNLYGAVYGSPEQVALNW
FT                   MYVSGTFKQAFGNKIQIITEKEAKGDPVFEYRKQLMMGGVTQQNPLDKWRAGGGSMLFC
FT                   PTAAARPAECAQQVKVATEIINRHGFDYLSEFSFFWRDARHVMDLRFNNADPAESKRAY
FT                   KCYDELVGSFIKHGWAINRTNTAFMNKVSDSYGPAMARLNRTIKKALDPNNILAPGKSG
FT                   ITLG"
FT   gene            complement(142613..144262)
FT                   /gene="pcmI"
FT                   /locus_tag="Geob_0119"
FT   CDS_pept        complement(142613..144262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmI"
FT                   /locus_tag="Geob_0119"
FT                   /product="p-cresol methylhydroxylase, alpha-prime subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18493"
FT                   /db_xref="GOA:B9M8F8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016170"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8F8"
FT                   /protein_id="ACM18493.1"
FT                   /translation="MSRFVALPQGVSEATFAKAIQEYRALLGEGRVRTDPASLQSYMKI
FT                   MIPESEELHKPSAAMYPKTVKEIQAIVAIANKYKTPLWTVSTGKNMGYGSSAPATRGQI
FT                   VLDLKTMKKIIHVDEELGYCLVEPGVTYYDLQQHFKKHKMNLWVDVPAPSAMASPMGNT
FT                   ADRGVGYTPYGEHFLFSCGMEVVLANGDVIRTGTGGVPNSTSWQANKWGYGPYVDGIFT
FT                   QSNYGILTKLGVWLMKGPPPGGYFPFLMKFPKVEMLADIIKTLMPLRLAQIIPNACIVV
FT                   NAGWEAAGYFTYDKNGKGTNRETFYKGKDSLPPKVFQQIMDKYDVGAWNFYAAVYGSPE
FT                   QVALNWKYVSGAFKAKFGNQVRIITEKEAKDDPIFEYRRQLMMGGSTLQEFGLYNWRGG
FT                   GGSMWFAPVAAARPSECDRQMRLATEVLNKYGFDYVSEFIVGWRDMHHIIDLLYDRTDR
FT                   EEMNKAYKCFDELLTVFTNNGWGTYRTNTAFMDKVSHSYGPGMRDIHYRLKRALDPNNI
FT                   LAPGKSGIDLNPHNPGYAFNEGLNHGRPLDVP"
FT   gene            complement(144286..144702)
FT                   /gene="pcmH"
FT                   /locus_tag="Geob_0120"
FT   CDS_pept        complement(144286..144702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmH"
FT                   /locus_tag="Geob_0120"
FT                   /product="protein PcmH with twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18494"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8F9"
FT                   /protein_id="ACM18494.1"
FT                   /translation="MINQSRRGFFKTVFTAGAALAASTMGSQTHVAEAVNTGQIKGICL
FT                   YVPSLGKASEFVEEMNRNAPGEWTARPLPGEMVDCYLETKNLYEEARGNANTFVGVVDP
FT                   ATFAIVHEAIADSGGSFHYVKYEERNRVTFSAQM"
FT   gene            complement(144699..145154)
FT                   /gene="pcmG"
FT                   /locus_tag="Geob_0121"
FT   CDS_pept        complement(144699..145154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmG"
FT                   /locus_tag="Geob_0121"
FT                   /product="p-cresol methylhydroxylase, beta subunit
FT                   cytochrome c, 1 heme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18495"
FT                   /db_xref="GOA:B9M8G0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8G0"
FT                   /protein_id="ACM18495.1"
FT                   /translation="MNGKNLALINRISALTKSFTAQKTQKTISNLLIIIGAILVGMLPG
FT                   RAAQAQEPPKMPYVFGMYCFMCHKEGVQIGPMGMFDMLSKTGNPLHEQFIRNNVRFGIK
FT                   AMPAFRLSEVSPKELDGIVKYLKELAAYRKSHPNYKPAPVQEGGSKK"
FT   gene            complement(145205..146131)
FT                   /gene="pcmF"
FT                   /locus_tag="Geob_0122"
FT   CDS_pept        complement(145205..146131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmF"
FT                   /locus_tag="Geob_0122"
FT                   /product="menaquinol oxidoreductase complex, cytochrome c
FT                   subunit, 4 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18496"
FT                   /db_xref="GOA:B9M8G1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8G1"
FT                   /protein_id="ACM18496.1"
FT                   /translation="MEKAVLRKLTLLCVICGFAAIALLGVTAFRDGKREWKDYQAEYKE
FT                   LLLKKMNRERNPSFYDRIAGMEPEVKQVVIDEWKTTDRCMSCHMGIEDPLFTDAALPLR
FT                   THPYPELLKNHPVEKYGCTICHGGQGLATTYDGASHRTIANWPFPMVPKELMQSRCGYC
FT                   HKDFEAIGANKLIKGRELYKEMHCAGCHQIDGQGGAIGPDLSNFADKDPSNFSFENLEG
FT                   KHSKQIWVIEHFKDPQKVSPGSPMRTYAMNNQQIEWLSSYVLSLNQRNLQRQYTPKVKA
FT                   DFVAPKVDVTLPEAELYSSSEDEESSE"
FT   gene            complement(146146..146664)
FT                   /gene="pcmE"
FT                   /locus_tag="Geob_0123"
FT   CDS_pept        complement(146146..146664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmE"
FT                   /locus_tag="Geob_0123"
FT                   /product="menaquinol oxidoreductase complex, iron-sulfur
FT                   cluster-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18497"
FT                   /db_xref="GOA:B9M8G2"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8G2"
FT                   /protein_id="ACM18497.1"
FT                   /translation="MELGNNSNVTILPLKASDEAVDENRRGFVKKLTLTTLVLGIGGSV
FT                   LQLGRFFKPNVLYEPSRTFKVGELNKFPFGSRTVIEGRGIEIVREKDGVHAVSLVCTHL
FT                   GCLLKPVLNDSEVGYACPCHGSTFALKGEVLGGPAPKDLPWYEVYMDNTGTLVVDTSKV
FT                   NQKRTKLVV"
FT   gene            complement(146706..147227)
FT                   /gene="pcmD"
FT                   /locus_tag="Geob_0124"
FT   CDS_pept        complement(146706..147227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmD"
FT                   /locus_tag="Geob_0124"
FT                   /product="menaquinol oxidoreductase complex, membrane
FT                   protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18498"
FT                   /db_xref="GOA:B9M8G3"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8G3"
FT                   /protein_id="ACM18498.1"
FT                   /translation="MQAIKKEEIFPKDTNKTYSLMAIVEGESFHVERGPEDTVQTWPHL
FT                   LVRELLLFLVVLVVILGVSLLFNAPLEEAANPLHSTNPAKAPWYFVGIQELVSYSAFLG
FT                   GIVVPIGIVVGLLLLPYLDRNPKGTGVWFSRDRKLANLLFTVFVVAMVVLIIIGQYVRG
FT                   PNWVMHWPWS"
FT   gene            complement(147251..148003)
FT                   /gene="pcmC"
FT                   /locus_tag="Geob_0125"
FT   CDS_pept        complement(147251..148003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmC"
FT                   /locus_tag="Geob_0125"
FT                   /product="menaquinol oxidoreductase complex, cytochrome b
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18499"
FT                   /db_xref="GOA:B9M8G4"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8G4"
FT                   /protein_id="ACM18499.1"
FT                   /translation="MSESTYSIMDSIKHLPKNIKESFVRREAGTPEQEQAANVFGNVFL
FT                   HLHPVRVHVNALRPGYTLGLGLISFYLFLILVLSGILVMFYYTPSTELAYQNMKDLEYV
FT                   VSFGVVLRNVHRWSAHAMVALAFLHMCRVFYTGAYKAPREFNWVIGVCLLIVTLFLSFT
FT                   GYLLPWDQLAFWAVTVGSNIASYMPWIGDKVRFLMLGGNEVGQMALLRFYVLHVAVLPL
FT                   IAAVLVGVHFWRIRKDGGLSRPPSQLED"
FT   gene            complement(148051..149892)
FT                   /gene="pcmB"
FT                   /locus_tag="Geob_0126"
FT   CDS_pept        complement(148051..149892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcmB"
FT                   /locus_tag="Geob_0126"
FT                   /product="FAD-binding pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18500"
FT                   /db_xref="GOA:B9M8G5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8G5"
FT                   /protein_id="ACM18500.1"
FT                   /translation="MGNLNGKYQVKILGIEDYQALTACQSACPLGTDTKRYVRAITEGD
FT                   YEKAFLIARQTNPLVSVCSRVCTAPCEKNCRKGAEGSPVDIRALKRFACDRHGVASPAA
FT                   VAERLDEFSQWDEWMSDRTGNNILTMSRWLQKAKEKTGDTKLSPRVAIVGSGPAGLSAA
FT                   HDLALLGYRVTIFEAAPQPGGQLMTGIPGFRLPKEIVMEEIEAILKLGVELKLNSPIGR
FT                   GVSLADLRQQGYDSIFITIGLQDPLKLALEGSELKGVYTGIDYVRDHGQMTMGKSCVVI
FT                   GGGGVAIDCAQHALRQGAIQVAIACLESWETMPASLSDKEDAQEEGITFYPSLGPQRVV
FT                   GQEGRATGVEFLKVSSVFDAEGKFNPTFVPDSTTILLADTVILAVGQSSTLPSLSGMEG
FT                   LELTPNGLIRANDDLSTNLPGVFAGGDDRWRFGRNATDAIADGQKAARAIHGYLSGKDL
FT                   QVRKKAYMRTVAPDFQNTRCETIASVKVPKREAGERIRTQEEITLGFAEEQARQQAARC
FT                   RQCSIQTVFDRSRCLRCGTCVDTCVNGALRLVRLADIQGDGNLEKLTDALEKSSGKKGM
FT                   TAIIKDDSRCASCGMCARRCPGGAITMAEFYCQEEWE"
FT   gene            complement(149923..151173)
FT                   /locus_tag="Geob_0127"
FT   CDS_pept        complement(149923..151173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0127"
FT                   /product="membrane protein, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18501"
FT                   /db_xref="GOA:B9M8G6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8G6"
FT                   /protein_id="ACM18501.1"
FT                   /translation="MGIVEKHSSYRWLVLLAGCLAICTIYMDMIAYAPILGEIAKKLTI
FT                   EMGAATNLMMGFVLSVACVLIWGGVVCDKFGITTALVLGLLCSTLPTAIIPWIGGNYAA
FT                   VMMARLVQGASVGFVFATIGPILALWFHPREHGMASGLLIGSISLGCAIGVFASPAVLG
FT                   MTGSWEKTIFTLGIPGWAAILLAIIATRKNPPQISTEEAISSSDTPPTSMSFMDALACP
FT                   ITWLGSLIVFCNAWAMYGLYNLVPPYLAADAPMGLGLGAAMSGKLSIAVTIIGLFATIF
FT                   GGLFFDKVAKGNSRLAAIIGFLISACVIVILLPAVSKSITVLALCLLVVGWGIPFMGPS
FT                   ISAFIAMNYPPGIVGRMIGWWFGFGTFGGAAGLYLGGMSISKSGNFYLAISMISIASMI
FT                   GVLLSLFLKRTLKPTAA"
FT   gene            151691..153448
FT                   /locus_tag="Geob_0128"
FT   CDS_pept        151691..153448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0128"
FT                   /product="aromatic catabolism-like sigma-54-dependent
FT                   transcriptional regulator, XylR and V4R domain-containing"
FT                   /note="domains: XylR, V4R, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18502"
FT                   /db_xref="GOA:B9M8G7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8G7"
FT                   /protein_id="ACM18502.1"
FT                   /translation="MYKQSGKTRTVSDTNTGDLRARLRFCAETGQIWLHEHRMLLVHAE
FT                   AQASLRRELIDTLGMDRARGLLTRMGYAAGMRDFELARTRPGSDGDVEAFMAGPELHML
FT                   EGIARSTIISLEYDRNAGSFYADIIWEYSWESEWHRHYYGNYSEPVCWSQVGYACAYAS
FT                   AFMGHPILYKEVECSGMGESHCRIIGKPLEEWDDASEYSRFFVKESIAEQLIDLQTQVV
FT                   QLRSAIGEKEKIPSDIIGNSPAFRAAYDLCQQAAATQITVLLLGETGSGKEVFARALHN
FT                   RGARRNESFIAINCAAIPQDLVESELFGVEKGAYTGALTARPGRFERAHEGTLFLDEIG
FT                   DLPLSAQAKLLRVLQEGEIERLGDDKVRKIDVRLVAATNVDLKQMVKEGKFRSDLYYRL
FT                   NAFQIEIPPLRKRKEDIPIIANRYLEKYSAVHGKKINGFTDKAMRALLAYPWPGNIREL
FT                   MNMVERGVILAPNGSRIELEQMFSGSADSPGPEFGLNSNGSLGMNQTESETNLQDEVLN
FT                   GSMTLDQAEAALIEAAVKKANGNLSAAARVLGVTRPQLAYRLKRLNGTESQPSGVTLSS
FT                   SDELAAGNL"
FT   gene            153448..153951
FT                   /locus_tag="Geob_0129"
FT   CDS_pept        153448..153951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18503"
FT                   /db_xref="GOA:B9M8G8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8G8"
FT                   /protein_id="ACM18503.1"
FT                   /translation="MKDTLGMGVQRYLRDHHVANLSTCGHDGPWGAAIFYANDGYTLYF
FT                   LSSPTSRHCLDLTDNPCVAVTIQENQVDWLAIKGVQIQGIASKISGAEEEKARSLYGEK
FT                   FPLVGLLAKAPAAIVQAMAKVSWYKVVPHRLYFIDNSLGLGHRDELALGLPDGGGKSGG
FT                   NDGA"
FT   gene            153941..154981
FT                   /locus_tag="Geob_0130"
FT   CDS_pept        153941..154981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0130"
FT                   /product="CTP-dependent riboflavin kinase-related domain
FT                   and phenylphosphate carboxylase, delta subunit fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18504"
FT                   /db_xref="GOA:B9M8G9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023602"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8G9"
FT                   /protein_id="ACM18504.1"
FT                   /translation="MVLEGRLADGLGRGAAFTKLDWVRCRLMDTVGIDPFPGTLNLTLD
FT                   DDSNLARWRQWQDMPGHSLEPPDTGFCRARCYPVQVMGHIPAAVLLPEVADYPRNKVEL
FT                   VAALPIRRHLALAPAAQLSVELCRPLAVKAVLFDLDGTLVDSVEAYIQVAQVAAAPFGL
FT                   QVTEEQVRTALANGSSFWRGAVPKDRSDVDAVVKAIAAQAYREWPRILQEHSRLFEGIM
FT                   QTLDALRSLGIKLGIVSGARQEVLELLRPDRILDRFDAVVLGPDVPTRKPDPEGILKCL
FT                   GMLNVTPAAALYVGDAPIDIMASRAAGVYAVGVLTGAGDSASLSSQYPDRLISSHMNLP
FT                   AIVEAA"
FT   gene            155058..155377
FT                   /pseudo
FT                   /locus_tag="Geob_3840"
FT                   /note="HipA domain protein; frameshifted, C-terminal
FT                   fragment"
FT   gene            complement(155409..156380)
FT                   /locus_tag="Geob_0131"
FT   CDS_pept        complement(155409..156380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0131"
FT                   /product="peptidoglycan L,D-transpeptidase lipoprotein,
FT                   YkuD family, TPR domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18505"
FT                   /db_xref="GOA:B9M8H0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8H0"
FT                   /protein_id="ACM18505.1"
FT                   /translation="MRTGERVKSKSDRICHGCICVIMALICGCSHFSEEYKARPTFEEA
FT                   NKLFSQGSYHTALTKYKQIKEQYPTMGDRVLFEMGVIHGHPQNEQKDYEKALECFQKLV
FT                   RDYPGSGYRQDSEMMMFYINNVTLKDGTIAAQQKQNETLRHEAATLRQEVKDKENEITL
FT                   LQKKIEGLEQKISALTIQKVTADRILIEKKQRRLTLFSKGEVLKTYRIALGGNPDGPKE
FT                   RQGDNKTPEGTYFIDSRNRDSRYHLALHISYPNERDKRRAKELGVAPGGNIMIHGLKNG
FT                   FSYVGDLHTKADWTKGCIAVTDEEIAEIAKAVPNGTVVEIRP"
FT   gene            complement(156460..156780)
FT                   /locus_tag="Geob_0132"
FT   CDS_pept        complement(156460..156780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0132"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18506"
FT                   /db_xref="InterPro:IPR016367"
FT                   /db_xref="InterPro:IPR021793"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8H1"
FT                   /protein_id="ACM18506.1"
FT                   /translation="MRKGLLVIAIGLAFTALTGCATTGELEKVQAQEQLTGAKADQAIR
FT                   DAQAAKAAADAAKLQADAAAARVENAVKMAEEREKAAAEREKAADEKAARAEAIFQKSM
FT                   RK"
FT   gene            complement(156871..158190)
FT                   /locus_tag="Geob_0133"
FT   CDS_pept        complement(156871..158190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0133"
FT                   /product="peptidoglycan L,D-transpeptidase lipoprotein,
FT                   YkuD family, SPOR domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18507"
FT                   /db_xref="GOA:B9M8H2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8H2"
FT                   /protein_id="ACM18507.1"
FT                   /translation="MCLTVDLSFSSNFPLRLMALCMVILSLNGCVAMQRAQEGPSTFPG
FT                   QFAKEVEKNRFRVVLGDDVIGRLGVMELDEGDTLPDVARHFSLGVTAISAANPGVDIWV
FT                   PKAGEQVILPLRFILPDAPRKGIVVNLATMRLFHYKGDNNALVVTTYPVGIGTKERPTP
FT                   MGQMFVQRKVSRPTWYVPASIAEDHRKKGDPLPARVPPGPLNPLGECALYLSKPSYLIH
FT                   GTNKPASIGLNASNGCLRLYPENVKMLYDDTPLKTPVVIVNQPYLLGQDNGVLYLEAHK
FT                   PQEGSGALELEKIYAKLKSIEKRGARTLDWKKIKNVQVEARGIPVPIEMSQEDGEEAGK
FT                   PIEVEHPVKLYGKPEVPGLKSDAWYVLAAKMRDEIEALRIAAIINHQGPPIPARVLSKS
FT                   DGHRVIAGPFDDISAAKDAIKRLKIDLEIDGILIEPEKKI"
FT   misc_binding    complement(158246..158339)
FT                   /bound_moiety="cyclic diguanylate"
FT                   /note="cyclic diguanylate-responsive riboswitch;
FT                   Geob_R3001"
FT   misc_feature    158531..158697
FT                   /note="conserved nucleotide sequence; Geob_R8002"
FT   gene            158760..160700
FT                   /locus_tag="Geob_0134"
FT   CDS_pept        158760..160700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0134"
FT                   /product="sensor protein serine/threonine phosphatase, PP2C
FT                   family, PAS, PAS, PAS and PP2C domain-containing"
FT                   /note="domains: PAS, PAS, PAS, PP2C"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18508"
FT                   /db_xref="GOA:B9M8H3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8H3"
FT                   /protein_id="ACM18508.1"
FT                   /translation="MGRKILDDFLKRIGSKHRLEDETSQQSFALLQVVFNEAFQLMGLL
FT                   KPDGTLIKINKTAHRSITGHESEVIGKPFWETPWWVHSSIEQERLRQAVRDAARGEFVR
FT                   FETTHMTGDGQMIFVDFSLKPVKDQKGNVVLLVPEGRDISERRRAEQALRDVAMKYRIV
FT                   ADNTYNWEFWLAPDGRFLYTSPSCLRISGHRAEEFIADADLLIRILHPDDRQMWLNHRH
FT                   DIAKNKALSDVELRMVRPDGDIRWVHHICLPVFADNEEYLGVRGSFSDITNRRLAEEKN
FT                   ERLAGIVEASDDAVIGKTVDGIITSWNKGAAKIFGYSESEVRGQPVTMLVPPENAAQLL
FT                   HVHDRVRQGEHIEHFEIVSRRKDGTLINMSVTYSPVRDALGKVIAVSTIGRDITEQKKA
FT                   AAAMVENAMINRELDIAKQIQQSFLPECPSSLPGMLMTCCCIPAAQVGGDYYDFFALDE
FT                   SIIDAVIADVTGHSIGSSLLMSVTRSVLHAKVNLSRSPRDLLAAVNELLYDDLSRTELL
FT                   ISMFYVRIDTQRSTLAYANAGHNHPFLYRCRQRAFIDLDADGLVMGVRKTVCFDEKETV
FT                   LEPGDILVLYTDGVIEAENAEGEQFGTDRLCRVIESHCGLHPKEIMGAVLQESMLFKRT
FT                   DDVTMIIFKIV"
FT   gene            complement(160797..161366)
FT                   /locus_tag="Geob_0135"
FT   CDS_pept        complement(160797..161366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0135"
FT                   /product="metal-dependent phosphohydrolase"
FT                   /note="domains: HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18509"
FT                   /db_xref="GOA:B9M8H4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8H4"
FT                   /protein_id="ACM18509.1"
FT                   /translation="MVKLPIYEKIYALAKPYLNTRKNDIHVEISHGFAWRLLEDEPGDP
FT                   EVVIPAILCHDLGWIKLTEELQLKAFGPGFDPDLRRIHEVEGVKLARGILSRLDYNPQK
FT                   TIEILHIIDGHDSRIQAISDSDKIVKDADKLFRCTATGLAIDMERFRQEKGPYRQWITS
FT                   QIDSWFFTETGTRLAWAELKLAGFSP"
FT   gene            complement(161490..162422)
FT                   /locus_tag="Geob_0136"
FT   CDS_pept        complement(161490..162422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0136"
FT                   /product="phenol transport outer membrane protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18510"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8H5"
FT                   /protein_id="ACM18510.1"
FT                   /translation="MMASAYKHVFHMLRFLAVFSLLYAGPCWAGGGQHYPNGVEDFAVG
FT                   ALPPPGVYLVNYLILAQKSSLRDNSGNGLPANFKADVVAEVPRLIYVSPYKVLGASWGA
FT                   QAFLPFYSADIKSDSAAIPPLNFDSRDKGIGDIIFSPLVLGWHFSPELHAVFALDMWAP
FT                   TGNYDKDRPATTLLSKNIWTFEPVLAVSYLKEGFDISAKLMYDFNTRNSDTSTDPGQEF
FT                   HMDWALGYGLKNGLTGGLVGYNYWQTTEDEVNGVSKTSDKSRVGGIGVGIKYWPKQGPF
FT                   TMTLKQYWEYGARNIATGNQTQFKISYAF"
FT   gene            complement(162483..163088)
FT                   /locus_tag="Geob_0137"
FT   CDS_pept        complement(162483..163088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0137"
FT                   /product="aromatic acid decarboxylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18511"
FT                   /db_xref="GOA:B9M8H6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8H6"
FT                   /protein_id="ACM18511.1"
FT                   /translation="MSLPLVVAITGATGVIYGVEMLSVLKSLGQETHLIVSDAAAKNLE
FT                   IETSYTLEDVKSLADVVYDNNDIGASVASGSFRTSGMIVAPCTVKTLSSIANSFTYNLV
FT                   VRAADVTLKERRPLVLMVRETPLHKGHLDLMSRAADCGAILLPPMPAFYHKPESIMDII
FT                   HQSIGKALDQVGIEHNLFTRWNGHDRKEQLRETLRIAT"
FT   gene            complement(163143..163613)
FT                   /locus_tag="Geob_0138"
FT   CDS_pept        complement(163143..163613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0138"
FT                   /product="phenylphosphate synthase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18512"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8H7"
FT                   /protein_id="ACM18512.1"
FT                   /translation="MIVRNWMQNDPLTIPSDMLASEAKRVLIDNNLNSLLVVDNGQLRG
FT                   LVTRHNMMRMGHYVTRTQNPDEVSFFINRLRVRDIMVRNPATVNADDTMEHCLDYGKKL
FT                   RVAQFPVMENGVVVGIISATEIFQLAAHLCRSLEAGTLGKAPRRQTSVQASQ"
FT   gene            complement(163643..164899)
FT                   /locus_tag="Geob_0139"
FT   CDS_pept        complement(163643..164899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0139"
FT                   /product="protein of unknown function UPF0261"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18513"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8H8"
FT                   /protein_id="ACM18513.1"
FT                   /translation="MAQKKGIVIICNLDTRGEDIIFVKHLIEGRGHQAYFLDFSMEEPP
FT                   PFQGDITCEEVAERGGMTIEAVRECYRSDRDRAMENQIRGASAIVGDMLEAGKVQGVFG
FT                   VGGGTSSLVGTSVMKGVPFGIPKLMASPMAAHPVYVGKYVGTHDITMHHTVLDIVKMNP
FT                   LLKAQITNAVGAICGMVEMTQGTDIQFDKPCVAISSFGFGEMAVQAALDMLNEAGFTPI
FT                   VCHAQGKGDKAMEDMIRAGAFHGVLDICTGGIVENLFNGNRDPGPDRLMAAVEAGIPMV
FT                   LAPCGLDILSYGGRPDMLEKTKDRPQYVQDSLRVQVRTTAEELRQAADVIADRLNQARG
FT                   EWTFLIPLQGWSSQDIKGRIIYDPAADAAFVARLKEKVAEPHRIKEVDLHLYTSEFARA
FT                   AVDEFVRLYEGSPARAVAQ"
FT   gene            complement(164967..166469)
FT                   /locus_tag="Geob_0140"
FT   CDS_pept        complement(164967..166469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0140"
FT                   /product="phenylphosphate carboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18514"
FT                   /db_xref="GOA:B9M8H9"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR014096"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8H9"
FT                   /protein_id="ACM18514.1"
FT                   /translation="MSTNPKVKPINDIRSYIAALEAQGVMHRVKAEVDWKFELAHVSKV
FT                   NEEQKGPALLYENVKGHTIPVFTSAFTTPERIAICLEQDPSLTMCQLSRKWMELTTKQM
FT                   IKPTFVKNPPVMENIIPEEAVDLENFPAPWFYPDDGGRFFGTSGYLVTQDPDTGWTNLG
FT                   TYRSQILGKNILGSQIISGKHGDFHMKKYQERGEKMPVAYVVGGDPILFLASSTLVSAQ
FT                   TDEYDVGGALRGRPIEVFKSDLTGLTLPANAEIIVEGWMDPEELMEEGPFGEYTGYYSG
FT                   NKMKDYPKPVIRVKRIIHRTKPIFWSTTVGKPINDTHMVQSINRTATLWHDLETMKVPG
FT                   IQSVYFPAAATGRFWVIASVKQMYPGHSNHVADAINGSTTGHYGVKGIIIVDHDIAADD
FT                   MDRVWWALATRFDPKRSVQVINRGRSTPLDPGLPIEARDVVSRIIMDATTPYEWKNKPN
FT                   EIFMDRAVLQKVSDRWNEYGFSGVSPVAEMIPRLTRPEVKKK"
FT   gene            complement(166524..167657)
FT                   /locus_tag="Geob_0141"
FT   CDS_pept        complement(166524..167657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0141"
FT                   /product="phenylphosphate synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18515"
FT                   /db_xref="GOA:B9M8I0"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8I0"
FT                   /protein_id="ACM18515.1"
FT                   /translation="MMTDTAKANMGKSGNTANKDLPMVCWLEECRKDSVPLVGGKCSSL
FT                   GELINAGVRVPPGFALTTEGYRHFMADAGIDREVQARLKGIDSQDMDALENASAGIREM
FT                   IEAQPFSTEIEDLVAEKYRKLAVRSCLPAVPVAVRSSATAEDLPGASFAGQQDTYLWVR
FT                   GADEVLHNMRRCISSLYTGRAIAYRINQGYADEQVAISVGVQKMANSFTAGVMFTLHPG
FT                   NGDRSVIVIDSNYGFGESVVSGEVTPDNFVVNKITLDILERTISQKDIYYTVDQKTQVS
FT                   RAIEVPFERQKVQSLMDDEITELARMGKLIEKHYGRPMDIEWAVDKDLPFGGNIFILQA
FT                   RPETVWSQKQQPPGAVKGGASAMDYILASMLEGKRLT"
FT   gene            complement(167682..169511)
FT                   /locus_tag="Geob_0142"
FT   CDS_pept        complement(167682..169511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0142"
FT                   /product="phenylphosphate synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18516"
FT                   /db_xref="GOA:B9M8I1"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8I1"
FT                   /protein_id="ACM18516.1"
FT                   /translation="MKFPKPHEVKDIPGTEGWERMYPYQYKFVTDDPERKAYEEQAFWF
FT                   YDGLHYPEAIYPFDTIWDEAWYLGLSQYNNRIFQVPPVRGVDHRIINGYVYISPVPVMD
FT                   PEEVGSRVPNFMERAGFYYKNWAELEAKWEVKMKAIIKEIEELPIPRLPDLEDITVVTE
FT                   GIGESKGFHLLKAYDDLINLGIQCWQYHFEFLNLGYAAYVFFLDFVQKLFPSIPLQRVT
FT                   QMIAGVDVLMYRSDDELKKLAKKAVQLGIDQILTSRTEWTDAKAELKKNPKGKEWLAAL
FT                   EEARYPWFHVSTGTGWSHSDKSWNDDLNIPLSGIATYINQLKQGIDIERPVEKVRAERD
FT                   RITAEYRDLITSDEDRKTFDDLLGTAKTVFPYVENHLFYVEHWFHTVFWKKMREVAAIM
FT                   KEHGMIEDVEDVWYLRRDEIKQALWDMVTAWATGVKPRGTAVWPKEIAWRKGVMEKFQQ
FT                   WSPPPAIGTAPEVIKEPFTIVLWGVTNSSITDWSEVQDATDPDSITALKGFAGSPGIVE
FT                   GKARVCRNADDIRLLQEGEILVAPTTSPSWAPAFAKIKAAVTDVGGVMSHAAIVCREYG
FT                   LPAVVGTGLGTKIIRTGMMLRVDGSTGLVTIDR"
FT   gene            170247..172010
FT                   /locus_tag="Geob_0143"
FT   CDS_pept        170247..172010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0143"
FT                   /product="aromatic catabolism-like sigma-54-dependent
FT                   transcriptional regulator, XylR and V4R domain-containing"
FT                   /note="domains: XylR, V4R, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18517"
FT                   /db_xref="GOA:B9M8I2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8I2"
FT                   /protein_id="ACM18517.1"
FT                   /translation="MTKGWRTGKSDCKSKDGDLRARVHFCMESGHIWLHEHRMLLVHAE
FT                   AQATLRRELIETLGMERVQGLLTRMGYAAGMHDAELARTRFEGASDMELFMTGPKLHML
FT                   EGEVKVTPVKIEFDRTAGSFYGEFLWENSWEGQWHKRHFGTNGEPVCWSQIGYACGYST
FT                   AFMGRPILYKEVECVGMGKNNCRIIGKPIDEWEDATDYMRLFNRESIAEQLMDLQTQVV
FT                   QLRSAINKKEKLPSDIVGNSKIFCTAYELLQQAAKSQITVLLLGETGVGKEVFARSLHN
FT                   SGARSKESFIAINCAAIPHDLVESELFGVEKGAYTGAMTARAGRFERANGGTLFLDEIG
FT                   DLPFSAQAKLLRVLQEGEIERIGDHKTRKVDVRLVAATNVDLRQLVKEGRFRSDLYYRL
FT                   NAFQINIPPLRERKEDIPLLAKRFLEKYSAIHGKKLRGFTDKAKRALLSYQWPGNIREM
FT                   QNMIERGVILAPSGTRIELEQMFSASGEEHGLEIGLDNNGSLGANGWDYGKDLCEAVFN
FT                   GVMTLDQVEAMLIETAVAKSSGNLASAARKLGLTRRQLAYRLGNLRENEPAEPAIPVPR
FT                   EQRVKQSETAG"
FT   gene            172091..173902
FT                   /gene="bamV"
FT                   /locus_tag="Geob_0144"
FT   CDS_pept        172091..173902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamV"
FT                   /locus_tag="Geob_0144"
FT                   /product="sensor histidine kinase"
FT                   /note="domains: HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18518"
FT                   /db_xref="GOA:B9M8I3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8I3"
FT                   /protein_id="ACM18518.1"
FT                   /translation="MTCIIRRHKLPVALFLISIGAVAALLLIQHANRDVRAEARARFIE
FT                   QYNRQQSLMAELASHTLEELFATYHRNLDLVVNLFEGKAVTRHRVEEVKGSLKKIYSSL
FT                   ANTPVIEMVIFDSKGTAITIEPYDTYTIGRSYAWRDYYHWAREMGRPGQMYLSPYARLQ
FT                   GGMQRGNKALIVAEGIYGPGEKFLGVVICAIDFEVLAKKHILPIHIGKEGHAWLADISN
FT                   RTMLVGPSGRLVGLSFEEAFLPRWPRLYQLLLSMENGKPGSDWYDYLDPGTYQHQVRKI
FT                   GSYHPIRIENRLWALGISTPEHEVEELLSTFLHRQELFANTLLVTVLGVATLLLGFLIN
FT                   WNRVLSAQVQNHTRALSEAHTRLESTFDELLVAKKVAAVGQLALGLSHEIRNPLSAIQM
FT                   NMQMIRKKIDLAGTLRENFAIVDGEIQRLNRLLKDVMDFARPRSLNLQNTELKEIISRL
FT                   MQLLSQRLEEQLIRTTVRTESPIQLVCDPEQIHQVLLNLILNAMEAMNETPGERHLTIF
FT                   ARSADGMALVTVSDTGGGIPQGKLEQLFDPFYTTRASGGGLGLSIVQTIVLRHGGSVAV
FT                   ESQPGQGATFTVALPLKGPAGTGDMSQ"
FT   gene            173899..175266
FT                   /gene="bamW"
FT                   /locus_tag="Geob_0145"
FT   CDS_pept        173899..175266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamW"
FT                   /locus_tag="Geob_0145"
FT                   /product="sigma-54-dependent transcriptional response
FT                   regulator"
FT                   /note="domains: REC, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18519"
FT                   /db_xref="GOA:B9M8I4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8I4"
FT                   /protein_id="ACM18519.1"
FT                   /translation="MKTILIADDDKAIRRTLELHLTEVGYRVVTAANGSDAVNLALADT
FT                   AIGHNIDLMLLDLRLTGMDGFEVLTLVKEKKPFLPIIMITAYDEMQTAIKAIRLGAIDH
FT                   LGKPVDLDHLDEVIDKIFEMSALSRTGVTFSDSFDPHFEQNIMVGRTRAMKEVYKTIGA
FT                   VADSRATVLIQGESGTGKEMVARAIHFNSQFRNRPFIAVACSALSPTILESELFGHEKG
FT                   AFTGAIRTKPGKFELAQGGTLFLDEISEISPEIQVKLLRFIQEREFERVGGIETIKADV
FT                   RIVAATNKNLSTLVASGMFRNDLYYRLKVVSIDLPPLRERKEDIPILVKFLLEKLHHET
FT                   GKRVEIIPQETMNKILEHSWPGNVRELENTLRRAVILSHGNMLLPESLHLEEGCDGQER
FT                   FPLLLKPLHEVEREHIQNVLCYVRNEKKRAAEILGISRPTLDRRIKEYGLEEEDKP"
FT   gene            175665..176732
FT                   /gene="buk-1"
FT                   /locus_tag="Geob_0146"
FT   CDS_pept        175665..176732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="buk-1"
FT                   /locus_tag="Geob_0146"
FT                   /product="butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18520"
FT                   /db_xref="GOA:B9M8I5"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8I5"
FT                   /protein_id="ACM18520.1"
FT                   /translation="MEKTLLVINLGSTSTKIAVSKSEDMLFTESVPHTAEELKKYQRII
FT                   DQYELRERTVLDVLAEKKVALEQLDGIASRGGNMKPIPGGIYEICPAMIDDMKSGKYGQ
FT                   HPNMCGGIVAHQLGKKLNIPALTVDPPTVDELCISATYSGIPLIRRQSSFHALNQKATA
FT                   RKIAEQLGRKYEDVNLIVAHLGGGISVGAHRRGKVVDVNNALDGDGPFSPERAGTLPAG
FT                   DLVKLCYSGEYSREQVLRLVQGGGGLMAYLGTTSGLEIEKRITEGDMVAAEVFEAMAYQ
FT                   VAKEIGACAAVLEGQVDAIALTGSLAYSERLVENLKKKVSFIAQVRLDPGENEMAALAA
FT                   GAMRYFKGTEQLSIY"
FT   gene            176746..177651
FT                   /gene="ptb"
FT                   /locus_tag="Geob_0147"
FT   CDS_pept        176746..177651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptb"
FT                   /locus_tag="Geob_0147"
FT                   /product="phosphotransbutyrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18521"
FT                   /db_xref="GOA:B9M8I6"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8I6"
FT                   /protein_id="ACM18521.1"
FT                   /translation="MLKSFDELITAVQEKPRKKIAIVSPEGSTVMKLVKQALEAKLADF
FT                   ILVGDEEKIKTMSAEAGFDANLINIINIIDQKEAAEEAVRLVVVGSANAIMKGNLPTAT
FT                   FMRAILDKQKGLNDNKVISEITIYEKIVDAPGGGFRFITDCAINVSPTLDEKKQIIENA
FT                   VGLAHKLGNDLPKVAVISAVEVVNPAMPDTIEAAALSKMAERGQIEGCLIEGPLAFDNA
FT                   ISVESARYKKIKGEVAGQADIIMMPNLLSANPLRKCLVYYTQQRIATAVMGAKAPIVLT
FT                   SRSDSADTMLLTIALAAYIS"
FT   misc_feature    complement(177703..177736)
FT                   /note="conserved nucleotide sequence; Geob_R4101"
FT   misc_feature    177754..177787
FT                   /note="conserved nucleotide sequence; Geob_R4102"
FT   misc_feature    177873..178099
FT                   /note="conserved nucleotide sequence; Geob_R5003"
FT   gene            178247..180283
FT                   /locus_tag="Geob_0148"
FT   CDS_pept        178247..180283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0148"
FT                   /product="sigma-54-dependent sensor transcriptional
FT                   regulator, CBS_pair and PAS domain-containing"
FT                   /note="domains: CBS_pair, PAS, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18522"
FT                   /db_xref="GOA:B9M8I7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8I7"
FT                   /protein_id="ACM18522.1"
FT                   /translation="MRVSEIMLATRVQIRPGDTIRRAVELLQSSRLNGVPVVDDQGKLI
FT                   GYFSKSHLYDCLLQSVDIDSTIEKHYIREVVSACEDTTYDSLEALSQWLQSCRVGQTIV
FT                   VNRENEPIGVATQAGTVLELLDRTDYLFRELSGVIENVPAGILATSDTGMVTMANQYAK
FT                   NILGGVQSGRYIGDYLQELERDFSPVISGNWMLPRKIEHNALKLIATAVPIYQNMKNKG
FT                   VIFVIQDMTDVEGVAHELETVKELKMTLETVLEVAYEGVAVLDEAGMITLVNARFCNKI
FT                   GKPKDNIIGENINRFIPLSHNQMPLSVLEINAKPCVVSTLPITKEGNTKGFVVKIYEDL
FT                   DNLADIVQQINRINMQLNYYKNELYKVNGTSYTVGSIVCRDERIATLKSQVLQVGRSNS
FT                   TVLITGESGTGKELFAHSIHNASNRRKEPFIKVNCSAIPGELAEAELFGYEDGAFTGAR
FT                   KQGKPGKFELADCGTIFLDEIGDMPLALQSKLLRVIQDKEIERVGGVKARKVDVRIIAA
FT                   TNRDLKRMVTEGTFREDLYFRINVVELKIPPLRDRRKDIPLLADTFIRKYNNQLGRRVE
FT                   GITEAALEALTRYDWPGNIRELENIIERMLNYRESGLIELQDLPEEIVGRPGGMAAKAT
FT                   QTLAVMEMETIQAALAEAGGNKSKAARLLGISRSKLYEKLGSD"
FT   gene            180539..182599
FT                   /locus_tag="Geob_0149"
FT   CDS_pept        180539..182599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0149"
FT                   /product="bis-(molybdopterin guanine
FT                   dinucleotide)-oxotungsten-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18523"
FT                   /db_xref="GOA:B9M8I8"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037949"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8I8"
FT                   /protein_id="ACM18523.1"
FT                   /translation="MTSSKQVLTDCTLCYHSCGTTVTVEDGKAVKVEGLKGHPINSDQL
FT                   CPKGEAALTHVYSPHRIKTPLKKVDGKFVEITWDQALDEISAKLLKLKEEFGPSVLGVF
FT                   SGSIGVENLEMAQLTQRFKAAFGSPNFFSVESICYRMRIRTRQITFGKYPTEELDSKLY
FT                   ILWGHNPDASDFPLKLALERNLAKGSKLVVIDPRRTPMADQADMYLKIRPGTDGAMAMA
FT                   MLHVIIKEDLVDHEFVDKFTIGFDKLVPHVEPFTPEWAEEITWVPADKIRELARLFATT
FT                   KGASIFQGTCTQDQTAGGTQNSRAFSVLQIITGNINVPGGWVISPRPHFGNVGLNVEGD
FT                   PLGMDEYPLFIEVWGRKSPYGVITMVPEAIPDKLKAFYVVGGNPLVSMADSNAFREAFR
FT                   RLDLLVVHDMFMTETAQEAHYVLPACSHLEKWGLAYTYNVCHCLPYLMLRKKCIEPIGE
FT                   SWSEWKVFTELAKRLGIGDKFPWQSEEELIQFELGPTGITFEQMLHDQPEGLYYGEKKY
FT                   VVKDGMFATPTGKIEIYSDALAQVGANPLPEYIEPERSPRNSDAKYLKKYPLILSTGHR
FT                   NYYYVHSQFRGIDELKAEAPHPVAEMGLKTGSTYGLASGDDILIETNRGSIKMKVALDE
FT                   RVAEGCIFVPHGWSGEANANLLTDTDCREKILGYPDVKSLMCSVRKLSAAA"
FT   gene            182626..183321
FT                   /gene="mobA-4"
FT                   /locus_tag="Geob_0150"
FT   CDS_pept        182626..183321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA-4"
FT                   /locus_tag="Geob_0150"
FT                   /product="bis-(molybdopterin)-oxotungsten
FT                   bis-guanylyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18524"
FT                   /db_xref="GOA:B9M8I9"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8I9"
FT                   /protein_id="ACM18524.1"
FT                   /translation="MHVHRHHKIRTAGRLAGGKITGMTGVILAGGKSSRMGYHNKALLL
FT                   HRGGRMIEGIYRTLAELFTEVIIVTNTPQHYQFLPCRKVSDIFPGKGVTAGIHAALSQC
FT                   NEEAVFTVACDMPHLNPQLIRHLAQQYQDVDVVIPRSDGGYEPLHAIYGMGCLPALEEL
FT                   LDKGEQRVISVLPKVRVKEVEAAEVARFDPGFCSFANINTPDDYYRLRNAEKDPDPLGQ
FT                   ENEMLLQSS"
FT   gene            complement(183608..184858)
FT                   /locus_tag="Geob_0151"
FT   CDS_pept        complement(183608..184858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18525"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8J0"
FT                   /protein_id="ACM18525.1"
FT                   /translation="MRKNVLVALVVALTVSSSLAFAASTPLFNAPVKFGEGVPGRGHGR
FT                   MAVDGQNFYATFGTETAAMANTNGRIQDAVRIVKSANRGALWGRSTALQTSDFSAFPVA
FT                   FTAVDQFSARVAISNDPLYPGQKIVHTIWKSTESSGVDNIYYSFFATRPDQNGWSAPVK
FT                   INGTTNVMNGAELVVTASGSIHVVYGSLTGAQPAETLYYTGAQAPGGIFSEPTVLPLPA
FT                   YQMRVGEPALAVDSSDNVYAAYVADSKSVYLNKKPALSYNWSAPQLVADLGSMSQDLSL
FT                   AVADSNSYYIAVIGGVPTESLSLMVTTDGGTTWRARTLIADHSYGGITSGPSVVVSPTK
FT                   VITVASETGTVVDWNYTFTGIKVWRSDDNGATWSAPASVKGQSNPRLILDSSNKANLSV
FT                   ADEQNNDGSNLLWIRER"
FT   gene            184942..185181
FT                   /pseudo
FT                   /locus_tag="Geob_0152"
FT                   /note="antitoxin, XRE family; C-terminal fragment"
FT   gene            185627..186346
FT                   /locus_tag="Geob_0153"
FT   CDS_pept        185627..186346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18526"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8J1"
FT                   /protein_id="ACM18526.1"
FT                   /translation="MKLNKRMKGYLLGATIAFLLVVAGNTSAQTFCPSPKRPIDCTVDL
FT                   KSGTASPGCSIAPLSLLVAPVDSNGDGWFEACVHVDLNPAFGNTKIAVATKYGHAPSDW
FT                   TFNVGDSLTNNGFGGDSSTQSNDSEAQVLNKTLTIFANDNGPGDRISEVIFPRLAGQKV
FT                   CYEIRDQFIGWSEGALSGSSSTPNPTQMLFALAGESDSEGPINYDVFICGNRVVDGGNP
FT                   TTRTGKGLRRMQIQLQP"
FT   misc_feature    186385..186513
FT                   /note="conserved nucleotide sequence; Geob_R9061"
FT   gene            186827..187000
FT                   /locus_tag="Geob_3841"
FT   CDS_pept        186827..187000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_3841"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_3841"
FT                   /db_xref="EnsemblGenomes-Tr:AID57965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A068EZ54"
FT                   /protein_id="AID57965.1"
FT                   /translation="MSKRKNQVLSRVQCSNGSKSQSQAGAIPVPAIVNCYIALKRRCRP
FT                   LDLQNDRATSTK"
FT   gene            187026..187364
FT                   /locus_tag="Geob_0154"
FT   CDS_pept        187026..187364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18527"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8J2"
FT                   /protein_id="ACM18527.1"
FT                   /translation="MKILRLVLAMVFAGIILLFNNVEESTAGNIATYNCNIVDKDVQVK
FT                   FRYMTLASKRILISTNKRSVEVNSDDSWATFYMLAHTDSTGLVEVQYEIGAWATYFEIL
FT                   SCAEVIYP"
FT   misc_feature    187450..187578
FT                   /note="conserved nucleotide sequence; Geob_R9062"
FT   gene            complement(187689..187865)
FT                   /locus_tag="Geob_3842"
FT   CDS_pept        complement(187689..187865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_3842"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_3842"
FT                   /db_xref="EnsemblGenomes-Tr:AID57966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A068F101"
FT                   /protein_id="AID57966.1"
FT                   /translation="MSILFRCLVKFVLLSGVITAAGCSWPSVKIGNDKYLLSPTPTSET
FT                   TKSTSNPGDIRRR"
FT   gene            complement(188213..190180)
FT                   /gene="apl-1"
FT                   /locus_tag="Geob_0155"
FT   CDS_pept        complement(188213..190180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apl-1"
FT                   /locus_tag="Geob_0155"
FT                   /product="sodium/solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18528"
FT                   /db_xref="GOA:B9M8J3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8J3"
FT                   /protein_id="ACM18528.1"
FT                   /translation="MRNVFLGVIFALAFGPLAFAAEPPTKPGAGTGAAISAQAAPNALS
FT                   PAAPSANPPTTATKSPAPMPKKMQTNRGFTISMFLLIIAATAGIVVWASKSTSTAADYY
FT                   AAGGGISGMQNGWAIAGDFLSAATFLGITGLMSLFGPDGFMYSVGIIISFLTILLIIAE
FT                   PCRNAGKYTLGDILAFRSSSKAVRAVASLSAVVVSIFYLLGQMVGAGKLMQLLLGIPYK
FT                   ASIIGVGALIIVYVALGGMKATTWVQIIKAGLLMFTGTILSGAILWKSGFNLLTFFDSV
FT                   AASQAIQDHVRGVMKHATAEPGFDYGQRFLELGLFFKNPLDQISLGLAWILGAAGLPHV
FT                   MMRFFTVPNAKEARKSVVVSMFLIGAFLIMVSFLGFGAALYVTPQQITALDKGGNMAGL
FT                   MIAQYVGGGAGTIAGDLLLAFVCAVAFATILAVVSGLVLASSAAIAHDLYVNVIKSGKA
FT                   DQGTQIKVARIASFFVGAVAIVLGIACENLNIAQLVGLALAVVASANFPVLLFALFWKR
FT                   FNSAGIIAGLVVGTVVTIAVLMVSPNMTYPKKIAADAQKIVVTLEKKQAEGVVLAEKDL
FT                   KTLEKARADYAQNKNGTSLVGLDAPLFPLKNPGIVSVPIGFLVTIAATLLFRNKREEEM
FT                   FEELFVRQTTGYGMAKAAKH"
FT   gene            complement(190177..190500)
FT                   /locus_tag="Geob_0156"
FT   CDS_pept        complement(190177..190500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0156"
FT                   /product="protein of unknown function DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18529"
FT                   /db_xref="GOA:B9M8J4"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8J4"
FT                   /protein_id="ACM18529.1"
FT                   /translation="MTEMKINWAAVANHPKFVELHRAKMRFLVGLWLVGAASYFLVLIG
FT                   AISAPGLFNTRIIGRLNFGYLFCLFQFVLAWGIAIYYTRKSNNEFDPLTKELLELISKE
FT                   EGQ"
FT   misc_feature    190610..190812
FT                   /note="conserved nucleotide sequence; Geob_R5004"
FT   gene            complement(190842..191774)
FT                   /locus_tag="Geob_0157"
FT   CDS_pept        complement(190842..191774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0157"
FT                   /product="branched-chain 2-oxoacid (Si)-reductase,
FT                   2-oxopantoate 2-reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18530"
FT                   /db_xref="GOA:B9M8J5"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8J5"
FT                   /protein_id="ACM18530.1"
FT                   /translation="MNYSPKKFAVIGAGPVGAIVAAFLAKGGYEVTLCDVVSSLLEPAL
FT                   NPGIIIEGVDSLQARVTKVTTSVDDIVNDLPDVIFVTVKATAIPLIASALENFVGEGRY
FT                   VVSWQNGIDTELDLAQHLGRKSVMRAVVNYGCVPLSPAHVRIAFHHRPHFLQELDPDSR
FT                   DAAIGICDALTNCGLETRHTDRITDMVWRKSVMNSCMNAICAVTGKTMIEIIIDPILFN
FT                   LVDSLIKEGVAVARANEFVLGSDFYPYCVNYIKNAGNHKPSMLQDIEAGRRTEVDYING
FT                   KIVEYGAQAGMATPYNTMIRGLVKALESR"
FT   gene            complement(191807..192265)
FT                   /locus_tag="Geob_0158"
FT   CDS_pept        complement(191807..192265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0158"
FT                   /product="ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18531"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8J6"
FT                   /protein_id="ACM18531.1"
FT                   /translation="MKLKQLSVFLENSPGRLYEATKALGDAGLNLKSLSICDTAGFGVL
FT                   RILVSDVVKARRVIMEKQLPARVDDVVAIEVDDTPGSLANNVLRLFLDYQVNVEYMYAL
FT                   AGTGPSSGKAVMIFRFSDNDRAIELMLDNGIKILDAEAFGMVESPRPV"
FT   misc_feature    192309..192480
FT                   /note="conserved nucleotide sequence; Geob_R5005"
FT   gene            complement(192487..193062)
FT                   /gene="iorB-3"
FT                   /locus_tag="Geob_0159"
FT   CDS_pept        complement(192487..193062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorB-3"
FT                   /locus_tag="Geob_0159"
FT                   /product="indolepyruvate:ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18532"
FT                   /db_xref="GOA:B9M8J7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8J7"
FT                   /protein_id="ACM18532.1"
FT                   /translation="MKVFNIVIAGVGGQGVLMASRVLAESALASSMDVKQNEVHGMAQR
FT                   GGSVISFVRIGDKVHSPVVMPGTADILISFEPLEALRYLHYLKPKGKLVYNNVTINPST
FT                   VASGLATYPTDVEAQIAKGCPEAHGIDALQIAKEAGNAKAVNMVMVGSVMKGLPIDATV
FT                   VEGVVREISRDKGVEVNLAALRGGAEAA"
FT   gene            complement(193049..194821)
FT                   /gene="iorA-3"
FT                   /locus_tag="Geob_0160"
FT   CDS_pept        complement(193049..194821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorA-3"
FT                   /locus_tag="Geob_0160"
FT                   /product="indolepyruvate:ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18533"
FT                   /db_xref="GOA:B9M8J8"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8J8"
FT                   /protein_id="ACM18533.1"
FT                   /translation="MKKIISGNEAIALSFQDSGGIFASGYPGTPSTETLEEVARLGKVY
FT                   CEWAPNEKVGLESAIGASLAGGRSLATMKHVGVNVAADALMTLTYTGVNAGLILMAADD
FT                   PGMHSSQNEQDSRNYAKFAKVPMLDPADSQEAYDFVRAGFELSEQFDTPVMLRTTTRIS
FT                   HAKGIVEAKGAIEPKVGEWVKNVPKYVMLPNFGKIKHVEVEARLLRLQAYAETTPLNRV
FT                   EMGDPELGIITSGISYQHVKEAFPNASILKLGLVHPLPEKKIREFAGQVGRLMIVEEMD
FT                   AIFEEQIRAMGIEVHVGKDRISLCGEVNADLIRAAAGAVVTTVSTAPVENLPQRPPTFC
FT                   PGCAHRGLYSILSKLKVFVSGDIGCYTLGALPPLSAMHTCICMGASISAAHGMAKVNEI
FT                   AGRSEKPVAVIGDSTFFHSGITGLLSMVYNSGNALVIIMDNRTTGMTGGQENPGSGRLL
FT                   QGEAAKQVDMVDLVKVLGIDNVVEINSYDLQATEAAIRKGLETPGPYVLVDKNPCILRY
FT                   RVKKPLVAVSAEKCTGCRACLKVSCVALGLTAAGDKPKVAIDPNICNGCGVCSQQCKFD
FT                   AMTVVGTGGNNESI"
FT   gene            complement(194895..196238)
FT                   /gene="paaK-4"
FT                   /locus_tag="Geob_0161"
FT   CDS_pept        complement(194895..196238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaK-4"
FT                   /locus_tag="Geob_0161"
FT                   /product="phenylacetate--coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18534"
FT                   /db_xref="GOA:B9M8J9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8J9"
FT                   /protein_id="ACM18534.1"
FT                   /translation="MIWNHVETSSRNEMKSIQLGRLQQTVSRVYDNNPVYRKRLDENGV
FT                   KPAQIKTLDDIRRLPFTVKDDIRDNYPFNLFTAKQEDVVEYHATSGTTGKPIIVGYTRN
FT                   DLDTWSEVMARCLTSAGITKNDVLQNIYGYGLFTGGLGAHYGGIKIGAAVIPISGGNTQ
FT                   KQIMLMQDFGTTALTVTPSFLMHVQEVGTEMGIDFRKLKLRTAVLGAEFWTDSMRGKIQ
FT                   EDFGIKACDIYGLSEIIGPGVACECHEARNGLHINEDYFYPEIINPETGEVLPLGEEGE
FT                   LVFTTIANEGQPLFRYRTRDLTSLSQESCACGRTLVKMKKLVGRTDDLLIIRGVNFFPS
FT                   QIESIILKHPGVTPHYLVVVERNGALDEVEVRIEVTDQHAYKYVAETMTVSQNQRVSDD
FT                   RATRDIVKNLVRDIKDVVGITVKVTLMPPGTIPRSEGKAKRFIDNRPK"
FT   misc_feature    196304..196475
FT                   /note="conserved nucleotide sequence; Geob_R5006"
FT   gene            complement(196489..197358)
FT                   /locus_tag="Geob_0162"
FT   CDS_pept        complement(196489..197358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0162"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18535"
FT                   /db_xref="GOA:B9M8K0"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8K0"
FT                   /protein_id="ACM18535.1"
FT                   /translation="MKLEDIKTVGMAGAGSMGAGIAQIAAMAGLQVKVVDMSEEVWGRA
FT                   KKTIVKSLERVVKKGTITEKEMEETLGRISFSTDVASLKDVPFIFEAVFEDINVKKELF
FT                   AKLDAVCGDDTIYATNTSSISITEMAALVKNPANFIGMHFFNPVPVMKLVEVIPALQTA
FT                   PATKDLALEMAKKIGKTAITCKDTPGFVVNRLFVPYIIDAVRLLEEGVASAEDIDTAMK
FT                   LGCNMPMGPLEFQDFAGVDIGYHVINIFHEYMKQERFAAPGLLRNMIKAGYVGRKAGKG
FT                   FYDYSEEK"
FT   misc_feature    complement(197359..197521)
FT                   /note="conserved nucleotide sequence; Geob_R7303"
FT   gene            complement(197522..198304)
FT                   /locus_tag="Geob_0163"
FT   CDS_pept        complement(197522..198304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0163"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18536"
FT                   /db_xref="GOA:B9M8K1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8K1"
FT                   /protein_id="ACM18536.1"
FT                   /translation="MSYEFITLKKDDRVLTISLNRPPTNPLNGVFGQELFKAFSEAEQM
FT                   EDITVVIITSALEKAFIAGADIKEMAAQDAAEAEQFSKLLQGANNILNRMKKIVIAAIN
FT                   GHALGGGCELALACDYRLMTSGKALIGLPEAGLGIIPGAGGTQRLPRLVGLSKALDILL
FT                   RGRTMSPQEALAIGLVDKLIEPENFQAEVMQFAQELAAGAGKALGYIKAAVYEGIDFPL
FT                   EQALAVERKYSAENSKTHDAKEGLTAFVEKRRPEFKNE"
FT   misc_feature    198305..198366
FT                   /note="conserved nucleotide sequence; Geob_R9073"
FT   misc_feature    198367..198539
FT                   /note="conserved nucleotide sequence; Geob_R5007"
FT   misc_feature    198540..198570
FT                   /note="conserved nucleotide sequence; Geob_R9079"
FT   gene            complement(198562..199752)
FT                   /locus_tag="Geob_0164"
FT   CDS_pept        complement(198562..199752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0164"
FT                   /product="thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18537"
FT                   /db_xref="GOA:B9M8K2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8K2"
FT                   /protein_id="ACM18537.1"
FT                   /translation="MLQKAYIPYRGYYSTPFAKWQGTLANENAIVLGAATSKRFFESKG
FT                   WDPKTIDYVLVGSTVYQKQWFYSGPWAAALMGAEASPGILVSQACSTSTFAIYQAGMGV
FT                   ETGLFNHSWCLMADRLSNGPHAVWPNPNGPGGQQLAEDWVMDNFGRDPWAGGAMIQTAE
FT                   NVAKEYGVSREECDAVTLRRQEQYLDALARDREFQQRYMFPAEVQISKKKSILLEADEG
FT                   ITTSTREGLATLKPVLPDGVHTFGAQTHPADGNAGICVTTREKAKELSTNPGIEIQVVS
FT                   FGYARTKKAHMAAAVAPSAQMALDQAGIKVKDLGAVKTHNPFAANDIVMAKVMGLDLNN
FT                   MNNYGSSLIFGHPQAATGARLMIEGIEELAVKGGGYLLFSGCAAGDTAASVVLKVS"
FT   misc_feature    complement(199793..199826)
FT                   /note="conserved nucleotide sequence; Geob_R4103"
FT   misc_feature    199844..199876
FT                   /note="conserved nucleotide sequence; Geob_R4104"
FT   gene            complement(199881..201968)
FT                   /locus_tag="Geob_0165"
FT   CDS_pept        complement(199881..201968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0165"
FT                   /product="acyl-CoA synthetase, ADP-forming"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18538"
FT                   /db_xref="GOA:B9M8K3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8K3"
FT                   /protein_id="ACM18538.1"
FT                   /translation="MLDSLFKPRAVAIVGASTKELSIGNVIIRNLQKYGYKGEIYPLNP
FT                   TAPEVCGIKAYKTLEEIPGEVDLAHVIIPSKFVPQTIEDCGRKGIKAVIINSAGFSELG
FT                   EEGARLQEDFLRRGKEYGVRVFGPNCQGIINSDPELKAYCNFTFTYPEPGYVSVVALSG
FT                   GVGALIMQALADLGVGQRLYASNGNACDISIPEIVRYYGADEGTKAVILYTEGFSDPKA
FT                   FLEAAHQVTAKKPILAMKAGRTEQGAKAASSHTGSLAGVDIATELIFEKTGILSFTDEG
FT                   EMARAAMAFATQPIPKGNRVGIITNTGGPAVIATDVLVSCGLDVPKLSERSIERLKESQ
FT                   FPEAALENPIDVVATAGGPQFRGALDVLLHEEGVDSIFINFVTAPFTDTHEVARQIVEV
FT                   SRLGKKPIVCNFMTDLSQERYQITRDILKKGGVPFYANPSDAAKAMGALTRYGRLKQRD
FT                   IGKPQTFANVDAAKARAIVEEARQAGRSVLSATDVYTIFEAYGIPVAGWGVTVNTAEAV
FT                   AAADRIGYPVVVKVDCEAIDHKSDMGGVAVNLKDAASVQATVEDMQRRLGHFGTLKFFV
FT                   QKFLPGGRELIIGATAERGLGHLVMFGLGGIYVEVLKDVSFKIAPVTQVEAEEMLSSLR
FT                   TAALLNGVRGEKGINREAVMNIIQRASQLLGDLPMIQEMDMNPLMAFADGAFAVDGRIR
FT                   I"
FT   gene            complement(201971..203218)
FT                   /locus_tag="Geob_0166"
FT   CDS_pept        complement(201971..203218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0166"
FT                   /product="(R)-2-hydroxyacyl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18539"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8K4"
FT                   /protein_id="ACM18539.1"
FT                   /translation="MAEESKTVRKKIQATDLMNKIMADYFFGLNESATTGKQKVAWCTS
FT                   VGPAELLRAMGFAVHFPENHAAMLGATRLATDLIPEATAIGYSPDICSYLTSDIGAYLK
FT                   GFTPLAKAYPGIESVPKPDVLVYNTNQCRDVQDWFAWYAREFKVPCIGITSPKNVNEVT
FT                   AAHINDVAGQIEALIPILEQITGTRLDMARLRETVALSRECTQLWKEVLETATASPAPL
FT                   TFFDGTIHMGPAVVLRGTQEAVGYYQVLLAELRQRISAGVGAVEGEAFRIYWDGMPIWG
FT                   RLRQHSELFSGLGTGVVASTYCSSWIFPAFDDSDPLRSMAKAYLELFIVRSDTYKEGYI
FT                   KAMLNKFAIDGIIYHDAKTCPYNSNSRYGLHQRLERETGIPHLVISGDLNDMRCVSDEQ
FT                   TKTNVEAFIEQLEEGN"
FT   gene            complement(203211..204011)
FT                   /locus_tag="Geob_0167"
FT   CDS_pept        complement(203211..204011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0167"
FT                   /product="(R)-2-hydroxyacyl-CoA dehydratase-radicalizing
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18540"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8K5"
FT                   /protein_id="ACM18540.1"
FT                   /translation="MTNPVFIGLDIGASRTKVAVIDGKGTLLGHAVKKSGTDFSVTAAA
FT                   CLDISMEMAGATRPQVARAVTTGYGRANVPFITETSKTEIGCLANGCRHYFSGELSIID
FT                   IGGQDNKIIKLDSAGKRSSFKMNRKCAAGTGAFLEEMAARLDLPLEKMNELAGQSEEMV
FT                   KLGSFCTVFSGTEVLESIRHGKKVADIVKGIFYSVIKRVLEMESLTEHVVMTGGVVAHN
FT                   PHIVRMTEEMIGRPVMLPPFPQLTGAIGAALYALDDRSQGDSNG"
FT   gene            complement(204392..206371)
FT                   /locus_tag="Geob_0168"
FT   CDS_pept        complement(204392..206371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0168"
FT                   /product="sigma-54-dependent sensor transcriptional
FT                   regulator, PAS and GAF domain-containing"
FT                   /note="domains: PAS, GAF, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18541"
FT                   /db_xref="GOA:B9M8K6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8K6"
FT                   /protein_id="ACM18541.1"
FT                   /translation="MNATFNSAPSKGEDIFNNLEQLFELNQFGIAIIDCGLRYIAINDR
FT                   MATMTDLPVKDHAGRTLREVDQMIARAVEPVVSRTITEGRAFVDLELVVHKPLPDRSIQ
FT                   EKFWLVCSYPLMSNDGTVYRCGLIVQDITEQKIKESVQAERLQVEAFLSNLSSAFINLS
FT                   VSEVDRKIEEGLQKLVEFLGFERCSIWHLSPDGNSLHITHSFAMPGIKQPPPTIVGLIP
FT                   VWISMIHGGETFRVSDIDELPDRFWSEKKYCKDQGGIKSIMFIPASIGGIIVGAITFVS
FT                   YRVKREWPDELTQRLRLLWEIFANALERKRADQKIQNALAEIKQLKDRLEAENVYLRDQ
FT                   IHVEYKHEEIIGKSDAIRNVLVQIKQVASTGSTVLILGETGTGKELIARAIHNASPRMA
FT                   RAMIKVNCAALPGALIEAELFGHEKGAYTGAVSTQIGRFEAANGSTIFLDEIGELPLEL
FT                   QSKLLRVIQEGQFERLGNPKPIKVDVRVIAATNKSLVQAVKEGTFREDLYYRLNVFPIS
FT                   VPPLRERREDIPLLVWAMVEEFGKVFGKTIERIPKKNMDAMERYHWPGNIRELRNLVER
FT                   AMILNNGASLVMDIQDGVSAATAQPMTIEGMERMHINSVLEKTGWRIRGRNGAAEILGM
FT                   KPTTLNSRMKKLGIRRRHLSAETP"
FT   gene            complement(206568..208319)
FT                   /gene="fadE"
FT                   /locus_tag="Geob_0169"
FT   CDS_pept        complement(206568..208319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="Geob_0169"
FT                   /product="very-long-chain acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18542"
FT                   /db_xref="GOA:B9M8K7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8K7"
FT                   /protein_id="ACM18542.1"
FT                   /translation="MHSTLLSGGEFLLADTARMDTFSPEEFTAEQRQIAETTDEFMKKE
FT                   VFPHLDRIEDKDFAFVVEKMRQCADLGLFLAEVPEEYGGLELEKTTNMLMIEKVAPATS
FT                   FCMAFGGHTGIGILPMVYYGTADQKERYLEKLSSGEWFGAYALTEPDCGSDPLSSRTTA
FT                   TLSADGRHYILNGTKQFITNSAFADLFTVFAKIDGLHFSAFLVEKSFEGFSVGAEEKKM
FT                   GLRGSSTTQLVLDNVKVPVENLLGEPGKGHKIAFNVLNVGRLKVATQALGMSKGAFGEA
FT                   ASYATERKQFGRTIGEFGAIREKLADMTAAIFASETVIYRVAGLLDSRLALLDHSGSDY
FT                   YERYQKAIEEYAAECAIAKVFCTEQLDMVVDEAVQIHGGYGYIAEYPVERYYRDSRIQR
FT                   IFEGTNEINRILIPTMLFRKADNSGSPLWKLVKKAEEGAVTETAYAGEFTAAATTVARL
FT                   KQLFLTMVGAAVPAKDHQEVLLAIADMVITTFALESALLRADKTFASASQSKQELLKAV
FT                   VTALTFDLSRQFQSAASRCCAYALTGENLSRMHRTVADLAACPVEGLLEAKHRLSQAAQ
FT                   EAGKYIF"
FT   gene            complement(208408..209277)
FT                   /locus_tag="Geob_0170"
FT   CDS_pept        complement(208408..209277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0170"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18543"
FT                   /db_xref="GOA:B9M8K8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8K8"
FT                   /protein_id="ACM18543.1"
FT                   /translation="MKLEDIKTVGMAGAGSMGAGIAQIAAMAGLQVKVVDMSEEVWGRA
FT                   KKTIVKSLERVVKKGTITEKEMEETIARISFSTDVASLKDVPFIFEAVFEDINVKKELF
FT                   AKLDAVCGSDTIYATNTSSISITEMAALVKNPANFIGMHFFNPVPVMKLVEVIPALQTA
FT                   PATKDLALDMAKKIGKTAITCKDTPGFVVNRLFVPYIIDAVRLLEEGVASAEDIDTAMK
FT                   LGCNMPMGPLEFQDFAGVDIGYHVINIFHEYMKQERFAAPGLLRNMIKAGYVGRKAGRG
FT                   FYDYSEEK"
FT   misc_feature    complement(209278..209440)
FT                   /note="conserved nucleotide sequence; Geob_R7304"
FT   gene            complement(209441..210223)
FT                   /locus_tag="Geob_0171"
FT   CDS_pept        complement(209441..210223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0171"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18544"
FT                   /db_xref="GOA:B9M8K9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8K9"
FT                   /protein_id="ACM18544.1"
FT                   /translation="MSYEFITLKQEGRVLTISLNRPPTNPLNGVFGQELFKAFSEAEQM
FT                   EDITVVIITSALEKAFIAGADIKEMAAQDAAEAEQFSKLLQGANNILNRMKKIVIAAIN
FT                   GHALGGGCELALACDYRLMTSGKALIGLPEAGLGIIPGAGGTQRLPRLVGLSKALDILL
FT                   RGRTMSPQEALAIGLVDKLIEPENFQAEVMQFAQELAAGAGKALGYIKAAVYEGIDFPL
FT                   EQALAVERKYSAENSKTHDAKEGLTAFVEKRRPEFKNE"
FT   misc_feature    210224..210285
FT                   /note="conserved nucleotide sequence; Geob_R9074"
FT   misc_feature    210286..210458
FT                   /note="conserved nucleotide sequence; Geob_R5008"
FT   misc_feature    210459..210489
FT                   /note="conserved nucleotide sequence; Geob_R9080"
FT   gene            complement(210481..211671)
FT                   /locus_tag="Geob_0172"
FT   CDS_pept        complement(210481..211671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0172"
FT                   /product="thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18545"
FT                   /db_xref="GOA:B9M8L0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8L0"
FT                   /protein_id="ACM18545.1"
FT                   /translation="MLTKAYIPYRGYYSTPFAKWQGTLANEHSIILGAATSKRFFESKG
FT                   WDPKTIEYVLVGSTVYQQQWFYSGPWAAAMMGAESSPGVLITQACSTSAFSLYQAGMGV
FT                   ETGMFDNSWCLMADRCSNGPHAVWPNPAGPGGKPIAEDWFMDNVNKDPWAGEAMIRTAE
FT                   NVAKEFGITREQCDELTLRRYEQYQQALAGDREFQKRYMFPVEVQISKKKTITLEADEG
FT                   VMATTKEGLAGLKPVLPDGVLTFGAQTFPADGNCGISVTTREKAKELSANPSLEIQIVS
FT                   FGFARTKKAHMAAAVAPSAQMALDKAGIKVSDIKAVKTHNPFAANDLAMAKELGMDVNT
FT                   MNNYGSSLIYGHPQAPTGARLMIEGIEELAVKGGGYLLFSGCAAGDTAASVVLKVS"
FT   gene            complement(211732..213687)
FT                   /gene="apl-3"
FT                   /locus_tag="Geob_0173"
FT   CDS_pept        complement(211732..213687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apl-3"
FT                   /locus_tag="Geob_0173"
FT                   /product="sodium/solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18546"
FT                   /db_xref="GOA:B9M8L1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8L1"
FT                   /protein_id="ACM18546.1"
FT                   /translation="MKRLLIPLILCMTIAPLCYAAPSHEPAQAAASTSAGPVPLSAAGV
FT                   PSAKDPVTTRTAAPLASEVKTNKAITLTMFVAIILFTGYIVVRAAKSTRTTADYYAAGG
FT                   GISGFQNGWAIAGDYLSAATFLGIAGITSVFGADGFMYAVGPFFSFVTILLVIAEPCRN
FT                   AGKYTLGDILSLRSASKVVRGTAALSAVVVSTFYLLGQMVGAGKLMQLLLGIPYSVSVI
FT                   GVGALMILYVTFGGMKATTWVQIIKAFLLVLSGVTITVLMLGKFGFNLFAFYDAVASSP
FT                   AIQEHVRGLLKHATPQPGFDYGQRFLEPGLILKDPLDQISLGIAFALGAAGLPHIMMRF
FT                   FTVPNAQAARKSVVISMVLIGAFMIMVTMIGFGAALFITPQQITAVDKGGNMAAPMIAQ
FT                   FVGGGAGTLGGDIFLAFVCAVAFSTIIAVVSGLILAVSAAVAHDFYVNVLKDGKPDQRE
FT                   QMKIARISAFFIGAIAIVLGIACEKQNIAHLVVLAFAVVASSNFPVILFALFWKRFNAG
FT                   GIVTGLSVGAIFAIGVVLVSPTMTYPKKIAADAKKIVEQLEKKQASGMVLADKDSKALV
FT                   KARADYEKNKDGKSLVGLDAPLFPLKNPAILSVPVGFLAAIAGTFLFGSRREEEMFDEL
FT                   YIRQNTGYGMADASDH"
FT   gene            complement(213684..214007)
FT                   /locus_tag="Geob_0174"
FT   CDS_pept        complement(213684..214007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0174"
FT                   /product="protein of unknown function DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18547"
FT                   /db_xref="GOA:B9M8L2"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8L2"
FT                   /protein_id="ACM18547.1"
FT                   /translation="MTAIGKDWAKLANMPKFIELHSRKKSFLLTLWCIGSILFYLLPIC
FT                   AGYAPDFMKVKLLGRLNVTYFFCLFEFIMTWAIAIIYTHRSNTYFDPLTKEVLADINGG
FT                   GQA"
FT   gene            complement(214065..215642)
FT                   /gene="ato-4"
FT                   /locus_tag="Geob_0175"
FT   CDS_pept        complement(214065..215642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ato-4"
FT                   /locus_tag="Geob_0175"
FT                   /product="succinyl:acetate coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18548"
FT                   /db_xref="GOA:B9M8L3"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8L3"
FT                   /protein_id="ACM18548.1"
FT                   /translation="MNQLAVKQESEFLKRIRNPALFGKIMEAEDTLQFFKDGMYLGFSG
FT                   FAEGHPKTVPALLADHVEKHGIGKMKFNVYTGASIGTDVDDRWAKLGMLGRRWPHQQGN
FT                   AIRKAINAGEIAYGDRYLSMYAQDFGYGYYTLDNGGKIDIGIIEASCITEDGSIVPTLA
FT                   VGIIAEIVERADKIIIEINSKIPSLEGLHDCVGVTLPPNKQVYNILSVKDRIGTTSIPC
FT                   NPDKIVAIVESYRDPVGRPLGAPDGNSVLIANHIIDFLQFEVKQGRLPKNLLPLQSGVG
FT                   SIANAVIGGLLTSPFENLNVWTEVFQDNLLDMFDSGKLDYVTTASFSLSDNGIKRLLAN
FT                   WEKYTSRTLLRPIQITNHAEPVRRLGLISMNTPVEFDIYAHVNSSIVNGSRLLNGVGGS
FT                   GDFMRNAYLSIMHTPSTRPSQADLHGISCVVPMVTHVDHTEHDMDVLVTEQGLADLRGL
FT                   SPRERALRIIDQCAHPEYKPLLQDYFHRALKECLASNSAHEPHMLHKVFKMYRNLEEKG
FT                   TMKLENWD"
FT   gene            complement(215934..217904)
FT                   /locus_tag="Geob_0176"
FT   CDS_pept        complement(215934..217904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0176"
FT                   /product="sigma-54-dependent sensor transcriptional
FT                   regulator, PAS and GAF domain-containing"
FT                   /note="domains: PAS, GAF, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18549"
FT                   /db_xref="GOA:B9M8L4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8L4"
FT                   /protein_id="ACM18549.1"
FT                   /translation="MKSSSDFFLEKFRELEDLFADLQFGFAVLDRDLHFIHVNGQLAKI
FT                   DGKPVEQHAGRSIEDINPQIALAMEPILLRVMRDNRPFFELAVDIHSTAAAHTAMNNTW
FT                   QVRCYPLNADDGEVLGVSLVVLDVTEQKLREAAQIERLQFESLLSTLSTTFINVPVSEV
FT                   DSKIVQGLQKIVDFLGFDRSTVWRVDPDTGEMICTHSYELPGIMPPLPILPPDMVPVWN
FT                   SMVKSGEIFKISDSDELPESFQREKLYCRDRGGIRSIMFIPSRVGGVVEGFITFVSYSV
FT                   IRAWPDDLIQRLRILWEIFANALERKRADQKIQHALAEIKTLKDRLEAENIYLRDQIDI
FT                   EYKPDDIIGQSTAIRGVLRQLQQVAHTDSTVLLLGETGTGKELLARAIHNLSGRRERSM
FT                   IKVNCAALPATLIETELFGHEKGAYTGAAARHVGRFEAANGSTIFLDEIGELPLDLQSK
FT                   LLRVLQEGQFERLGSTRPIDVDTRVIAATNRDLAREVKEGRFREDLYYRLNVFPISVPP
FT                   LRERKEDIPLLVSAMVKEFAGAFGKTIERVPKKNMDALVHYTWPGNIRELRNMVERAMI
FT                   LSNGPTLEIDIPDGTPTTVARAALLKEVEQLHILSIMEKTGWRIRGKNGAAELLGLKPT
FT                   TLESRMKKLGIKRCLSSSEIS"
FT   gene            218124..219167
FT                   /locus_tag="Geob_0177"
FT   CDS_pept        218124..219167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0177"
FT                   /product="zinc-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18550"
FT                   /db_xref="GOA:B9M8L5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8L5"
FT                   /protein_id="ACM18550.1"
FT                   /translation="MTEQHVAVSSPAPLTFPYDAPQSKAELVDISPEIKWLRMPMPYAL
FT                   DHVNIYLLQVGGGWLIIDTGLDSTEAREIWEEVFSGPLRGEKVVGVYCTHYHVDHLGLA
FT                   GYLTERWRVPLFTTYEEYFTLRGWPDLVTVPWQHAEFFQRAGFPQERLQETLVMFQFFP
FT                   EISPMPPSFIRLQEGSILPIGKDWRVIIGRGHSPEHALLFSGDRGVLISGDQLLPTITT
FT                   NVSVSVMNPEDDPLSHWLVSLDRLAEIPDEVLVLPGHGLPFRGARKRVAELQSHHQRRF
FT                   QVIRDACFDRELSAYELVQVMYPAPLSDFDLQLALGECLAHVRYQIASGGLTLRLDESG
FT                   VNRYRTV"
FT   gene            219258..220136
FT                   /locus_tag="Geob_0178"
FT   CDS_pept        219258..220136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0178"
FT                   /product="ATPase, AAA_5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18551"
FT                   /db_xref="GOA:B9M8L6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8L6"
FT                   /protein_id="ACM18551.1"
FT                   /translation="MSNLQFHQFRGTEGYVASRALQDVVNVAIALERPLLLKGEPGTGK
FT                   TLLAHHIAEALDMEIILWNVKSTTKARDGLYTYDTVQRLNDARFGDGDVKDIRHYIKYG
FT                   PLGRAFASGKRVVLLIDEVDKADIEFPNDLLFELDEMRFHVLETDEWVKADQRPVVIVT
FT                   SNSEKELPDAFLRRCVFHYIDFPDEAQMRAIIEVHFPDLGVELMGKACKIFFGLREVPG
FT                   LRKRPSTSELLDWIRVLLASGAKLPEGDVPSLESVPFLGALVKMQEDTETLSRHANRPA
FT                   DVRTAGRRFFS"
FT   gene            220136..221308
FT                   /locus_tag="Geob_0179"
FT   CDS_pept        220136..221308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0179"
FT                   /product="VWFA superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18552"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8L7"
FT                   /protein_id="ACM18552.1"
FT                   /translation="MFLALYHSLRALKVPVSLTEWLTLLEGLAKGLHNDSLEDFYYLSR
FT                   SLLVKDVAYYDAFDQAFAYCFKDGALPDDLATREKILEWLQDPRMPRPFSQEELDRLKA
FT                   LPLDELLRQLEERLRDQKEAHNGGKKWIGSGGTSPYGINGSHPSGISFSAERQGGRAAL
FT                   QAFARRYRNLRHDLTLDVRQIGVALKRLRDLRDSGAEEILDMDATIEKTCRNAGEIDLI
FT                   FGRERENQVRLLLVMDSGGSMEPYRDLSERLFSAAHGLNHFKDFRAFYFHNCVYENLYT
FT                   NLDTDEFVPTAEVMREYGKNYRLVIVGDAAMSPYELMTPHGTLERYRTSNVTGHEWLRQ
FT                   FSDAFPKRAWLNPLPESYWNQYETVPTVAGLFPMFPMTLEGLGRAVRQLH"
FT   misc_feature    221560..221602
FT                   /note="palindrome; Geob_R9083"
FT   gene            221643..222248
FT                   /locus_tag="Geob_0180"
FT   CDS_pept        221643..222248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18553"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8L8"
FT                   /protein_id="ACM18553.1"
FT                   /translation="MKIIEKHITRRDIITYYVKYDRQKKGLPVIKNLETWPWNDANAID
FT                   KQLQSNNLKTGVLSAYCEWQLAQLDYADIADCAIVNHIFPGQPQALGRINQSHIAKSKP
FT                   NGNPEWWEPLSSGSDIPREWALILRPTVASELPAKWYIEDGSGRALALFQRMLVNQELW
FT                   RTAYAYLGIIPDEGSHFIQKRPELLRNCVEKGGQAVFW"
FT   misc_feature    222296..222379
FT                   /note="conserved nucleotide sequence; Geob_R9042"
FT   gene            222478..223830
FT                   /locus_tag="Geob_0181"
FT   CDS_pept        222478..223830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18554"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8L9"
FT                   /protein_id="ACM18554.1"
FT                   /translation="MSKNMINVMMGLFVALVFGISGCGGATNSNNPGATQTQPVANAGS
FT                   SMRVITGAVVQLDGSASKATIGTLTYIWHITAKPSGSNATLSAENIVNPTFTPDVAGTY
FT                   TIGLVVTDSVAASTESSITVTATLPIAPVANAGTSQSVTMGTVVTLDGSASTVGAGKTA
FT                   SYSWAIATKPSGGVASISNPTTVKPTFIPDVVGTYIFTLTVSDGYFTDTGTVTVSVAHN
FT                   PGDIVRTIPFPAGISGVSDVVFDSSSQTLLVFAYDVLDNWKVTKIIQIDYSSGATLNTT
FT                   AIVNPDFFMNQSSEFTKAGDYYYGTSYGNSNGVPQSFIYKIDMNGNVIASFPCPATNAG
FT                   GFCEGLAWDGQYLWSGASDNKNLTQFSTNGSVHATITAWNYIGTTDVSYDKTMNQLIVS
FT                   LNNRLHRVDPVTGTENSSVYTGFSRVGDWDGNLFWAVNSSTKQLEGIYIGN"
FT   misc_feature    223860..223955
FT                   /note="conserved nucleotide sequence; Geob_R9043"
FT   gene            223998..224603
FT                   /locus_tag="Geob_0182"
FT   CDS_pept        223998..224603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18555"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8M0"
FT                   /protein_id="ACM18555.1"
FT                   /translation="MKRIRVFLSVCFCLISGSIVVEAAAQEKQPVAIIIAALNARVEAQ
FT                   CSIARMRQSLASTAYEKAQVNAAVKMNCECLPPEIERAGNDLSGGNPDATITEKVYETR
FT                   LKAAINLCVAKGVREDIQTRCENEDITALGITDKKAYCGCVVRQVKGLSDEAIASASTV
FT                   TKMHFEEKVRARMEGKPDPVSPLTAIDEVTNFCKQEEK"
FT   gene            224739..225368
FT                   /pseudo
FT                   /locus_tag="Geob_0183"
FT                   /note="hydrolase or acyltransferase, alpha/beta fold
FT                   family; internal stop codon"
FT   gene            225410..225952
FT                   /locus_tag="Geob_0184"
FT   CDS_pept        225410..225952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0184"
FT                   /product="nicotinamidase-related cysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18557"
FT                   /db_xref="GOA:B9M8M2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8M2"
FT                   /protein_id="ACM18557.1"
FT                   /translation="MKKALLVIDVQNEYFSGKLPVTHPAGSLEKIGKAMDAAAAKGLPV
FT                   IVVQHTAVPDYPFFRKGSQEWMLHPEVANRPNTLLIEKNLPGSFTGTNLEAWLRERNID
FT                   TVVISGYMTQMCCDTTARQAFHRGFGVEFLADATGTLSLANNAGSVTAEELHRAILVTQ
FT                   GMLFSKVLTTAEWISSL"
FT   gene            226104..226337
FT                   /locus_tag="Geob_0185"
FT   CDS_pept        226104..226337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18558"
FT                   /db_xref="GOA:B9M8M3"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8M3"
FT                   /protein_id="ACM18558.1"
FT                   /translation="MSTLTKRATVYFDPAIHRALQHKALVASRSLSDIVNDAVQQALAE
FT                   DAEDLAAFEERVHEPLVSYEAVLKELKANGRL"
FT   gene            226324..226584
FT                   /locus_tag="Geob_0186"
FT   CDS_pept        226324..226584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0186"
FT                   /product="toxin, RelE family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18559"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8M4"
FT                   /protein_id="ACM18559.1"
FT                   /translation="MAGYSIFFKDSVRKDFESIPKNDLQRTMERIAALAENPRPMGCEK
FT                   LSGQEKYRVRQGNYRIVYSIQDSQLTVWVVRVGHRREVYRP"
FT   gene            complement(226790..227332)
FT                   /locus_tag="Geob_0187"
FT   CDS_pept        complement(226790..227332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0187"
FT                   /product="HAF repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18560"
FT                   /db_xref="InterPro:IPR014262"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8M5"
FT                   /protein_id="ACM18560.1"
FT                   /translation="MQLPDRSPQPFQVVLRGPAFDTISYEYLILLPCRLLLLGEVQQHL
FT                   VQGKMTDLGPIDKDERTAVDIFINNRGQVAGSDLDSSALFHGFFWQDGVMTDLGTLFGG
FT                   QTRVFDINDKGQVVGFSSATLGPTKAFIWQKGVMTDLGSLGGNSFAKAINNHKQAVGYS
FT                   QTSPGSAETHAVLWKIK"
FT   gene            227456..228652
FT                   /locus_tag="Geob_0188"
FT   CDS_pept        227456..228652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0188"
FT                   /product="Fic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18561"
FT                   /db_xref="GOA:B9M8M6"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8M6"
FT                   /protein_id="ACM18561.1"
FT                   /translation="MRKSDLSPERRGLLVPVREYSGSFALVPPPTPRARDLVGLPGLED
FT                   KLVRAREALDSLQRLSAVLPNPDLVTRTADRREAVRSSQIEGTQSGINDLLAFEATGSD
FT                   EGLPPDVQVTKNYVYALEHGLEQVRESGVSAFSCGLIKQIHARLMEKVASFQGIPGEFR
FT                   DRQNWIGGGLRIDQAKFVPPPAEYIDPCMEDLLQVLHYTPEEEDFFEFSIIMRMAVVHA
FT                   QFETIHPFIDGNGRVGRILLPLMLAAEGLPPVYLAGYLKENQREYYEALAGVQLRGRWA
FT                   EWIRFFSAGVEAAVQEAIDTSVGLDAIVKKWEAIVADMGLRRQSVLHRFPRLMAGTPVL
FT                   TANQVKDALNISFPSASAALAKLEEVDILVQRQPHRRNRCFYAKEVIELLDRAPKVRR"
FT   gene            228744..229919
FT                   /locus_tag="Geob_0189"
FT   CDS_pept        228744..229919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18562"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8M7"
FT                   /protein_id="ACM18562.1"
FT                   /translation="MQHYMIGILILTICMGGCARTLPPSEELTQAVTKSFAATGFNYTS
FT                   KSRITDLNVPRKDLPKMPGKKTNLALDKGLEVLDSLSVTLDGAVDTTAKRSQVLYALRY
FT                   ERDNLEISVKLPILMDYGTQTVYLGTSIYTTVLESLYPQAPPTRGKLIRIDLNKLLQEG
FT                   TAKKPELAKVVGSNLLNGKNIDLINNAIKAAVLKELPKLKEDCFRDQPLSDKDRQAGVI
FT                   RRIRVDLGRSESVSLALGAMESVVEALYQQQIIPEQVYTVLLTLTDPKFAEEAKEKLSI
FT                   NATFHVGIAPSGQVAYVEGQYDMADRQEQFRVGVETVSTFSNYGAPRFTLLPEQSGVVD
FT                   FTELLKVIAVSAQEKKADVDASNAEEIDETSKDGTLDTKGDVWLQRADVAL"
FT   gene            complement(230111..231358)
FT                   /locus_tag="Geob_0190"
FT   CDS_pept        complement(230111..231358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0190"
FT                   /product="HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18563"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8M8"
FT                   /protein_id="ACM18563.1"
FT                   /translation="MSNALQVRVDGVVVGSLWLDDRKRFCFQYDKRWLATSHMPLSLSL
FT                   PLRREPYLDDESHPFFANLLPEERMRAVISRNLSVSPNNDYGLLEKIGGDCAGAVSLYP
FT                   ATDEFQPEPAAYRQLSLDELDAIIEELPRRPLLAGEKGVRLSLAGAQKKLPVYYDEQHF
FT                   HLGLGDAPSNYIIKPPIEGLDGTVENEAFCMALARAVGLDVPESFIHRHGETCVFVVKR
FT                   YDRLAVAGGTRRLHQEDFCQALAIPPEFKYETEGGPTLVSCIDLLRHASIRSGKDVLSL
FT                   LNWLIFNYLIGNSDAHGKNISLLLLPKGPVLAPFYDLVSTRIFAHYGLASGLAMKIGGI
FT                   SDPDSLRKKHWELFAEEAGIKPRLVLSRVVELAKRIEEIRLQLFNGSFAPYRCDALYRL
FT                   MEFIGGQTENTLRKLL"
FT   gene            complement(231355..231591)
FT                   /locus_tag="Geob_0191"
FT   CDS_pept        complement(231355..231591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0191"
FT                   /product="helix-turn-helix XRE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18564"
FT                   /db_xref="GOA:B9M8M9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8M9"
FT                   /protein_id="ACM18564.1"
FT                   /translation="MKILTVKNLGGIIKQKRKTDGLTLEEAAAVCGVSYAFLSALENGK
FT                   ETVRLNKVLQVLSCLSIELEANLRTWSGPGKET"
FT   gene            complement(231810..232256)
FT                   /locus_tag="Geob_0192"
FT   CDS_pept        complement(231810..232256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0192"
FT                   /product="acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18565"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8N0"
FT                   /protein_id="ACM18565.1"
FT                   /translation="MNRPFRYYLRVRYAECDMQRVVFNARYGDYTAVAISEFMRAIGLR
FT                   REFADGTYGIQWVKQTTEWKAPARFDDVIEASVRTTHVGTTSFTLATEFRLAGEDKLLA
FT                   TVESVLVLIDERTMEKSPLLERHRQALINGAPDTVVDHAGYLQR"
FT   gene            complement(232253..233464)
FT                   /locus_tag="Geob_0193"
FT   CDS_pept        complement(232253..233464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0193"
FT                   /product="membrane protein, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18566"
FT                   /db_xref="GOA:B9M8N1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8N1"
FT                   /protein_id="ACM18566.1"
FT                   /translation="MAHTGTKEILWSRTFTLTTLGMFFLFIPFALYLPVMPVYLLKELH
FT                   SSMEAAGAVNGIFLIAAVLFRAQTARLEGRFGSRRVLLASGFLFVATNLLYLSATTVAG
FT                   VMLIRFFSGACFAVANTGIQAMGSRLIPRSRVGEGLAYITTMVLAGGAIGPYLGLTLSQ
FT                   TLGYRAVFILSALVSLLGMLILCAMTIPDERPQIKRGFSFHDLYEWKAVPVSLIILVIA
FT                   IAYGGVLTFVAVYAAELRLTAAANYFFVVMAAASVAARVTTGRMYDRFGPDAAIYPAIV
FT                   LMAAGLLLMGCIHSAAGLLSAAALIGVGYGMAVPSIQTLAIQISPPHRASEVTATVFTC
FT                   LDGGVGLGAYLLGGSILAFGYANVYLALGLLTLACTCFYYAMRRRARAEKTYALEEITE
FT                   KELP"
FT   gene            complement(233497..234756)
FT                   /locus_tag="Geob_0194"
FT   CDS_pept        complement(233497..234756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0194"
FT                   /product="nucleotidyltransferase DUF294, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18567"
FT                   /db_xref="GOA:B9M8N2"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8N2"
FT                   /protein_id="ACM18567.1"
FT                   /translation="MDRLPTELSLSQVDRIVRERLARLDISPGEEFLALVRGALEPLQG
FT                   SIATARSELRSLVAMATAAEELAVLRSINERLVGVASDLFLATGSTPMVQEICTAAREA
FT                   IVERVLELARRELYFAGSYCEAPLSLFAVGSAGRREELLFSDQDYLFLHGSGEVISVQM
FT                   GEEPGDYFASLGSVFVNKLEAVGISRCSGGIMPVNEAWRGSVQQWESRLSHMLRLERSD
FT                   WEKSIVNLIALMDVRFICGDRDLGLGFGKSVRSRVRENPQAIRHMARVVSSMRLSKGFL
FT                   RRFVVEADGLHRGEFNIKVMAWMPLVMCVRLLAVHVGIEETSTPARIDRLRDAGRLTDQ
FT                   MASELADAYHVITGHRLLQQNRLRKRIIDDACYINPHELPGPERERLRKAIGSIDDLQN
FT                   MIRSEFSMATSADRFINRSR"
FT   gene            complement(234959..235999)
FT                   /locus_tag="Geob_0195"
FT   CDS_pept        complement(234959..235999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0195"
FT                   /product="TRAP proton/solute symporter, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18568"
FT                   /db_xref="GOA:B9M8N3"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8N3"
FT                   /protein_id="ACM18568.1"
FT                   /translation="MKQLKKLIMLSIAATLLVSVPAGAASDVVTLKVSHFLPTSSNFHQ
FT                   KILLPWCEKISKESGGKLKCQIYPSMQLGGTPAQLLDQVRDGVADIVWTLPTYQAGRFT
FT                   KAEVFELPFMAKSSEGGSQALWEYVQKNAQDEFKGTKLLFTHLHDGNQMHFGKKSVKTL
FT                   EDLKGLKLRAPSRIGSKTLTALGAVPVQMPAPAVPESISKSVVDGASIPWEVTTAFKLQ
FT                   EICKTHTETAPGQAKHAYSIFTFAMNPAKYNRLSPELKKVIDNNSGLAASKWAGKTFDS
FT                   FTVAARKIAVERRNTFNVLTDAEYKRWVKACENVDNDWIKEVNAKGGNGVALLKDARAL
FT                   LKKYHD"
FT   gene            complement(236020..237351)
FT                   /locus_tag="Geob_0196"
FT   CDS_pept        complement(236020..237351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0196"
FT                   /product="TRAP proton/solute symporter, large membrane
FT                   protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18569"
FT                   /db_xref="GOA:B9M8N4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8N4"
FT                   /protein_id="ACM18569.1"
FT                   /translation="MSGTQIGFLMFAVMMGLLVIRIPIGIAMFTVGAGGYFFLSGCELQ
FT                   PLMATLKNLAYARLSNYDLVVIPLFLLMGQFATHGGLSNALFRCVSAFMGHRKGGIAMA
FT                   AIGACAGFGAICGSSLATAATMGQVALPELRRYGYSGSLATGCLAAGGTLGIMIPPSVP
FT                   LVIYAILTQESIGKLFMAAVLPGIIAMLGYMIVVRILTTINPAAGPAGPSVPWSERLRS
FT                   LMLVTPVLIVFVVVIVGIYGGWTNPTEAAAIGAAACGILAVITGGMRLQGVIESAVGTA
FT                   QATAMIFLVLLGADMLNTGLAVSQMPTELATWVQNCGLSPLLIMIMILLIYIFLGCVMD
FT                   SLAMILLTIPIFYPIVMGLNYWGLAPEDKSIWFGILALMVVEIGLVHPPVGMNVYIINR
FT                   LAKDVPLTETFKGVMPFLFSDFVRIALLLFFPIISLYLVHTFQP"
FT   gene            complement(237348..237890)
FT                   /locus_tag="Geob_0197"
FT   CDS_pept        complement(237348..237890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0197"
FT                   /product="TRAP proton/solute symporter, small membrane
FT                   protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18570"
FT                   /db_xref="GOA:B9M8N5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8N5"
FT                   /protein_id="ACM18570.1"
FT                   /translation="MREEPLSYAPFTTSDSFGPFGNLLLKLSRALALGGGLIFMGLVIM
FT                   SLVSVVGRKLFSFAVPGDVEVLQMCAALALSTFFAYCHLIHGDIKVDFFTHKMAPHKVA
FT                   LLDCLGSLMVGLFGALIAWRTAAGALALKEVGETSAILSWPVWIPQALMVPGFVLLAVA
FT                   GFYMSIHQLRLAVWRSL"
FT   gene            complement(238172..239521)
FT                   /locus_tag="Geob_0198"
FT   CDS_pept        complement(238172..239521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18571"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8N6"
FT                   /protein_id="ACM18571.1"
FT                   /translation="MIKRLGLSAATLLLFAAPAMAEETAPYNCDYSPSCEVAPGVYGAM
FT                   ASPVKSKFNLSLGGYVKLDYAHNTNAVGPRSPVAFQNLPINGSKDESIFTAKQSRLWFK
FT                   VAGPTFLGAKTNALVEADFYGGGSAATTNENPNFRLRHAYGSLDWANTQVLFGQFWDVF
FT                   GPAAADTIDFSQGSSTGAPNNPRVPQIRLTQKYNLNADNSLKLVLSLQNPGQDSASGAA
FT                   ASFSKTGGYGSLVNAAGQIMFSSKALGVSPGFMGLGMSPLQAGLFGLGGRQKIAGNHQV
FT                   DVYGYGVYGFVPLLKSKDGKNRAMTMSLETQAYIASGMDMQGATALSVVGSKPDLTGAK
FT                   GYGYYGQLKFYPTQDMGITGGYNRRSVLNSDNYNGLSAATIGLSQGAVNGVERYNELVY
FT                   ANITYDLNAAIRLATEFEHNKTQYMATTTGAATTASGQNNIVRFAAYYFF"
FT   gene            complement(239610..240158)
FT                   /locus_tag="Geob_0199"
FT   CDS_pept        complement(239610..240158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0199"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18572"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8N7"
FT                   /protein_id="ACM18572.1"
FT                   /translation="MRTLNKIVITLGLLFLAGCAGTNTGSSSRRDYVEVANPAFTMSPN
FT                   APETIWVPRSYVDSGVPRGGELAKQGYEAIKGSTPVPAGETGIVAPGGKPAALIPRFGM
FT                   VVAVDKDKVYFNLGREAGINIGQKLKVFRGGTVVEGLGLAPGEAVGTIEVLGFVGSKGG
FT                   YGVMKQGGPAQMNDLVGGD"
FT   gene            complement(240195..241754)
FT                   /gene="bamY"
FT                   /locus_tag="Geob_0200"
FT   CDS_pept        complement(240195..241754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamY"
FT                   /locus_tag="Geob_0200"
FT                   /product="benzoate--coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18573"
FT                   /db_xref="GOA:B9M8N8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8N8"
FT                   /protein_id="ACM18573.1"
FT                   /translation="MPYNLNLPEQFNAADYFIDRNVREGRANKTAVLCEERAFTYGQLQ
FT                   ENVNRFGNALKSLDVRMEERVALLLLDTEIYPQAFFGAIKIGAVPICLNTMNRPKDFEY
FT                   YLNDSRARVLVVDASLLELIEPIRNNLLFVRQIIVANGEAPAGDLSLDELTADQSTHLE
FT                   AASTCSDDACFWLYSSGSTGAPKGTVHLQHDMVYATETYGKQVLGIKEDDYCFSAAKLF
FT                   FAYGLGNGLYFPFGVGATAIYLPKRPTPDQVYGTIHRHRPTLFFGVPTLYGQMLEAEGS
FT                   MDNVRLCVSAGEALPGDYINRWKDRFDLDILDGIGSTEMAHIFISNLPGDIHAGSSGKV
FT                   VPGYEARIVSEEMTDVAPGEIGTLLVKGDSAAAFYWNKHQKTRQTMMGHWVNTGDKYYQ
FT                   DEQGYFYCAGRSDDMLKVGGIWVSPNEVESCLIKHPAVLECAVIGAPDENNLIKPMAFV
FT                   VLKKPDQSATHMEAELQDFVKSSLALYKYPRWVRFLDELPKTATGKIKRFELRNMVYSQ
FT                   AA"
FT   misc_feature    242197..242234
FT                   /note="conserved nucleotide sequence; Geob_R2001"
FT   gene            242296..244155
FT                   /locus_tag="Geob_0201"
FT   CDS_pept        242296..244155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0201"
FT                   /product="acyl-CoA--carboxylate coenzyme A transferase and
FT                   N-acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18574"
FT                   /db_xref="GOA:B9M8N9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8N9"
FT                   /protein_id="ACM18574.1"
FT                   /translation="MNGDILTKYGRRAITPDEAVAHIRSGWRVFVGSGCAAPQELVAAL
FT                   CRAADRLNDVELIQLLTYGDAAYLQEEFAGHFRYNSFFISKKVRQTVCEGRADYTPIFL
FT                   SEIPELIRSGQRGNQAMLLQVSPPDRHGYCSMGVSVDIQRAALDRAQLVIAQINPRMPR
FT                   THGDAQVHLSQLHHLVAVDSPILELEIPEPDEVALQIGYHISRLVENGSCLQMGIGTSP
FT                   GSVLKFLHDKHNLGIHTEMFTDELIPLLENGNITNKAKAVLPGKTVTSFVTGTRRLYDF
FT                   IDDNTSIAFHPSDFVNDPRVIAQNDKVVAINAALQVDLTGQVCADSLGYRFYSGIGGQV
FT                   DFIRGAAMSRGGKPIVAVRSTAANGTVSRIVHCLDEGAGVVTSRGDVHYVVTEYGIAYL
FT                   HGKTIRERALALISIAHPDFRRELLEFVKKKQYVYEDEQVWQQALDRYPKELEEQRLFG
FT                   KKRLLVRPLKATDERALQEFFYSHSPETIYNRYFGPKQQLAHLEAAKLCCVDYQSRMAL
FT                   AVFEQEDENVEKIVAVARYAANPRSNMAETAVVVHEGFRRLGIARYLLAQLQRHAAGQG
FT                   IKGFCSEILSGNEAMLAYHRRLGHPLIYCRDSDTYAVQFEFES"
FT   gene            complement(244215..244418)
FT                   /locus_tag="Geob_0202"
FT   CDS_pept        complement(244215..244418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0202"
FT                   /product="heavy metal-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18575"
FT                   /db_xref="GOA:B9M8P0"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8P0"
FT                   /protein_id="ACM18575.1"
FT                   /translation="MNVDINGHLEKIEIGIKEMDCADCARHIKSAVESVPGVAEAEVLF
FT                   SAQKAVLSFDPAKAGPADGYMI"
FT   gene            complement(244574..247651)
FT                   /locus_tag="Geob_0203"
FT   CDS_pept        complement(244574..247651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0203"
FT                   /product="efflux pump, RND family, inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18576"
FT                   /db_xref="GOA:B9M8P1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8P1"
FT                   /protein_id="ACM18576.1"
FT                   /translation="MLNKIINWSLNHRLVVIVAWSVVAVLGILAFLRLPLDAFPDTTPV
FT                   QVQVNTVAPALSPLEIERQVSAPLEQAISGLPKLKEVRSTSRFGMSQVTVIFEDGTNIY
FT                   LSRQVVMERVQGVALPAGIEKPQLGPVATGLGEVFHYLLTAKDKSLAELRTLHDWVVKP
FT                   QMRSVPGVAEVNTWGGDERRFEIVVDPEELAKRGLTMDRLIAAVERNNANVGGGTIDQA
FT                   GESSLVQGVAIVTTPQDIEGIVITAKEGVPVRVADVARVVEGREIRRGAVTADGKGEAV
FT                   LGLGFMLMGENSHDVTTRLKARLEEVKKTLPKGVEVAVAYERTSLVDKVLHTVEKNLFE
FT                   GAILVIAVIFVFLGNFRAGLIVALAIPLSMLFAFDLMLRFGIAGSLMSLGAIDFGLIVD
FT                   SSVIMIENAERRLAEGKSDRSIIDVVREAAIEVRKPTMFGELIIMIVYLPILALEGVEG
FT                   KLFRPMALTVIFALLGSMAMSLTLMPVLASFSLKRKKEHKEPWLVCRLKELYRPVLGFA
FT                   LRRRKAVLAIAVGCLCIAGILSTRLGSEFVPRLMEGSIVINTVRLASVSLDESVRYGSH
FT                   LERTLLEKFPNEIERIWTRTGSAEIATDPMGVELSDIFLTLKPRDKWKRARTQGELVMV
FT                   MEKELKNMPGMRMVFTQPIEMRVNEMIAGIRSDVGIKIFGDDFETMKAKAKEIENAVKK
FT                   VAGAADVSVEQVTGQPLVQVEVDRNATARYGIPAREVLEVIEALGGRDVGMLQEGDRRF
FT                   PIAVRIADKYRAETEDLGRILVTAGSGERIPLSLLTKIKSSEGPSTINREWGKRRVVVQ
FT                   ANVRGRDVGSFVADVQKSIEREVKLPSGYYVRYGGQFENLQRAQQRLMIVVPVALALIF
FT                   TLLYFTYGRVLDAARVFTGVPFAAVGGIVALWFRDIPFSISAGVGFVALSGVAVLGDMV
FT                   LVSAVRDLLAKGTPLIDAIKQAAEQRLRPVLMTALVASFGFIPMALNTGIGAEVQRPLA
FT                   TVVIGGVVSSTLLTLLVLPVLYAVFGRAKAPDEGEE"
FT   gene            complement(247672..249051)
FT                   /locus_tag="Geob_0204"
FT   CDS_pept        complement(247672..249051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0204"
FT                   /product="efflux pump, RND family, membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18577"
FT                   /db_xref="GOA:B9M8P2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8P2"
FT                   /protein_id="ACM18577.1"
FT                   /translation="MRRLLILVILIPLAVASGCGKKEAAKAPEAAKQAAAEPKKEAEAG
FT                   LCKEHGVLEALCTKCNPKLAPIFQAKGDWCAEHGFPESVCPICHPERGGKPAMDVAGDD
FT                   APPDGTKVILKGNDTARLAGIETTKAVAGRGTAAIIAPVIINYDATRVAQVSARATGVV
FT                   KRVSADIGDRVSAGAPLAVIESSAVSGDQSRLAAARSRVQTAEASYRREAELEKKGISA
FT                   KKEVQAAQQFLREATAELESLQATLRGVGAHNGSGGRYTVKAPVSGVVTQRTVSLDRYV
FT                   DSQTPLFEIVDTSSMWAEVALPEAELGTVKAGASVVVTMDGLSGREFRGSISHIAPVID
FT                   PQTRTAKARVKLANPGGLLRANMYGQARISAGGSRSSSAVPRGAVQRAKSVKLAFVRLA
FT                   PNEFEARRVQVASNHGSGDLVEIASGVEVGEEIVVAGSFLLKTETLKDSIGAGCCEVDT
FT                   K"
FT   gene            complement(249053..249349)
FT                   /locus_tag="Geob_0205"
FT   CDS_pept        complement(249053..249349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18578"
FT                   /db_xref="UniProtKB/TrEMBL:B9M8P3"
FT                   /protein_id="ACM18578.1"
FT                   /translation="MKRSILLSLALLVSLSVSAFAAESAKDAHGAKGAKPGSYEDWCSE
FT                   HGVPESLDTRCDKSLIPAFKATGDWDEKHGLPKSQCKKCNPKLKIVRPPKGSK"
FT   gene            complement(249441..250676)
FT                   /locus_tag="Geob_0206"
FT   CDS_pept        complement(249441..250676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0206"
FT                   /product="efflux pump, RND family, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18579"
FT                   /db_xref="GOA:B9M921"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B9M921"
FT                   /protein_id="ACM18579.1"
FT                   /translation="MQMKKYVFAVLTTLALPVFAIAADEAKGTLTLVRVIELAADNAPE
FT                   VRLSTTRIAEGEARLAGAQIRTLENPKLDLATGPRNGTESSVDVEAGFEIPFELGSRRS
FT                   KRIAVAQAGIQREKYATGDVRRQSVAAAVGAYYRVLQAEERLRLATDRKTMAEEFLRIA
FT                   KERLLVGDAARFEVNLAQTEVSRAESDISAARGRIAQVRTTLAKTLGLSSGADIQIVGD
FT                   LKERSLFDTIRSAQTARERDDLQAARAEVEASRAAISLAEAERLPDLAFRVSYKREGND
FT                   NIALGGITVSLPFLNPRPGPIQEARVQNQRAQIAAEVRQSAISAEIEGARNTYDAAVEA
FT                   VRRVETDGLALQQENETLAGESYRAGKINLSTLLQVRRDALETRREYLERLLEAADAGV
FT                   ELASANGRWSTN"
FT   gene            complement(250882..251193)
FT                   /locus_tag="Geob_0207"
FT   CDS_pept        complement(250882..251193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18580"
FT                   /db_xref="UniProtKB/TrEMBL:B9M922"
FT                   /protein_id="ACM18580.1"
FT                   /translation="MVMLAVPVCCYELESDHEKSGISLTSGAVDADHNECPCCPDENKS
FT                   DSNIDTCSTCSYCTYYAPLAPLISTHYDPSVSPLIFLEEFTKLPDVHIPIFIPPQNLA"
FT   gene            complement(251307..251486)
FT                   /locus_tag="Geob_3843"
FT   CDS_pept        complement(251307..251486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_3843"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_3843"
FT                   /db_xref="EnsemblGenomes-Tr:AID57967"
FT                   /db_xref="GOA:A0A068EZW0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A068EZW0"
FT                   /protein_id="AID57967.1"
FT                   /translation="MRPADKLDIDTATDIRPGLTFWPVFSALLVFAVHSCPKLREFVKK
FT                   RKSAYVSHLRGYLI"
FT   gene            complement(251498..251814)
FT                   /pseudo
FT                   /locus_tag="Geob_0208"
FT                   /note="resolvase-like serine recombinase; frameshifted
FT                   fragment"
FT   gene            complement(251832..252272)
FT                   /gene="bgeR"
FT                   /locus_tag="Geob_0209"
FT   CDS_pept        complement(251832..252272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bgeR"
FT                   /locus_tag="Geob_0209"
FT                   /product="winged helix-turn-helix benzoyl-CoA degradation
FT                   transcriptional repressor BgeR"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18581"
FT                   /db_xref="GOA:B9M923"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9M923"
FT                   /protein_id="ACM18581.1"
FT                   /translation="MKLNKASLLGLIAVLELADDPEQQLSTTDIAEKYDISTHHLAKVM
FT                   RNLVHKGVVQAMRGVGGGYRFAGNPNRTTLLDIIQLFETMESELDLPHWSKAADPIISE
FT                   LQSITNEIDDVTKAILETITLSAALKNMHLRSEAAQKAGNGK"
FT   gene            complement(252315..252761)
FT                   /locus_tag="Geob_0210"
FT   CDS_pept        complement(252315..252761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0210"
FT                   /product="acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18582"
FT                   /db_xref="GOA:B9M924"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9M924"
FT                   /protein_id="ACM18582.1"
FT                   /translation="MSNKLLIRNALPTDLEAIISLDRTTPDKDKADYWQGIFEHYVVKG
FT                   RADRIFLVAEKAGTVIGFIVGEVRAWEFGSPPCGWVFALAVSPDAREQGTGKQMFDEIC
FT                   SRLEKTGVSTVRTMANLDQKLTLSFLRSMGLRTGRYIELEKQLD"
FT   gene            253151..254296
FT                   /gene="bamA"
FT                   /locus_tag="Geob_0211"
FT   CDS_pept        253151..254296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamA"
FT                   /locus_tag="Geob_0211"
FT                   /product="6-oxocyclohex-1-ene-1-carbonyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18583"
FT                   /db_xref="GOA:B9M925"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR017613"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9M925"
FT                   /protein_id="ACM18583.1"
FT                   /translation="MATTDEIIARTAPGHLIDHNLIDRDVESLCDGMVRYEKRPAKRHD
FT                   GSVAEGIYNAWIIFNNPKQYNSYTTEMVKATILAFRRASADREVNAVVFTGVGDKAFCT
FT                   GGNTKEYAEYYAGNPQEYRQYMRLFNDMVSAILGCDRPVVCRVNGMRIGGGQEIGMACD
FT                   FSIAQDLANFGQAGPKHGSAAIGGATDFLPLMIGCEQAMVSGTLCEPFSAHKAARLGII
FT                   ADVVPALKVGGKLVANPTVVTDRFLDEYGRIVHGEFKTGADFKAGQAQIKEGEVDLTLL
FT                   DQKVDELCAKLLETFPECMTKSLEELRKPKLQAWNLNKENSRAWLALNMMNEARTGFRA
FT                   FNEGTKETGREIDFVKLRQGLAKGTPWTEELIESLMPAVKK"
FT   gene            254505..256463
FT                   /gene="bamB-1"
FT                   /locus_tag="Geob_0212"
FT   CDS_pept        254505..256463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamB-1"
FT                   /locus_tag="Geob_0212"
FT                   /product="benzoyl-CoA reductase,
FT                   bis-(molybdopterin)-oxotungsten-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18584"
FT                   /db_xref="GOA:B9M926"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B9M926"
FT                   /protein_id="ACM18584.1"
FT                   /translation="MRYAETGYVLEVDLTKGSIERVATDPKDTELYLGGLGTNAKLLWD
FT                   RVPPEVDPFSPDNLLIFAAGLLCGTPATGCNRTIVSTISPQTRLMAFSMMGGFWAPELK
FT                   YAGYDKVILRGKSPDLVYLYINNDKVEIRDASHLKGKGAIETAEIIKKELDEPRAQVAA
FT                   IGLAGENRVYYASIEQGRSSASRGGIGAVMGDKGVKAVVVRGTKDLCVAKPQEYMDLCN
FT                   EVLDYIKHREENPIPDVMPILAGLGSPQEMKVHDEKWHTENFNWGNARTRRKDFWTEEV
FT                   DHAWAETMEKARTRLISCYNCPMKCGATISMEGLPTYMMKCFTKLTYTMAAYSDLDFGL
FT                   RIAQKATEYGLDGFSAPQVMAFAFELLEKGILTEKDFPGLPEDNEEKFFYLLDKIVRRD
FT                   GIGDVLANGTYWAAQEIGKGAEEYAHNNIKKHEQLPLKLSMLNPIYYLMYCTGEKINIT
FT                   QIEGQFPQAPYPKREQREEFVKDWFQVPDDKFKQIFLDWEPRGEKSMPHYPTVDMCCDI
FT                   VDWQERMHYIDDALGQCAGLSSFPLKPPYHIHNYPKFIEAGAGIEMDEEKLTLAAKRYR
FT                   TLVRAINIRRGMRRIDETPPANHWKNRFPELEKELLDSYYKLKGWNDDGIPTKETLDEL
FT                   GLGFVSEEFVKRGILTD"
FT   gene            256511..257053
FT                   /gene="bamC-1"
FT                   /locus_tag="Geob_0213"
FT   CDS_pept        256511..257053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamC-1"
FT                   /locus_tag="Geob_0213"
FT                   /product="benzoyl-CoA reductase, iron-sulfur
FT                   cluster-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18585"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B9M927"
FT                   /protein_id="ACM18585.1"
FT                   /translation="MNNDTKTRTVKTINIDADKCNGCRACEVICSAFHAMPKYSSNNPA
FT                   RSRVRVVRDPLRDIYVPLYAGEYTESECIGRDKYIIDGKEYDECGFCRASCPSRDLFRE
FT                   PDSGLPLKCDLCDGEDEPLCVKWCLVGALSVTEREVAVIPEEEKLGEMEIGLESLISRF
FT                   GIDKVADTVAQKSKEKR"
FT   gene            257064..258227
FT                   /gene="bamD-1"
FT                   /locus_tag="Geob_0214"
FT   CDS_pept        257064..258227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamD-1"
FT                   /locus_tag="Geob_0214"
FT                   /product="iron-sulfur cluster-binding oxidoreductase, CCG
FT                   domain pair-containing, putative benzoyl-CoA reductase
FT                   electron transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18586"
FT                   /db_xref="GOA:B9M928"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B9M928"
FT                   /protein_id="ACM18586.1"
FT                   /translation="MGAIVETVTPYKEIIDVIKEKGGDSLKYCYQCGLCDSVCPWNRVR
FT                   KFSMRKIVRQGTFGLTEIEQEDIWRCSTCGTCPSRCPRGVNQIEAGVAMRKIGAEYDVY
FT                   PGHAGTIRNVVASLTSEGNSLGGERTKRAEWANDLPVKTYKDGMEVLYFTGCYLSYDPR
FT                   MRKVAAATAQILNKAGVEFGILGEKESCCGESIRKTGNEDLFKKLAKENIKAFIDNGVK
FT                   KVLVSSPHCYHTFKNEYPEFMVNFEVVFISQFIAQLINEGRLTISKEFAKKVTYHDPCY
FT                   LGRHNGIYDEPREVLQKVPGLELLEMADSREASLCCGGGGGRIWMETPKEERFADLRLR
FT                   QAVDVGAEVLATSCPYCITNFTDSSLDLAEHEAVEIKDLTEIILEVI"
FT   gene            258327..261386
FT                   /gene="bamE-1"
FT                   /locus_tag="Geob_0215"
FT   CDS_pept        258327..261386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamE-1"
FT                   /locus_tag="Geob_0215"
FT                   /product="polyferredoxin, putative benzoyl-CoA reductase
FT                   electron transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18587"
FT                   /db_xref="GOA:B9M929"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:B9M929"
FT                   /protein_id="ACM18587.1"
FT                   /translation="MNTEDRNIGDVLIVGGGISGIQASLDLANSGFRVFLVDKSPALGG
FT                   KMSQLDKTFPTNDCSMCIESPKFIECARNPNIEIITYTEVDRVEGEAGDFKVTLTKKPR
FT                   YISEEKCTGCNICVDYCPVKISDPFNQHLSENKAVHIYFSQAVPLVTYVDPETCLYLKE
FT                   GKCQICVGACKTNAIDLHQKPETMVLEVGAIILSPGYETFNPKLRGDFGYGQMKNVVTS
FT                   LDFERILCATGPYEGEILRPSDGKHPHKIAWIQCVGSRQVTPGGNNYCSAVCCAYSQKQ
FT                   VILAKDHDADLQATIFHNDVRAYGKDFERFHQRAERLSDVRFIRSYVTVGREIESSKNV
FT                   TIRYSTLDDGVKEEEFDMVVLSVGLNPPKDVEMLAQKIGIELSDQKFCKNNPYNPIETS
FT                   RKGVFVSGAFQGPLDIPESVVTASGAGALCGQLLSYRRHRLERERVYPPEKDVSKEELK
FT                   IGVVVCYCGANIGRVVDIPAVIEYAATLPNVSWAGENLFACSTENAKQISDAIVEKGLN
FT                   RVVLAACTPRTHEPLFRDTCREAGLNQYFFEFANIREHCSWVHSREKESATQKAKEIVR
FT                   MSVARAAHLEPLQEFQLPVDHTGLVVGGGVAGMTAALNMAEQGFEVYLIEKDDDLGGMA
FT                   RRLHYTLEGLDVQSYLKELVKKVYRHPQIHVWTDATITEVTGYVGNFNTKVVSEGRTRE
FT                   VKHGVAVIATGAQEYKPTEYLYGTSDRVLTQLELEGEIVDKTDKVTGAQSVVMIQCVGC
FT                   RQADRNYCSRVCCSQAIKNAHKLKEINPEMEIQILFRDMRTYGLKETYYREASEKNVKF
FT                   IRYEADTKPVVEAAGNGFKVTVPDPVLGQMMELEADLVVLAAAVIPSPSSADAGKFFKV
FT                   SNNPDGFFQEAHVKLRPVDFAADGVFLAGTAHYPKHLTETISQAYGAAGRAVGILSRET
FT                   VTASGAVCDVTESDCVSCGACITACKYGAISFHDTPQGKKARVEPILCKGDGLCNAKCP
FT                   TGAIYLKHYTDDEIFAQIDAALPAHQEDHL"
FT   gene            261420..262193
FT                   /gene="bamF-1"
FT                   /locus_tag="Geob_0216"
FT   CDS_pept        261420..262193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:261474..261476,aa:Sec)
FT                   /gene="bamF-1"
FT                   /locus_tag="Geob_0216"
FT                   /product="benzoyl-CoA reductase electron transfer protein,
FT                   selenocysteine-containing, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18588"
FT                   /db_xref="GOA:B9M930"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9M930"
FT                   /protein_id="ACM18588.1"
FT                   /translation="MAAGFEDKPRVVGFLCTWUAYGAADLAGVSRLQYTTETKIIRVMC
FT                   TGRVDLAFVIRAFSKGADGVFIGGCWPGECHYVTEGNFDVLKNVHIAKKLLEQIGINPD
FT                   RLRLEWISASEGMRYAEVMNDFGKKLKEMGPLGKGEGIEESVLKLKLEAVTKLVPYIKL
FT                   VERERLRQRFDTEEAYSRFFASDELNRLFAELVGNKLAVSQITLLLQDKPLSTGEIAQA
FT                   LGLNASEVSRHLKTSTMHGLIRFDEGLKRYALAQV"
FT   gene            262233..262685
FT                   /gene="bamG-1"
FT                   /locus_tag="Geob_0217"
FT   CDS_pept        262233..262685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamG-1"
FT                   /locus_tag="Geob_0217"
FT                   /product="benzoyl-CoA reductase electron transfer protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18589"
FT                   /db_xref="GOA:B9M931"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B9M931"
FT                   /protein_id="ACM18589.1"
FT                   /translation="MDIAKIDQIIDKHNGEESSLIQILLDIQSEHHWLPKEALNRVAEK
FT                   LQVPMSRIQHIATFYKAFSLVPKGRHEVHVCMGTACHVRGAQRVLDTVQDATGIKPGET
FT                   DAELKFSLETVNCLGCCALGPVMEVDGKHHGNIAPSQIASVLNNCD"
FT   gene            262696..264600
FT                   /gene="bamH-1"
FT                   /locus_tag="Geob_0218"
FT   CDS_pept        262696..264600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamH-1"
FT                   /locus_tag="Geob_0218"
FT                   /product="benzoyl-CoA reductase electron transfer protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18590"
FT                   /db_xref="GOA:B9M932"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B9M932"
FT                   /protein_id="ACM18590.1"
FT                   /translation="MTRLSSPEKLECARKEIISKIDPAKPCISVCAGAGCLASGAADVI
FT                   AAFKTELEFHNLTTEVNTKGTGCPGFCERGPIVMIYPEEICYLQVKPEDVPEIVSHTIK
FT                   EKKVVERLLYVDPATGNKATKESDIPFYKNQQRNILSENIRIDSKSIDDYLAIGGYSAL
FT                   SKVLFKMTPEEVMGEVKKSNLRGRGGGGFPAWRKWEESRNAPDPIKYVIVNADEGDPGA
FT                   FMDRALIEGNPHSILEGLIIGAYAVGAHEGFIYVRQEYPLAVVNINLAIRQAEERGLVG
FT                   KNILGSNFDFTVKVHMGAGAFVCGESSALMTALEGRAGEPRPKYIHTAVKGVWDHPSVL
FT                   NNVETWANVTQIINKGADWFTQFGTEGSKGTKIFSLVGKITNTGLVEVPMGVTLKDIIQ
FT                   NIGGGIPGGKKFKAVQTGGPSGGCIPEAQLDLVVDFDQLTKAGSMMGSGGMIVMDEDTC
FT                   MVDIARYFIDFLKDESCGKCTPCREGIRQMLKVLTNITTGKGKEGDIELLEELAESTGA
FT                   ALCALGKSAPNPVLSTIRYFREEYEAHIRHKKCPALSCKELIAFHIQPDKCKACGTCFK
FT                   QCPAEAIEGGKKRIHIIDQDKCTKCGTCLDVCPKQFGAVRKISGEPVPAPVPEEKRAL"
FT   gene            264610..265245
FT                   /gene="bamI-1"
FT                   /locus_tag="Geob_0219"
FT   CDS_pept        264610..265245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamI-1"
FT                   /locus_tag="Geob_0219"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18591"
FT                   /db_xref="GOA:B9M933"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B9M933"
FT                   /protein_id="ACM18591.1"
FT                   /translation="MSEIHLQIDGKEVVASEGMTILEAAKTVGISIPTLCHSEKLEPYG
FT                   GCRICTVEVEVRGWPKLVAGCIYPVEKDLVVRTKSEKVNKIRKVLIEEMLAHAPDAEVL
FT                   KELATEYGADKDRFEKHPSFCIHCGLCVRYCAEIKKKNAVGFVDRGSNREISFIPEIAA
FT                   KECWDCKECFPLCPTSALQAAYVLAESLMTPPESASGCGCSCSSGKKG"
FT   misc_feature    complement(265334..265558)
FT                   /note="conserved nucleotide sequence; Geob_R5009"
FT   misc_feature    complement(265564..265620)
FT                   /note="conserved nucleotide sequence; Geob_R4002"
FT   gene            complement(265611..266210)
FT                   /locus_tag="Geob_0220"
FT   CDS_pept        complement(265611..266210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0220"
FT                   /product="acyltransferase, left-handed parallel beta-helix
FT                   (hexapeptide repeat) family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18592"
FT                   /db_xref="GOA:B9M934"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B9M934"
FT                   /protein_id="ACM18592.1"
FT                   /translation="MAFRRIITMAKVYEMGGVIPVIDPTSFVHPDAVIIGDVIIGPNSY
FT                   IGACACLRGDLGRIVISAGANIQDTCVIHSFPEVDVIVGENGHVGHGAILHGCTIGRNA
FT                   LIGMNAVVMDHAVIGENSFVAAMAFVKSGMTTGANMLIGGMPAREIRPLEKEEITRKAQ
FT                   GTLLYQWLAAQSKVSMREAEPLTEAEPDRGRVSPPP"
FT   misc_feature    266266..266401
FT                   /note="conserved nucleotide sequence; Geob_R2002"
FT   gene            complement(266401..267336)
FT                   /locus_tag="Geob_0221"
FT   CDS_pept        complement(266401..267336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0221"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18593"
FT                   /db_xref="GOA:B9M935"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M935"
FT                   /protein_id="ACM18593.1"
FT                   /translation="MKFAILGTGIMGRGWITQCAMSGHEVHCHDASPQTLAGTVAGCEK
FT                   LAATAAKKFKHDDPNFVSNAMGKIRVHNEKGAFIDAAKGCDVFLEVIFEDLKLKCSVLA
FT                   DYLPQLPPSVVFWSNSSSLDIDPMAQAGGRPDRSIVTHGMNPVPLMPGVEVVPGAKTSS
FT                   ETIEFTRQTLLNMKKAPFLAPNIPGFWVNRLLVPQMLDAVRLLEQGKITVEDGDTGLYT
FT                   SLGHPQGTFKLHDFVTAPTMLRVALQMYQASNDPRMYPPLTLMRMVKNGEYGASSGKGF
FT                   YDWSDPRNPKPLDMSKYVIGTAEEMLQPLA"
FT   gene            complement(267333..267578)
FT                   /locus_tag="Geob_3844"
FT   CDS_pept        complement(267333..267578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_3844"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_3844"
FT                   /db_xref="EnsemblGenomes-Tr:AID57968"
FT                   /db_xref="UniProtKB/TrEMBL:A0A068F6A1"
FT                   /protein_id="AID57968.1"
FT                   /translation="MFHMSASGCPSDCLSPSVQPAPSHQNNLLIPACYKIAAFRHLADG
FT                   HIGTKYVLWCLITDLDAAHYVPIRLPICKSTGGGRL"
FT   gene            complement(267661..269019)
FT                   /locus_tag="Geob_0222"
FT   CDS_pept        complement(267661..269019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0222"
FT                   /product="sigma-54-dependent transcriptional response
FT                   regulator"
FT                   /note="domains: REC, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18594"
FT                   /db_xref="GOA:B9M936"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M936"
FT                   /protein_id="ACM18594.1"
FT                   /translation="MAYIVLVIDDQPSILQSMEVFFQLRSWKVHTAPDGKKGISLARRV
FT                   QPDLVVLDIRLPDMDGLEVLKELRSRVPNAEVIMITAHQDMESTIKAIKAGAFDYLHKP
FT                   IDIDEMDSVLKRLRAMMSAAPVAADDESANQPLGGLDTLHLIGKSKAMKEVFKKIALAS
FT                   GARVTMLVQGESGTGKDMVAQAIHRNSPWNNKPFTVMDCSTLAPSLVESELFGYEKGAF
FT                   TGADRTRAGRIELTGDGTVFFDEIGELPLHLQSRLLRFLQEGQFVRVGGVAPIQSNARI
FT                   IAATNRDLLAMVAEGTFREDLYFRLKVVTIHMPPLRDRRSDIPDLARFLLEKIAARTAL
FT                   RPRMLSEGAIGELMKRDWPGNVRELENSLTRAALMTKSTVLSEEELAAALDGDRYQPAT
FT                   ERSVKSLADAERDHILFALESYEWSLGKTCQALQISRPTLRAKIRTYGLGKNS"
FT   gene            complement(269022..270524)
FT                   /locus_tag="Geob_0223"
FT   CDS_pept        complement(269022..270524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0223"
FT                   /product="sensor histidine kinase, PAS domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18595"
FT                   /db_xref="GOA:B9M937"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M937"
FT                   /protein_id="ACM18595.1"
FT                   /translation="MDVFKTLGKYHGEIVDVWVGRMLSDRSAPYHREAEANLRPLVSQA
FT                   TAAYSLVLDGGGWDELDAFITFIARRRLAQGYKLSDVQKAFMLYQQVVTPFIIRNARDD
FT                   ERDEAIARLGSCISQTVGKFSDFFQGLHEEYMRQQTVVLEKEVAKRTRELSESESKYKA
FT                   LVEDIRDGYYVLHDGVVVFANSAFCAMHGRPMKEIVGIPFLELVAPESRGDVERSSEQS
FT                   RTSQSTSLVEYFRLQSNGRKLPTEALAKISSYEGKAASLGICRDISERKELEQKTREAE
FT                   TLNALAQQAASLAHDIRNPLTAIKMNVQMLAAELDGNPTHHRLLEISRKEVESIERSVL
FT                   EMMHLARPFRLNREIVLLRPFIQDCVDALRTRMEHKGVKASLRLSPKLDRLRIDPHRIE
FT                   QTLVNLLFNAIEAVPRGGHIFVTSGRVEHQGSQWGTICVADNGPGIPAELLPYYFDEKQ
FT                   KRRIGLGLDNVKKVIEAHGGVVEVGIRRPRGLRVCLRLPQEQ"
FT   gene            270828..272480
FT                   /locus_tag="Geob_0224"
FT   CDS_pept        270828..272480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0224"
FT                   /product="2,3-dihydroxybenzoate--coenzyme A ligase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18596"
FT                   /db_xref="GOA:B9M938"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B9M938"
FT                   /protein_id="ACM18596.1"
FT                   /translation="MIKNGFTEWPEDFAQAYRDAGYWRDQTIGEVLAERFARFADRTAL
FT                   IAEDGAHYTYADLDRLSTRLALHFKNLGLQPYDRVIHQIPNGPVSVLTFLGLLKAGAVP
FT                   VMTLPPHREAEIGHFARLSGARGYAIASQVREFDFQALAGTVQEQNPSLEFVLVTGGMP
FT                   GPGYQSIDAMLLDPIEERAGSTSLPRPDPDFPAVLLLSGGTTGIPKLIPRTHNDYAYNF
FT                   LRCAEVCGLDGETSVLVAVPQAHNFALACPGLLGTLATGGCELLSANTATEQLMKLIET
FT                   HRLTHFIAVPTMILGLLDHPERGKYDLSSLRMILTGGSKLNPEVALRLRPELGCDVLQV
FT                   LGMAEGPLYWTRLEDPDDVRLHTQGRPQSPGDEFRIVDPESGKEVAPGEVGELWCRGPH
FT                   TIRGYYRADEHNTRAFSSDGFYKSGDLVRLHESGNIVVEGRNKDCINRGGEKISAEEIE
FT                   NHLIAHGSVLNCAVVAMPDAIFGEKCCAFVVPAPGASLTLEGLCDFLIKERKIARFKLP
FT                   ERLETLDALPLTNVGKINKKALREIIVQLQQAA"
FT   gene            272633..274009
FT                   /locus_tag="Geob_0225"
FT   CDS_pept        272633..274009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0225"
FT                   /product="membrane protein, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18597"
FT                   /db_xref="GOA:B9M939"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9M939"
FT                   /protein_id="ACM18597.1"
FT                   /translation="MTTNAQTKPSVSFTQWCDSLSFNRFHAMVMALAALILVFDGYDAQ
FT                   IIAYVMPQLVKEWHLTPVEAGSMASYGFIGLMIGAAGFGTFADRLGRKKGVMIALVVFS
FT                   VFSGAAYWAPNFKVFCLLRFLAGIGMGGAMPLTITLVTEFAPAKARAKAVSAMFAGFTL
FT                   GWGVAALVAMVGIPALGWRMVLLFGFLPVLILPLLQKALPESVRFLASKGRHEEAILEI
FT                   QRMEKAAGLPPAAWTKESFQTGPVEPGSSLTQLFSPGFSFMTPLIWATYFLNLLVVYGL
FT                   ATWLPSLLVKAGFSLVKSYSFGMVQAIGASLGGFLLGWMMDRFGRKSALIFAYMAGGVV
FT                   VALFGTVSSNTALYIIGAATGVFVIGAQIAQHVVTGELYPTSIRSTGVGYALTAGRLGS
FT                   IAGPLLGGALQMAGVTFSQYFLIFAVPSFLCAGLVYLYRVNVKDEGLETVHERLVSVEE
FT                   "
FT   gene            274220..275023
FT                   /locus_tag="Geob_0226"
FT   CDS_pept        274220..275023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0226"
FT                   /product="helix-turn-helix transcriptional regulator, IclR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18598"
FT                   /db_xref="GOA:B9M940"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9M940"
FT                   /protein_id="ACM18598.1"
FT                   /translation="MTENNSPTKIKEDEKYNIRAIERALSVLEAFSIERRKLSLDELTK
FT                   LIGLSKPTVFRILSTLQSRKFIYLDKGDGRYRLGSVFLTLASAVHGSSGLGAIARPHLT
FT                   TLRNSTQATVLLGALLEDHLVYLDKTEGRGPVRLANDIGWRRDPAHYGMLGMTLMAFLD
FT                   PAEAERLLDEFPLAPYTEKSLNDRLLFLKRLDDIRRLGYALEFEEAIDGVWGVAAPVLN
FT                   AAGEIIAAVGAALSMSACSDERIADTINSVTACAGAISSDLGHRR"
FT   gene            275437..277419
FT                   /gene="bamB-3"
FT                   /locus_tag="Geob_0227"
FT   CDS_pept        275437..277419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamB-3"
FT                   /locus_tag="Geob_0227"
FT                   /product="benzoyl-CoA reductase,
FT                   bis-(molybdopterin)-oxotungsten-binding subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18599"
FT                   /db_xref="GOA:B9M941"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B9M941"
FT                   /protein_id="ACM18599.1"
FT                   /translation="MKYAETGFALEVDLTRGNIEKVPTDPKMTGLHLGGDGVAAAILWE
FT                   RVPPEVAPQSPANLLIFSAGLLAGTPIPGANRTCVSSISLQSNLLVNANFEGFFAPELK
FT                   HAGYDRVVIRGKSTSLVYLWIHDDKVEICDASHLQGKSAMETTAILRKELKDPNVQVAT
FT                   IGVAGENKVSQASIEHANSSASQGLGVIMGDKGLKAIAVRGTKDLGIARPDELFARCNA
FT                   LYGEIYDNPSCGDLLLSEHDNAWHVANLPWTAAGERVKGFWTPELGQEWGVRVEREEIG
FT                   YQWENYSQEMEEVRETVVEESKLVRGTGCYNCPKNCHKVLSLPGERQYFLKSYSRHVYA
FT                   MAAYGDLKLNYDVLYAMQDFGLDENAMVQLFAFVQDLHQAGIFTDSDLPDFPADPIGRY
FT                   LYILEKVANRQGIGAILAEGLCQAAGQIGKGAEAYVRGVKKTAQLPLRWKTANYASFLM
FT                   YAAGDKMDISQVEGSFPQLPIPDRKEREAFVKVWDAAPQRFKEWFLDWEPEQQFSIEAA
FT                   AEIVGWNEAMHYADDILGICPLLSSFRGQFGGKPPYHLNNLPQLVSLATGIELDVAGLL
FT                   EISRRNRQLIRALNAGRGQRRADDEFPAELWENRDTAMEQQHLDAYYSFMGWTAEGIPT
FT                   RETLTGAGLDHVSKVLMARGLLTGE"
FT   gene            277538..279451
FT                   /gene="bamB-4"
FT                   /locus_tag="Geob_0228"
FT   CDS_pept        277538..279451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamB-4"
FT                   /locus_tag="Geob_0228"
FT                   /product="benzoyl-CoA reductase,
FT                   bis-(molybdopterin)-oxotungsten-binding subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18600"
FT                   /db_xref="GOA:B9M942"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B9M942"
FT                   /protein_id="ACM18600.1"
FT                   /translation="MRYAETGFNLEVDLSQGTVKRVPTDRKLSELHLGGQGTAARILWD
FT                   RVPPETDPLSPENILIFSTGLLHGTPVPGANRTSVSTFSPLTGLYVNSLMGGWFGPELK
FT                   FAGYDKIIISGESPSLVYLYINNDTVEIRDAGHLQGKGCQEVATLLQKELKEPKLQVAA
FT                   IGLAGENKVFQATIEHANSSASRHGVGAVMGAKRLKAIAVRGTKDVYVSGAAELWELCR
FT                   GKYQEIYDNKNCGDPMAHDHNESFHVDNFAWGNARTRRKDYWNKEREEQWVGLWKEVRT
FT                   RDSGCYNCPKDCHYTISYPGRHTYFLKCFNKLTYSMAAFEEIDFNYNILGLTSAYGMDG
FT                   FSTPQVLAFAIELYEAGILTEKDLPDFPADGAGRFFYLLDKVVHREGIGDVLANGVYQA
FT                   ARIIGKGAEAYDHNTTKKVEQVPLKLGVVNYPFFLMYCTGEKMNITQIEGSFPQAPIAN
FT                   PEKRRKFVENWSAAPERFKKWLLEWEPKQHMPIEASVNVCDWNEAMHYVDDAIGTCAWL
FT                   SSFRGQFGGSPPYHLFNLPQIIGLAAGIELDSDGLLEISRRNRNLVRALNIRRGLRRNV
FT                   EKPPEDHWKIRDPEMEQKHLDAYYEFKGWTSDGIPTRETLDRLQLQYVSEDFIARGILP
FT                   AA"
FT   gene            279508..280044
FT                   /gene="bamC-3"
FT                   /locus_tag="Geob_0229"
FT   CDS_pept        279508..280044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamC-3"
FT                   /locus_tag="Geob_0229"
FT                   /product="benzoyl-CoA reductase, iron-sulfur
FT                   cluster-binding subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18601"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B9M943"
FT                   /protein_id="ACM18601.1"
FT                   /translation="MSDQPKKKMVKEVKVDLDKCIGCRACEVACSGFHASPKYSSFNPA
FT                   RSRIRVVQDLVNDVYVPLRAAEYTPAECTGRQTFKIHGKQYSECNFCPASCPSRDLFKE
FT                   PDSGLPLKCDMCEEEETPLCVQVCRPGALTYEVREEERAEEEPALGEVEVGLKSLLHKH
FT                   GAQKVLDTIARLQND"
FT   gene            280044..281216
FT                   /gene="bamD-2"
FT                   /locus_tag="Geob_0230"
FT   CDS_pept        280044..281216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamD-2"
FT                   /locus_tag="Geob_0230"
FT                   /product="iron-sulfur cluster-binding oxidoreductase, CCG
FT                   domain pair-containing, putative benzoyl-CoA reductase
FT                   electron transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18602"
FT                   /db_xref="GOA:B9M944"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B9M944"
FT                   /protein_id="ACM18602.1"
FT                   /translation="MHKKELKVETVAPFKEIIDVIKEEGGDPFKFCYQCGKCDSVCPWN
FT                   RVRTFSMRKLVRQASLGLTEIESEDIWRCSTCGRCPQNCPRGVKQIESGVALRRIATQN
FT                   EVFPAAVEPLRTVSVGLMGEGNPFNDERKNRGDWAQGLSVKPFTKEMEVLYFSCCYLSY
FT                   APRLKKVAAATANVLNKAGVKFGILGERENCCGESIRKTGNEELFTKLAKENIQNFIDN
FT                   GVKKILVSSPHSYHTFKNEYPEFMVNFEVVYVTDYLNQLIKDGRLKLSKECPKKVTYHD
FT                   PCYLGRHNGIYDQPREILKRIAGLELVEMADSRENSLCCGGGGGRIWVETPKEERFSDL
FT                   RVGQAVSVGAEVLATSCPYCITNFEDSRLSLDEGVVLEIKDITEILEELM"
FT   misc_feature    complement(281346..281573)
FT                   /note="conserved nucleotide sequence; Geob_R5010"
FT   gene            281566..284661
FT                   /gene="bamE-2"
FT                   /locus_tag="Geob_0231"
FT   CDS_pept        281566..284661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamE-2"
FT                   /locus_tag="Geob_0231"
FT                   /product="polyferredoxin, putative benzoyl-CoA reductase
FT                   electron transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18603"
FT                   /db_xref="GOA:B9M945"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:B9M945"
FT                   /protein_id="ACM18603.1"
FT                   /translation="MNQTKGMLTVGNDMAQKKFIDVLVVGGGISGIQAALDLANSGFKV
FT                   YLVDKAPAIGGKMSQLDKTFPSNDCSMCIESPKFNECSRHPNIEILTYTAVESVKGKAG
FT                   NFKVTLVKKPRYVVEEKCTGCNLCVEYCPAKVPDRYNQNISDNKAIHIHFSQALPLIPY
FT                   VDPEACLYLKDGSCTICVGVCKPNAIDLHQEEELMEVNAGAIVLAPGFETFDPKLRSDY
FT                   GYGVFENVVTSLDYERILSSTGPYEGTISRPSDKKHPHKIAWIQCVGSRQVNPEGGNSY
FT                   CSAVCCAYTQKQVILTKDHDPGMEATIFHNDIRAFGKEFERFYQRAEKLSDVRFIRSYV
FT                   SIGRENPETRNVSIRYSTFDQGVKEEEFDMVVLSVGLNPPADVQTMATTFGIELNEYGF
FT                   CKTRPGNAIETTRPGIYVSGAFTGPADIPESVVTAGGANALCSELLSYRRGDLSRERVY
FT                   PPEKDVAKEEIRIGVVVCLCGANIGRVVDTPAVVEYAAGLPNVVYAERNMFACSTENAQ
FT                   LIADAIVEHNLNRVVLAACTPRTHEPLFRDTCREAGLNQYYFEFANIREHCSWVHSKDK
FT                   EGATEKAKDIVRMAVARAAHLEPLQEFQLPVNKTALVVGGGIAGMTSALSMANIGFQVH
FT                   LVEKESDLGGMARRLHYTLDGLEVQPLLDDLVRKVYRHPLIHISLDATITDVSGYVGNF
FT                   VTTVISEGRRREIAHGAAILATGADEYKPTEYLYGQNDQVLTSLELEERIAKGDEQTLG
FT                   AQTLVMIQCVGCREEWKNYCSRVCCSQSIKNALKLKELNPEMEIYVIYRDMRTYGFRED
FT                   YYREAANKDVKFIRYEPAGKPLVEAATEGGRPIIRVTVPDPVLGQKLAIDANLLVLAAA
FT                   VVPSAASQEMAKLFKVAMNTDGFFQEAHVKLRPVDFGADGIFLCGLAHYPKHITETISQ
FT                   AYGAAGRTVNLLTRDSVTASGAVCDVTRSNCVACAACITACKYDAIELVDTPFGKEATV
FT                   NPALCKGDGLCNTKCPTGAIYLKHYTNQEIWSQIDAATPGWE"
FT   misc_feature    complement(284685..284718)
FT                   /note="conserved nucleotide sequence; Geob_R4105"
FT   misc_feature    284733..284765
FT                   /note="conserved nucleotide sequence; Geob_R4106"
FT   gene            284793..285560
FT                   /gene="bamF-2"
FT                   /locus_tag="Geob_0232"
FT   CDS_pept        284793..285560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:284847..284849,aa:Sec)
FT                   /gene="bamF-2"
FT                   /locus_tag="Geob_0232"
FT                   /product="benzoyl-CoA reductase electron transfer protein,
FT                   selenocysteine-containing, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18604"
FT                   /db_xref="GOA:B9M946"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="UniProtKB/TrEMBL:B9M946"
FT                   /protein_id="ACM18604.1"
FT                   /translation="MTAALEFKPRVVGFLCTWUAYGAADLAGVSRLQYTTETKIIRVMC
FT                   SGRVDLDFVLRAFSRGADGVFIGGCWLGECHYVTEGNYDALSMMHLAKRVLEEVGINPD
FT                   RLRLEWVSASEGMRYAEVMNDFGRRLKELGPIGSSEGIEKEALKLKFAAVKKILPFLKL
FT                   VERERLRVRFKTEEEYTKFFSSPEVDALIRGVIAENLAISQILTLLGRKPLTTRQIAEV
FT                   LRLEPAEVARCLNVSSQQGLIRYNETEKRYAVA"
FT   gene            285603..286055
FT                   /gene="bamG-2"
FT                   /locus_tag="Geob_0233"
FT   CDS_pept        285603..286055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamG-2"
FT                   /locus_tag="Geob_0233"
FT                   /product="benzoyl-CoA reductase electron transfer protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18605"
FT                   /db_xref="GOA:B9M947"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B9M947"
FT                   /protein_id="ACM18605.1"
FT                   /translation="MDRDRIDQIIDTHGCKASSLIQILIAIQSENHWLPKEVLERVSER
FT                   LNVPMNQIQHITTFYKSFSLVPKGRHEVHVCMGTACHVRGAQGVLDTVEDVTGIKPGET
FT                   DVDLKFSLETVNCIGCCALGPVMVVDGDYHGNLAATQVEDVLKTYE"
FT   gene            286065..287978
FT                   /gene="bamH-2"
FT                   /locus_tag="Geob_0234"
FT   CDS_pept        286065..287978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamH-2"
FT                   /locus_tag="Geob_0234"
FT                   /product="benzoyl-CoA reductase electron transfer protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18606"
FT                   /db_xref="GOA:B9M948"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B9M948"
FT                   /protein_id="ACM18606.1"
FT                   /translation="MAKINSTVEFEALRKEILSSRDPNRPCIAVCTGSGCLALGAAKLV
FT                   AALKSEIKEQGLEQRIEVRETGCPGFCERGPLIVIYPEETCYLKVQPTDAKEVIASVME
FT                   KKIIDRLLYVDQVTGERVVHEMDIPFYKNQLRLLIGNNIKLDPTSIDDYIAIGGYTALE
FT                   KAVCQMKPEQVVGLVKESGLRGRGGGGFPSGNKWEFTRNAPDPVKYVVVNADEGDPGAF
FT                   MDRALLEGSPHAVLEGLIIGAYAIGAHEGFLYVRQEYPLAVHNITLAIQKAEEYGFLGK
FT                   NILGSGFDFTVEVAQGAGAFVCGEETALIRSLEGKTGEPKPRPPFPAVRGLWNKPTNIN
FT                   NVETWANIPLIINKGPAAFASVGTGGSKGTKIFSLVGKVKNTGLVEVPMGITLRDIVYK
FT                   IGGGIPGEKKFKAVQTGGPAGGCMPESLLDMEVDFDQLTKAGSMMGSGGMIVLDEETCM
FT                   VDFARFFLSFLAEESCGKCVPCREGIQQMLAILNDLTHGKGKKGDLELLEQLTEVSSAS
FT                   LCALGKGAPNPVLSTLKHFRDEYQAHMEGKCPAFTCKSLFSYYIEPEKCQACTSCGKKC
FT                   PAGAIEGGKNQIHMVDQAKCTKCGACLQACPPRFAAVTRILGEVVPPPLPEEARTIVRG
FT                   SK"
FT   gene            287981..288595
FT                   /gene="bamI-2"
FT                   /locus_tag="Geob_0235"
FT   CDS_pept        287981..288595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamI-2"
FT                   /locus_tag="Geob_0235"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18607"
FT                   /db_xref="GOA:B9M949"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B9M949"
FT                   /protein_id="ACM18607.1"
FT                   /translation="MSELVLQIDGREVTVKEGATILEAAESVGIAIPTLCHHHKLEPYG
FT                   GCRVCSVEVEANGRTMVVAACTYPAEKNVVVRTRSEKLSRIRQALVEMMLAHAPDSEKL
FT                   VALAEEYGADRDRFKRNQSFCIHCGLCVRYCTEVKKKNALGFIDRGAKKRICFIPKIAA
FT                   AECWKCRECFPLCPTSALQAAFVLTEGMTAAVPTEAAESGR"
FT   gene            complement(288711..289508)
FT                   /locus_tag="Geob_0236"
FT   CDS_pept        complement(288711..289508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0236"
FT                   /product="helix-turn-helix transcriptional regulator, IclR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18608"
FT                   /db_xref="GOA:B9M950"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9M950"
FT                   /protein_id="ACM18608.1"
FT                   /translation="MTMDRKTRDPAEARKFVEALARGLEVLSCFNPSDRYLGNQDIAKR
FT                   TKLPKSTVSRLTYTLSELGYLNYCKSANKYSLGNAVIALGYAKLGQMDIRRISRPLMQA
FT                   LAEHTQASVNLGIRDHLNLIYIDTYRNTSTLTVQLDVGSQIPIATTSMGRAYLCVMPED
FT                   ERNELLEEIKVSDEQNWPTVKAGFDQAMAEYRQFGYCTSLGNWRTEVHAVAVPLVLEDG
FT                   TIMGFSCSGASFQLSRQLIESDIGPRLINLVGNVRTALSFARN"
FT   gene            290112..291269
FT                   /locus_tag="Geob_0237"
FT   CDS_pept        290112..291269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0237"
FT                   /product="glutaryl-CoA dehydrogenase, non-decarboxylating"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18609"
FT                   /db_xref="GOA:B9M951"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9M951"
FT                   /protein_id="ACM18609.1"
FT                   /translation="MRFGLTDEQKMMQDMARDFAQKEILPTLKEDEANHTFRPELVKKM
FT                   ADLGFFGCALPEEYGGNGCGFLESVIIAEQLATISGSSRLPLNMQNIGPSITVNQFGTK
FT                   EQKERFIPKWVSGEYFGFFAITEPNSGSDVISMGTTAIDRGDHWELNGQKMWISNAHLG
FT                   DYGLVYAMTDKSAKYKGMTCFIVNLKGNEGIITAPIETKLGLHCAPTGEISFSQAKIPK
FT                   DSVLGEVGQGFQICMYQLNNTRISCAAGALGIGGGAIEAAIGYANERTQFGKKIGSYQM
FT                   IQASIAEMVAEHEAAKLLVYQAAWLKDQGLPNQYQTSMAKLFASEAAVHAATETMKIFG
FT                   SYGFSTEYPAERWLRDSMSLRTVEGTSNIQKTIIAGMALGDTVNR"
FT   gene            291357..293114
FT                   /gene="gcdA"
FT                   /locus_tag="Geob_0238"
FT   CDS_pept        291357..293114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcdA"
FT                   /locus_tag="Geob_0238"
FT                   /product="glutaconyl-CoA decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18610"
FT                   /db_xref="GOA:B9M952"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B9M952"
FT                   /protein_id="ACM18610.1"
FT                   /translation="MSRKQTPLRPYFEKMPEIGKALTEAEIKRAQENIDLVREQEKILA
FT                   QEAERVKNAGIPAKKVHERGGMTIYDRLEYLVDPGTWSPLHSLYNPRDNEEGCTGVVNG
FT                   IGKIEGKWAVIIGFDNKVMAGAWIAGQSENILMVTDMAKRLNVPLVWLTNCSGVKLMEQ
FT                   ETVYAGRRSSGAPFYRHADLNHLGIPILNAIYGTNPAGGGYQGISPTILLAHEGANIAV
FT                   GGAGIVGGMNPKGYIDAEAARALIDGTKSFKAKDPGRVETHFDHTGYFREVHDSETGVL
FT                   DGIKDYMRMMPAYDPAMFRVAQPAPPKFPVEDLNMILPANQKRPYDAIQILSRLTDNSE
FT                   FMEYRPDYGREVFTGIAKIDGYPVAFIGNRQGVFPGYPEYANGAYPAVGGKHYRQGLIK
FT                   QGEFVTLCGRDNLPIVWLQDTTGIDVGDLAEEAELLALGQSLVYSIEQTELSMMCIVLR
FT                   KGTAAAHYIMCGPQANNNNAFTLGTPLTEIYVMHGETAAAASYARRLVKEDEAGNDLTP
FT                   TLDKMNQMIQDYVDKSRPAYCAKTGFVDEIVSLPDLRKYIQAFTGANYQNPRSITPVHQ
FT                   MLLPRIIKG"
FT   gene            293229..295304
FT                   /gene="oadA"
FT                   /locus_tag="Geob_0239"
FT   CDS_pept        293229..295304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="Geob_0239"
FT                   /product="oxaloacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18611"
FT                   /db_xref="GOA:B9M953"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9M953"
FT                   /protein_id="ACM18611.1"
FT                   /translation="MSKGKNPLGITEVVLRDAHQSLFATRLRLDDMLPICEKLDKVGYW
FT                   SIEMWGGATFDSCIRFLGEDPWERLRKLKQAMPNTPQQMLFRGQNILGYRHYADDVVEK
FT                   FVERAAFNGIDVFRVFDAMNDPRNLDTAIKAVIKQGKHAQGTMSYTVSPVDTIPKWVDL
FT                   AKRIEDMGSHSLCIKDMAGLLSPYTAYELVKKLKKSINIPIHMQCHATTGMSTATYVKA
FT                   IEAGVENVDTSISSMSMTYGHSATEALVAIMSETDQATGLDMSLLQEIADYFTVVRKKY
FT                   AKFEGSLKGIDARIIMAQVPGGMLTNMESQLKDQNAGHKMDQVLAEIPKVREDLGMIPL
FT                   VTPTSQIVGTQAVINVLTGERYKSMTKETAAVLKGEYGATSAPVNKELQAKVLAGAEPI
FT                   TCRPADLLDHEMDKLTAELRELAKGKNLKFGDHEVEDVLTYALFQQVGLKFLEHRDNPD
FT                   MFEPVPTGEEAAPAAKAAAPAVAGGETFTVTGGGQTFVVQVAKATGAAAAAAAAAANAA
FT                   AGAAAAAPAASAGGFDIVSPLAGNVWKIEVDPGQEVKEGDLLLILEAMKMENEIFADRD
FT                   GIVGTIHIQEGNAVDIGQPLVTLISDAAALVATAAAPAAAGAAAPKNGVTAPLAGNVWK
FT                   IEVKPGQKVQEGDLLLILEAMKMENEIFADKDGIVGQLLIQEGHAVDIGQVLLTLD"
FT   gene            295433..297700
FT                   /gene="maeB-2"
FT                   /locus_tag="Geob_0240"
FT   CDS_pept        295433..297700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB-2"
FT                   /locus_tag="Geob_0240"
FT                   /product="malate oxidoreductase, NADP-dependent, phosphate
FT                   acetyltransferase-like domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18612"
FT                   /db_xref="GOA:B9M954"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B9M954"
FT                   /protein_id="ACM18612.1"
FT                   /translation="MSKKSAALEYHSTGRKGKIEVIATKPCQTAQDLSLAYSPGVAEPC
FT                   LAIEQTPEDAYQYTAKGNLVAVVSNGTAVLGLGNIGALAGKPVMEGKGVLFKRFADVDV
FT                   FDIELNSENPDEIIRAVQLLEPTFGGINLEDIKAPECFYIEEELKKTMNIPVFHDDQHG
FT                   TAIISAAGLINALELVGKKIEDIRLVVNGAGAAAIACANLVVSLGVKRENIIMCDTKGV
FT                   IYKGRTEGMNKYKEHFAVDTPLRTLEEAAVNCDVMFGLSSKGAFTPEMVRTMAVNPIIF
FT                   AMANPDPEITPEEARKVRGDVLIATGRSDYPNQVNNVLGFPFIFRGALDVRATTINEEM
FT                   KKAAVFALAELAREECPDSVCRAYGNVKFSFGRDYIIPKPFDPRALMRVAPAIAKAAMD
FT                   SGVARQPIPDMDKYVEALESLQGKAKETLRMIINKAKCDPKSIVFPEGENEKILRAAQV
FT                   LVEQGIARPILLGSEKKIRATLQELGIDLNGGVTIIDPANSDKANGYADEFYRLRQRKG
FT                   LTLSESQRLMSRKSRTHFGCMMVRQGDADTLLAGIDANYAETIRPALQVIGKQEGLSSV
FT                   HGLYIMVFKKGLYFLADTTVCIDPNAQELAETAILTAEMARMLEVEPSVAMLSMSNFGS
FT                   VRHPQADKVRLAVELVKEKEPGLIIDGEMQADTAVVTEILQSSFPFSTLKKAANILIFP
FT                   DLTSGNIAYKLLNKLGEAEAIGPILMGMNKPVHILQRGDDVMDIVNMAAIAVVDAQNNG
FT                   RP"
FT   gene            297770..298615
FT                   /locus_tag="Geob_0241"
FT   CDS_pept        297770..298615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0241"
FT                   /product="SAM-dependent methyltransferase, type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18613"
FT                   /db_xref="GOA:B9M955"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9M955"
FT                   /protein_id="ACM18613.1"
FT                   /translation="MHSTAAYFDTVEAHYGHNDLETTILNALVAAGKDPDRLKAEDLAP
FT                   IDQFHVRGLKATSQLAMDIKLDRDMQVLDLGSGLGGASRYLAKEFGCSVVGLDLNAQYC
FT                   QVATTLTRRLGLDSRVTFIQGNALEIPFPDGSFDLVWTQHMTMNIPDKSSFYREVYRVL
FT                   KPGGRLAMYDILAGPGGEVLFPVPWARDTATSFLVASQVLVDTITETGFDIHIWRDVTE
FT                   AARLWTRATQERLYLNPGLLGLQLLLGTDFRKMVHNQFLNLQQERIALVEAVVRRPLLA
FT                   "
FT   gene            298668..299588
FT                   /locus_tag="Geob_0242"
FT   CDS_pept        298668..299588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0242"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18614"
FT                   /db_xref="GOA:B9M956"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9M956"
FT                   /protein_id="ACM18614.1"
FT                   /translation="MNKSAAKMVLLPTLNDLPGEIAQADSGGSMQTTAEKMVLPTLKDS
FT                   SIAVEKRIAVLTLQRHDVRNALTGTALIDDIVQTVNWVNNEPEVSVLVITGEGTAFSSG
FT                   GNVKEMQSQSGSFAGSPMEIQDHYRRGIQQIPLALHKAEVAVIAAVNGPAIGAGFDLAC
FT                   MCDIRIASTKAQVGEAFINLGITPGDGGAWFMQRLIGYQRAAELTFTGRIVKADEALQL
FT                   GIFLEVVEPEELMPRAMELAGQIAAKPPLTLRLTKRMMKLAQRSELPDFLDLCACFQTM
FT                   AHHTEDHLEAVNAFLEKRPPSYRGR"
FT   gene            299835..301010
FT                   /gene="bamN"
FT                   /locus_tag="Geob_0243"
FT   CDS_pept        299835..301010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamN"
FT                   /locus_tag="Geob_0243"
FT                   /product="thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18615"
FT                   /db_xref="GOA:B9M957"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B9M957"
FT                   /protein_id="ACM18615.1"
FT                   /translation="MSEVFIVESLRTPLGSFGGALADVDAPRLAAAVIKELLERAALSP
FT                   EAVDEVIIGQVLSGGSGQAPARQALRYGGLPDSVPAMTINKVCGSGLKAIMLGADAIRL
FT                   GDAHVVLAGGMENMSQAPYALPKARNGFRMGNGEVVDLMVNDGLLDPYSGNHMGVIAEA
FT                   NAAKNGLSRAEQDEFAVASYKKAQAAVKDGVFKDEIVPVVKKGRQGEVVIAEDEEPLKG
FT                   DIGKLPGLRAAFAKEGTITAGNASTINDGAGIALLASGEAVKKYNLKPKARLLAYATNS
FT                   IHPDLFTEAPVGAIEKALVKAGLKVGDIDLFELNEAFATVPLLAIKKLGIDPARVNVNG
FT                   GAVAIGHPLGASGARLAATLIRELHKRNARYGLATLCIGGGEAVAAIFERV"
FT   gene            301131..301976
FT                   /locus_tag="Geob_0244"
FT   CDS_pept        301131..301976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0244"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18616"
FT                   /db_xref="GOA:B9M958"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M958"
FT                   /protein_id="ACM18616.1"
FT                   /translation="MIKKVGVLGAGQMGSGIAHVLAVQEIEVVLFDIAEDQLAKAVAGI
FT                   EKNLERQAKKGEVDSASIPAILKRIHTTKVMGDLSDCDMAIEAVTERETLKLDIFRQLD
FT                   GIVKKGAILASNTSSIPITRIAAVTGRPDKVIGMHFMNPVPVMKLVEVIRGLATSDETF
FT                   DATAALVAKLGKEMAVSADYPGFIVNRILIPMINEAAFALFEGVATVEDIDKAMKLGTN
FT                   QPMGPLTLADFIGLDTCLAIMNVLYEGFKDTKYRPCPLLVKMVEAGYLGKKAGRGFYTY
FT                   "
FT   gene            302131..302913
FT                   /locus_tag="Geob_0245"
FT   CDS_pept        302131..302913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0245"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18617"
FT                   /db_xref="GOA:B9M959"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9M959"
FT                   /protein_id="ACM18617.1"
FT                   /translation="MEYRNLLIEKHGAVAALTVNRPTVLNSLNSAVLDELLAAFSSLGQ
FT                   DEGVRAIVLTGSGEKAFVAGADIAEMADLSAMQAQEFSRKGQQLVNLIGRLAKPVIAAV
FT                   NGFALGGGLEMVLACDFAYASENAKLGLPEVTLGIIPGFGGTQKLARLIGRSRANELIF
FT                   TGRMLTAAEAKDWGVVNAVFPGGELVAKAMETAAKIAANGQLGVAHAKDAVKSGLDMAE
FT                   ADGMNYESVHFGALFSTADQREGMRAFLEKRKPVFSGR"
FT   gene            302947..304935
FT                   /locus_tag="Geob_0246"
FT   CDS_pept        302947..304935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0246"
FT                   /product="electron transfer flavoprotein-associated
FT                   cytochrome b and CCG domain pair iron-sulfur
FT                   cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18618"
FT                   /db_xref="GOA:B9M960"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B9M960"
FT                   /protein_id="ACM18618.1"
FT                   /translation="MEATRELYWNIGHGALVLLPMYLFTFVALGLLVKSGLKRLDIYRQ
FT                   GKPLDRFGNRGERIANLLKNVFLQSRVLMVKGPGYAHGLFFWGFFVLFVGTILVALQAD
FT                   FTDLLFGFRFLDGEFYKLFSLALDLAGLAAVVMLAGLFVRRYLVRPKGLETSRDDAIMH
FT                   GLLFAILITGFVIEGARMAVNELPNDPALAAWSPVGLMIAKALAGMGEPSLRALHQGLW
FT                   WVHFFLVIGFICAIPFTKFRHIFTTAANYFFADLGPKGALVTLDMEGDAESFGTANLKD
FT                   LTWKDIFDTDACTKCKRCQDRCPAHNTDKPLSPMKVINQLGEVACTNPEANLIETVSKD
FT                   ALWSCTTCRACQEICPAAIEHVGKVVDMRRNMVLMEGEFPGEEVMAAMDNTEVNGNPLG
FT                   MAMASRGDWAEGLPVKKMAEDADVDILYFVGCYASFDKRNIKIATSFIHLCAAAGIKVG
FT                   ILGKEEKCCGEPMRKMGNEYLYQSMAAENIETIKGYGVKKVVTACPHCFNTLAKDYRDL
FT                   GFDVETEHYTVFLNRLVEEGKLKLKAETFDCTYHDSCYIGRYNDLYKEPRALISAAGGT
FT                   IREMDKSGAESFCCGAGGGRIMAEEKLGSRISVSRAKMAAGTGAGMLVSNCPFCMTMFE
FT                   DGIKGAELEGQLVPRDIGEILLERLTL"
FT   gene            305151..306317
FT                   /gene="sucC-2"
FT                   /locus_tag="Geob_0247"
FT   CDS_pept        305151..306317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC-2"
FT                   /locus_tag="Geob_0247"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18619"
FT                   /db_xref="GOA:B9M961"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:B9M961"
FT                   /protein_id="ACM18619.1"
FT                   /translation="MNIHEYQAKAILREFGVPVPDGHVCYNGASAREWAKRLSEGPWVV
FT                   KAQIHAGGRGKGGGVKLARTADEVRNTARDMLGMILRTHQTGPEGKVVTRVLVENGCNI
FT                   GTELYISLLVDRATSKVTVMASTEGGMDIEEVAAKTPEKIFREAIAPLVGLTPFQCRNL
FT                   AFSLGLTGKLTNKAVKLLQGLYETFIGCDCSLLEINPLVVTKEGDLLCLDAKFGFDDNA
FT                   VFRHPKIGDMRDYDEEDPNEVEASQHDLSYVSLAGNIGCLVNGAGLAMATMDIIKHSGG
FT                   NPANFLDVGGGATIERVTEAFKIILSDKNVKGILVNIFGGIMKCDVIATGVIEAAKQVS
FT                   LKVPLVVRLEGTNVDKGKEILSASGLNIIAADGMADAANKIVQAVAAA"
FT   gene            306331..307203
FT                   /gene="sucD-2"
FT                   /locus_tag="Geob_0248"
FT   CDS_pept        306331..307203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD-2"
FT                   /locus_tag="Geob_0248"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18620"
FT                   /db_xref="GOA:B9M962"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M962"
FT                   /protein_id="ACM18620.1"
FT                   /translation="MSILIDKNTKVITQGLGATGLFHANGARDYGTQMVGGVTPGKGGT
FT                   TIEGFPVFDTVKEAVYKTGATASVIYVPPPFAADAIMEAVDAGIDLVCCITEGIPVLDM
FT                   VKVKQYMQGKRTRLVGPNCPGVITPGQCKIGIMPGYIHKPGKIGVVSRSGTLTYEAVWQ
FT                   LTNVGLGQSTCVGIGGDPVNGSSHLDVLKMFEEDPGTEAVIMIGEIGGTSEEEGAYFVK
FT                   EHMTKPVAAYIAGVTAPPGKRMGHAGAIISGGKGTAAEKVAVLEDCGIAVAASPADMAQ
FT                   ALLKVYKPK"
FT   gene            307349..307537
FT                   /locus_tag="Geob_0249"
FT   CDS_pept        307349..307537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0249"
FT                   /product="transcriptional repressor, HgtR-related"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18621"
FT                   /db_xref="UniProtKB/TrEMBL:B9M963"
FT                   /protein_id="ACM18621.1"
FT                   /translation="MGLYKENPRYKCVSARLSDDEWEDLMIVCGQKRTSMSECIREALT
FT                   ALLMENGLRGERAETAG"
FT   gene            307729..308541
FT                   /gene="etfB-2"
FT                   /locus_tag="Geob_0250"
FT   CDS_pept        307729..308541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfB-2"
FT                   /locus_tag="Geob_0250"
FT                   /product="electron transfer flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18622"
FT                   /db_xref="GOA:B9M964"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B9M964"
FT                   /protein_id="ACM18622.1"
FT                   /translation="MLVISCIKQVPDTTQVKIDPVTNTLVREGIPFIINPYDTHALEES
FT                   LNLKDRFGLRAVALSMGPPNTEATLRKAAALGVDEAILLSDRAFGGADTLATSKVLSAA
FT                   IERLNDQEEVGIVFCGKQTIDGDTAQVGPGIATRLGFTQLTLVDRIESLDLVKKKIRVR
FT                   RKLEGRHEIVEAPLPVMITVVRELNRPRYPTVPMRLMAQETEVKVWDNSILKLDATTVG
FT                   LKGSPTWVSKIFSPERDQGEIIGDGINDPVGTANLLIDKMVDKDMLAV"
FT   gene            308596..309945
FT                   /gene="etfA-2"
FT                   /locus_tag="Geob_0251"
FT   CDS_pept        308596..309945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfA-2"
FT                   /locus_tag="Geob_0251"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18623"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B9M965"
FT                   /protein_id="ACM18623.1"
FT                   /translation="MTEAKKPMKKPRGKARVVEGKCIACGARCESSCPVNSIEMSDGGE
FT                   PAVLAEKCIGCEKCIKVCPASALEMFYSPEDLELLKQWDKEHGPAGEEISDEEKQLREM
FT                   LARYRGVWVFIEQYDGEAAKVSWELLGTGAGLAKTLGVELSAVVIGDHVGHICGEAFAY
FT                   GADQAILLDSPVYANYRTQPYADAICHLVEKHRPEVILMGATGQGRDLAGAVATVVKTG
FT                   LTADCTGLGIDDKRNLMQTRPAFGGNIMATIMCDKFRPQMATVRPHVMQMPERKEGRIG
FT                   RVVRETFAPREEDVLVKVIEVLNDKDGKDQVDVAAAEIIVSGGRGLMNKENFSMLQQLA
FT                   DELGGVVGASRSAVDAGWMPHGRQVGQTGKTVRPKIYIACGISGAIQHMVGMQDSDVII
FT                   AINRDPEAPIFQIATYGIVGDLFQVVPALIGRVRSMKSQRGGTEPERVAV"
FT   gene            309982..311964
FT                   /locus_tag="Geob_0252"
FT   CDS_pept        309982..311964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0252"
FT                   /product="electron transfer flavoprotein-associated
FT                   cytochrome b and CCG domain pair iron-sulfur
FT                   cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18624"
FT                   /db_xref="GOA:B9M966"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B9M966"
FT                   /protein_id="ACM18624.1"
FT                   /translation="MSNTTIFIPLFIVASLTFIYSCYQRLQLVAVGSAEERLDNPLSRL
FT                   AGTFAYAFGQKRVLARPYGVNHFFLFWAFMFLLVANVEFLLEGLFPGISLSALPAPLYH
FT                   VLELIFDLVSLVALACVAVAFIRRLFFAPAYLENDYTKARSGEALLILAMIATLMLAFF
FT                   FMNGAKLVQGGDGIWQPVSAFFGSLLVGLPPSALESVAGAAWWVHAVVLLVFLNLLPRS
FT                   KHMHILTAIPNCYFRSLEKPNVQPRETFKKGERYGVSQVEQFTWKDLFDSMTCTECGRC
FT                   QDLCPAHNTGKPLNPRRIVHDIKLNLFGNASALKEAQQGKTPLIGEAGEGTISEEALWS
FT                   CTTCGACLSVCPVLIEHMPKIVKMRRHLVEEKAKFPEELLNLFENMEQRSNPWGIAPSE
FT                   RTKWSTQLGERPFKAGETEYLFFVGCAGAFDSRNKHVTVALATLLDAAGVTWGILGKDE
FT                   KCCGDSVRRLGNEFVFDRMASENVATFKERGVTKIVTQCPHCFSTLKNDYRQYGLEVEV
FT                   LHHSQLIAQLVRDGKLKAAKAANMGKVVFHDSCYLGRHNDTFEAPRQVIAAATGQAPGE
FT                   FGRNRESAFCCGAGGGRMWMEEQTGTRINLERVKEALQQQPDTLCVSCPYCMTMLEDGL
FT                   KDEGANQVRVKDIAEVMAESLRPNA"
FT   gene            312083..312916
FT                   /locus_tag="Geob_0253"
FT   CDS_pept        312083..312916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0253"
FT                   /product="helix-turn-helix transcriptional regulator, IclR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18625"
FT                   /db_xref="GOA:B9M967"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9M967"
FT                   /protein_id="ACM18625.1"
FT                   /translation="MAKNVKKKNYTIRSVSNAFDLLEQFHGDVSEMGLTDLSQNLQLTK
FT                   NNVFRLLATLQSRHYVEHDSHTEKYRLGFKTVELGQTVIRQRGRLNNSREIIEELVKEC
FT                   NETVCVSVMKDFCSVNLDVVECDHPLRVIPRIGVRLPAYCTAAGKSQIAYFADDILKKY
FT                   LSENQLQPHTENTIIIPEQLKRHLREVASQGYAIENEELDIGVVSVAAPIRDYMSRIIG
FT                   AVTLLGPSQRLSTKLMESTFIPLVMKGAGEISAKLGYCGGQAEEIHPVLLGRAQG"
FT   gene            313103..313441
FT                   /pseudo
FT                   /locus_tag="Geob_0254"
FT                   /note="hypothetical protein; internal stop codons"
FT   gene            313669..314073
FT                   /locus_tag="Geob_0255"
FT   CDS_pept        313669..314073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0255"
FT                   /product="N-acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18627"
FT                   /db_xref="GOA:B9M969"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9M969"
FT                   /protein_id="ACM18627.1"
FT                   /translation="MNIEYKYTQDFEQSQLQDLFLSVQWSSGQYPDKLQIAMKNSDCVI
FT                   SAWHGDTLVGLINALSDGVMTAYFHYLLVRPEYQSQGVGKQLASLALSKYNDYARKVLI
FT                   AYDKEVGFYQGLGFEIGTGKTPMFVTYLTT"
FT   gene            314099..314977
FT                   /pseudo
FT                   /locus_tag="Geob_0256"
FT                   /note="transposase, Y1_Tnp domain-containing; C-terminal
FT                   fragment"
FT   gene            complement(315068..315778)
FT                   /locus_tag="Geob_0257"
FT   CDS_pept        complement(315068..315778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0257"
FT                   /product="PilZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18628"
FT                   /db_xref="GOA:B9M970"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:B9M970"
FT                   /protein_id="ACM18628.1"
FT                   /translation="MESLKVLVVSREGEAMDAYGLALEQIGVNYDVASSFRHLSSMVRK
FT                   EAYNGMIVDMLTLVRAGKDEKRIAYELMNFFPATHVKWDTRHKSISLSLLGQMSETESV
FT                   AALRTFIEEKCRPFRSRRLRMYPRKELILNILLSPDPSFPEGLTEKTFTVNVSKGGCFL
FT                   HTVGPLENGQTVWLKIHEFSDQTPIKAVICWKLAWGEQLTIPGIGVKVEETTPMQMTEL
FT                   SKLLQSKCPGAREG"
FT   gene            316328..319168
FT                   /locus_tag="Geob_0258"
FT   CDS_pept        316328..319168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0258"
FT                   /product="sensor histidine kinase response regulator, PAS,
FT                   PAS and PAS domain-containing"
FT                   /note="domains: PAS, PAS, PAS, HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18629"
FT                   /db_xref="GOA:B9M971"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M971"
FT                   /protein_id="ACM18629.1"
FT                   /translation="MNAKISPGTLTLPAPSPLRSILVLLLVLFFVEMLLMFSFSHLLPS
FT                   RSIIITNITDAALLTLFCSPFIYWLIFQPFKKMALMQEALAENVLGQVVDGVVLFDEEK
FT                   TIRSFNPAAEKIFGYLAQEVLGCNLQLLFESACGSGGSEGIGAAISKDTSINREYTGKR
FT                   RDGSHCHLDISISKVRVGDSWMHMGIVRDLSEQKRAEAEYQAILRTAMDGFWITDEKGG
FT                   FLDVNDTYCQMTGYSRQELLAMQIGDVEAVLTAEEIKARMESIRNPGRIRFETRHRRKD
FT                   GSSFDVEVSANYLPAGGGRFFAFLRDITCRNEMLGTLAKSEEKYRTLADNVTVGVTLIS
FT                   PKMEIISANRQSRQWYPELDEKYSPICYKTFNNPPRDSICPDCPTVKTLADGGIHEAVV
FT                   TNPWKGVARHFRIVSSPIKDNAGNITGVIESVEEVTALKRSEDEYSEALSRLTATLEAT
FT                   ADGILAVDLNGRIVSYNQKLVQMLKIPGHILETDDFYLLIANIYSQLKGHDKLVRAEFE
FT                   GDADRDFHDLLEFKDGRVFERFCRPQRIGDTIVGRVSSFRDITGERKMEAQLRHAQKME
FT                   AIGTLTGKVAHDFNNMLTAIIGYCHLSQMQIHSNDPLMQNIRQIITAAERAAGLTQSLL
FT                   EYSRKTPSNPQAMELNQVVRQVNGFLSRLIGEDIELVTSPADEPLVIIADAGQIEQVLM
FT                   NLATNARDAMSGKGRLIIGTATTRIGEDFLQSHGFGNPGTYALVSVSDTGSGMDEDTCD
FT                   KIFEPFFTTKPVGNGTGLGLSIVYGIVKQHNGYVTVESKKGCGTTFRVYLPLTGQAPHE
FT                   KVEKPTLPAKMGGETVLVAEDNSEVKALLEDVLQGYGYSVVTALDGHDCVESFRKKRDD
FT                   IDLIIMDVMMPRKNGKEAYAEIEKLKPGMKVIFISGYTGDILHSADLAEENLNFLAKPL
FT                   SPNRLLTKVREVLDRD"
FT   gene            complement(319173..320348)
FT                   /locus_tag="Geob_0259"
FT   CDS_pept        complement(319173..320348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18630"
FT                   /db_xref="UniProtKB/TrEMBL:B9M972"
FT                   /protein_id="ACM18630.1"
FT                   /translation="MSADHLPPTTRKSVYKCHFIILLLCFFILPTEAIGEIDPERRTNM
FT                   EVGFAGPLYNNGPLGGYGMVLFNRPHFRDQDTYLLAILSPYLFAEVIRDKWPAEGHALG
FT                   FSIGGGFLINDFDQVRDGSYVRRESFRGHGADTAFSYYLRPPPIGGELPVDGILRFASR
FT                   YAIYQRSGDTDPAYLLPADSFVHSVKVGVRVGGVPPELLPEKALEVSLWHQVDYRVKTG
FT                   LHGLPGQRQETEHLTQQTWGSLGGTMPLWREQSGSVMMSAGTSGRTDEFSCYRMGSGLR
FT                   FQDEVPLILHGYYFREIFARSFFLLNTSYRFAPIPAMERLQLQLNYDYALIGYLPGHDL
FT                   PRSSLNGLGADIILRFPDDITLVMGYGYGVDGPRHGGFGGHQINVMFEWKM"
FT   gene            320551..322755
FT                   /locus_tag="Geob_0260"
FT   CDS_pept        320551..322755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0260"
FT                   /product="aldehyde:ferredoxin oxidoreductase,
FT                   bis-(molybdopterin)-oxotungsten-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18631"
FT                   /db_xref="GOA:B9M973"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B9M973"
FT                   /protein_id="ACM18631.1"
FT                   /translation="MHYEATKLNHGYAGRILTIDLPSRAIEAPMLDEHVRDYFLGGRGL
FT                   GLYLLHQSVTSTTRATDPENPLILANGPLGGIPQFPGTAKAMAVSLSPITGVPGVSNFG
FT                   GYFGAFLKYAGFDALKVTGKAGRDVMIIIDGLKHQVAVEEIAHLDEAFDLERMIDERYT
FT                   GLGIDRRHIAFMSTGIGADHTTFGCINSHYFDMTKPTPNGRGIYRTKQAGRTGIGSVMS
FT                   GKGIRAIVVLAAYPQGENPYGAADWERAKDAGKRLHQVVKEVDPTSLRMSRKGSAGLIT
FT                   FMSKDEYQSLPVNNFQAGSDPRAPQICGSHYEEHLFEHRGMDGCFPGCNLQCNKGGWVT
FT                   LVSGAHKGSRVWVDGPEYETAAGFGSNLGIWNPEFILEANWHCDNYGIDTISTATILAF
FT                   VMECFQRGFLTSAAADGLELAWGNEGAALEFIHRLARGQGELYKQAGGGMLPLVDWVAA
FT                   GCKAKTGRDVRGELDLFAMQTKGLPFSFYRTHRSLSMQGSYAAASDIGAHHAAAWLIKA
FT                   DLLGAFPTFEEKAWALISYPRVRLGNDNLGLCKLPWVDVFNPESARRTDTDIHINPASQ
FT                   EIYADFFNSMLGTDMSWEEIFAQTDRDINLQRVMNVVRFGDKTRAYDWIPDRAIGPTDD
FT                   ALYEGEGDYNDGEVAGILGVSSEEVAAMATSRKRIVLMDYRKQELQRLIDVYYAERGWN
FT                   RAGIPFIDTLQELGLWSYLTAETQAKIAGLQEIVEIVAPA"
FT   gene            322822..323286
FT                   /locus_tag="Geob_0261"
FT   CDS_pept        322822..323286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18632"
FT                   /db_xref="UniProtKB/TrEMBL:B9M974"
FT                   /protein_id="ACM18632.1"
FT                   /translation="MKKIVAVTAGLALLAFAGVASAAEINADFSPTDAIMKKEQALKEQ
FT                   AAKKEADLKAKQTEAAEKAKKQEADLKAKKTELTDKAKKKETELKDAKKKQDEKSAESK
FT                   KKRQEQIDAAKKKKQERIDALKKKKEQTVKDVKDAKEQTRKDINELKEVK"
FT   gene            complement(323368..325329)
FT                   /locus_tag="Geob_0262"
FT   CDS_pept        complement(323368..325329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0262"
FT                   /product="sigma-54-dependent sensor transcriptional
FT                   regulator, GAF and PAS domain-containing"
FT                   /note="domains: GAF, PAS, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18633"
FT                   /db_xref="GOA:B9M975"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9M975"
FT                   /protein_id="ACM18633.1"
FT                   /translation="MAPKKLLTMQKTWHRYVETHELDVQLLRPEVASSWQRCRHLNVNP
FT                   FQEADGHVNQLELRERIYHKQHLLKVARPFMDNLYNFVKGSGFQVVLTDELGYLLEVLG
FT                   DNEIVNRTRQVLLCPGGNWSESQQGTNAIGTAIVEKKPVQIYAWEHYCKSNHFLTCSAA
FT                   PIFNPEGEAIGILDISGDYRVANAHTLGMVVAAVNAIENQLRLQKATDKLYMAYRYSNT
FT                   LLENMSDGLISINNNGIITEMNAKAGEILGCNPTLAKGRHVEQIYNARNTLLQVLSEGT
FT                   EYEDREIIIEKLGRKIYSSATLLRDDTGGTIGAVAVFREMNNRQPVRRPTILQSHCYTF
FT                   DNIIGASPAITAVKEWAKLAAASLSTVLIRGESGTGKELFAQAIHHASPRGDRQFIALN
FT                   CAALPESLIESELFGYEEGTFTGARKGGQAGKFEVADGGTLFLDEIGDMSANVQAKLLR
FT                   VIQEKKVSRIGSANERPVDIRVIAATHKDLAEEVRGGRFRQDLYYRLNVLEINIPPLRE
FT                   RREDLPVITAHLIEKMAAKLGRDVPAVGNSFMEKVVSHGWPGNIRELENAIERAVIRAG
FT                   IGGVLTAELLEMQAAQAVKPVIAAPVVKEIRSLREVECDMIVDALAFYQGNIQKAAAKL
FT                   GIGRNTLYRKMREFGISF"
FT   gene            325567..326730
FT                   /locus_tag="Geob_0263"
FT   CDS_pept        325567..326730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0263"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18634"
FT                   /db_xref="GOA:B9M976"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B9M976"
FT                   /protein_id="ACM18634.1"
FT                   /translation="MEPSEFQLRKFVAPEFIFGIDARKLAGRYARNFGARKVLVVTDPG
FT                   VIAAGWTEEILASLRSVDLDYTLFSAVTSNPKAEEVMVGAELYRSSGCNAILAVGGGSP
FT                   MDCAKGIGIVSSNRRHVLEFEGVDKVDIPTPPLICIPTTAGSGADVSQFAIITDTGKKV
FT                   KIAIISKTLVPDVALIDPVVTTTMPAALTAFTALDALCHSIEAFVSTAHSPITDVHALH
FT                   AMQLVTANLLPTLKEPDNMVRRGRMVLGSLQAGLAFSNASLGAVHAMAHSLGGFLGCAH
FT                   GECNAILLPHVIDYNFESMSERYLEVAKSIGLNVEGMPPANGKNALTSFLQQLIREAGV
FT                   PYCLGQLGISRDDIPELAKKAMNDPCIFTNPRQMRQRDIEAIYDKAF"
FT   gene            326714..327946
FT                   /locus_tag="Geob_0264"
FT   CDS_pept        326714..327946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0264"
FT                   /product="sensor phosphatase, sensory_box and SpoIIE
FT                   domain-containing"
FT                   /note="domains: sensory_box, SpoIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18635"
FT                   /db_xref="GOA:B9M977"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B9M977"
FT                   /protein_id="ACM18635.1"
FT                   /translation="MTKPSDAGEDWDAQREKIIGLGERSLRKTYYPELQQKLDELERFR
FT                   SLLDESNDCIFLFQVPSFAFVDVNESACRQLDCPREKFLSLSLENLVPVEDLLRIRQLA
FT                   TAAITDGRDKGTIMTQLNKCSGGEFPAEITIRIVNLNKACYGVAVARDITERLQAQKVL
FT                   LENSRMLRDMELARQIQLSLLPGAPPRVPGVRLAGCCVPATHVGGDYYDYYIREKGTLD
FT                   LVVADVSGHSIGAALMTAEARSVLRAQFHSSPSAGKLLAYLNDVLYDDLNRAGLFITLF
FT                   YVKYDPESRMLAYANAGHVSPLLLRPPEVSCRKLDAEGLIIGVREDETYEEKELQMQPG
FT                   DLLVLYTDGITEAQNSAGEMFGFSRLCSIVSAISSNPPEDVVSIVLEQLAGFTGTTALE
FT                   DDVTMIVMKVI"
FT   gene            complement(327930..329072)
FT                   /locus_tag="Geob_0265"
FT   CDS_pept        complement(327930..329072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0265"
FT                   /product="BioD and DRTGG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18636"
FT                   /db_xref="GOA:B9M978"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:B9M978"
FT                   /protein_id="ACM18636.1"
FT                   /translation="MCRKIFIAATGQNTGKTTISLSLVHLARQRYKRVGFIKAIGPKCQ
FT                   EFNGCIVDKDAALMARVFDMEEDIRLMSPVVLGRGSTKRFLDGQLTTAELEGRLLAACR
FT                   EMERKYDFLVIEGAGHGGVGSVVGLSNGRVASLCNAPVLMVSGGGIGNVIDSVLLNLPL
FT                   YRAEASPVRLLMVNKLLPEKREISLGYLTKAFAPLHLPVTAAFDYSPILANPTLNHIAR
FT                   LLDHPLCGDGAARSRIVHHVQLGAASSQKVIDLLAQSTLLITTSSRDELIVTLSSLYHI
FT                   PAYREKIAGLVIPGQAPVSAITQRILDASGIPYIRIFQSTADVFSTITGHISKISVEDE
FT                   EKIELICSSAEKVIDFDGIDRIAEEGLGANEGARRLRSLS"
FT   gene            complement(329123..330463)
FT                   /locus_tag="Geob_0266"
FT   CDS_pept        complement(329123..330463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0266"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase, DUF4008-related domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18637"
FT                   /db_xref="GOA:B9M979"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027586"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:B9M979"
FT                   /protein_id="ACM18637.1"
FT                   /translation="MQNCTAAMTLEQRYPAVDSALLPYPSRLFVETTSRCNLSCVMCMK
FT                   QNDGGTGDGDLDMGTFSALEPALPNLNALVLNGVGEPLLNSRLEQFITRAKKLMPSHGW
FT                   IGFQSNGLLLTNMRAMTLLDAGLDRICLSMDGVDSTTFGSIRTGSQLLDLQWAFEALAA
FT                   ARTVCGRHDLEIGVEFVVMRDNIRELPPALEWAAARGASFAIVSHLHPFHEPHLEQCAY
FT                   DTCTDEAIQIFQTWKSKADTIGVDMLSYFRILWKYAKTADEQQVVDFVDAMKTDAGDRG
FT                   ITLDLKRLFAMDYSQIGVTMAVFDEAMRVARRVGLDLRLPEVVRREKRGCAFVEQGGAF
FT                   VSWDGKMHPCYHLWHRCQSFANGWLHPIKPRSFGNVSQRGILEIWNSCEFRTFRENVLH
FT                   HDYPSCSGCNCSPCDLVQKDEFERDCYVNTEPCGSCLWSSGVFRCLD"
FT   gene            complement(330588..330782)
FT                   /locus_tag="Geob_0267"
FT   CDS_pept        complement(330588..330782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0267"
FT                   /product="transcriptional repressor, HgtR-related"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18638"
FT                   /db_xref="UniProtKB/TrEMBL:B9M980"
FT                   /protein_id="ACM18638.1"
FT                   /translation="MARKYNNPRKPYIVSMRVTDEEMDKFRQIMEMTNLSAADLMRDAF
FT                   TLLRQQWELSHGTDMSLHI"
FT   gene            331287..332450
FT                   /locus_tag="Geob_0268"
FT   CDS_pept        331287..332450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0268"
FT                   /product="ethanol dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18639"
FT                   /db_xref="GOA:B9M981"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B9M981"
FT                   /protein_id="ACM18639.1"
FT                   /translation="MALAEQTYGFFIPTVSLMGIGCSKETGAQAKALGATNLLIVTDAG
FT                   LSKMGVADKIKAQLVEAGLKAVIFDGAEPNPTDKNVHDGVKVYLDSKCDGIVSLGGGSS
FT                   HDCGKGIGLVIGNGGNIRDFEGVNKSTKPMPPFLAINTTAGTASEMTRFCIITNTDTHV
FT                   KMAIVDWRCTPNIAINDPVLMVGKPPALTAATGMDALTHAVEAYVSTIATPITDACAIK
FT                   AIELVAANLSVAVANGDNLEARDAMAYAEYLAGMAFNNASLGYVHSMAHQLGGFYNLPH
FT                   GVCNAILLPAVSQFNLIACPKRFADIAVALGENIAGLSVTEAAEKAISAIRKLSASIGI
FT                   PAGLKELNVKEEDLKIMAENAKKDACQLTNPRKATLEQVIDIYKAAM"
FT   misc_feature    complement(332622..332652)
FT                   /note="conserved nucleotide sequence; Geob_R9001"
FT   misc_feature    332724..332766
FT                   /note="conserved nucleotide sequence; Geob_R9036"
FT   gene            332814..334544
FT                   /gene="aorA-1"
FT                   /locus_tag="Geob_0269"
FT   CDS_pept        332814..334544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aorA-1"
FT                   /locus_tag="Geob_0269"
FT                   /product="aldehyde:ferredoxin oxidoreductase,
FT                   bis-(molybdopterin)-oxotungsten-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18640"
FT                   /db_xref="GOA:B9M982"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B9M982"
FT                   /protein_id="ACM18640.1"
FT                   /translation="MDKILRVNMTDLTTRTEPVPAAWAGLGGRALTSTIVAAEVPATCH
FT                   ALGENNKLVFAPGLLTGTPAANSGRLSAGAKSPLTGTIKESNAGGTAAQMLARLGVKAL
FT                   IIEGLPKADKWYSLHVSKDGVTVQEESELIGKGNFAVIEALEARLGKKTGILTIGPAGE
FT                   LKMTAANISVKDPDSKIRSHGRGGLGAVMGSKKIKFITINDEGAPGVKIADPEKFKVAA
FT                   RTFAKALLDHPVSGEGLPTYGTNVLVNILNEAGGLPTKNFTLGQFEGHDKISGETLHDT
FT                   IVARGGKPKHGCHAGCIIQCSQVYHDKDGKYVTSGFEYETIWGLGADCCIDNLDDIALA
FT                   DNIMDDIGVDSIETAVMFGVAMEAGILSFGDSKEMLRLLRDEIGTGTPLGRILGGGAAS
FT                   VGKAYGVTRVPVVKNQAIPAYDPRSVKGIGITYATSTMGADHTSGYTIATNILNVGGFV
FT                   DPLKKDGQVELSRNLQIATAAVDSTGMCIFVAFPALDIPECLPALIDMINARFGISLTG
FT                   DDVTDLGKQVLKTERQFNIEAGFTKEHDRLPEFFKTEPVAPHNAVWDFSDEEIDEFWNF
FT                   "
FT   gene            334613..334837
FT                   /gene="moaD-1"
FT                   /locus_tag="Geob_0270"
FT   CDS_pept        334613..334837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaD-1"
FT                   /locus_tag="Geob_0270"
FT                   /product="molybdopterin biosynthesis sulfur carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18641"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B9M983"
FT                   /protein_id="ACM18641.1"
FT                   /translation="MNITVKLFATFRNGRFKIDNQEWPEGTDCRRIVASLGLTEEEIGI
FT                   VLINGRHVPLEQQLAQADTLSLFPLVGGG"
FT   gene            334839..335687
FT                   /gene="moeB-1"
FT                   /locus_tag="Geob_0271"
FT   CDS_pept        334839..335687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeB-1"
FT                   /locus_tag="Geob_0271"
FT                   /product="molybdopterin biosynthesis sulfur carrier protein
FT                   sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18642"
FT                   /db_xref="GOA:B9M984"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B9M984"
FT                   /protein_id="ACM18642.1"
FT                   /translation="MDAVLQYLWSKAEGDLVPWSAQSEAVRQFGLSYGQVESLILEKGL
FT                   LPARYQRNRTTVSTIEQRQLFNSRVAVIGCGGLGGYIIEELARLGVGQIVAIDPDIFEE
FT                   HNLNRQLFSSPHALGKPKVEAAAARVSEINPAVNLVPVQEAFTTANGKQLLQGVTVAVD
FT                   ALDSIAYRLELAEVCSEMDIPMVYGAIGGWYGHVATQLPGDTTIQRTYRNWVEGKGIEK
FT                   QLGNPSFTPAVVASLQVAEVCKILLGKGELLRHRKLSIDLLEMEIFDVSYAALAELVRA
FT                   A"
FT   gene            335762..336190
FT                   /gene="mop"
FT                   /locus_tag="Geob_0272"
FT   CDS_pept        335762..336190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mop"
FT                   /locus_tag="Geob_0272"
FT                   /product="molybdate/tungstate-binding protein, molbindin"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18643"
FT                   /db_xref="GOA:B9M985"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B9M985"
FT                   /protein_id="ACM18643.1"
FT                   /translation="MNISARNLLSGKVTTVRKGAINSEVELSLDGGETIAAVITNASLE
FT                   EMGIKEGMEAFALVKAPLVIIAKGNTGLKFSARNVLQGTVKKIAQGSVNAEISIQLQGS
FT                   GIITSIITKGSVAAMALQEGDQVSAIFKASSVILAVKA"
FT   misc_feature    336520..336562
FT                   /note="conserved nucleotide sequence; Geob_R9037"
FT   gene            336679..337920
FT                   /locus_tag="Geob_0273"
FT   CDS_pept        336679..337920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0273"
FT                   /product="phosphate-selective outer membrane channel"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18644"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B9M986"
FT                   /protein_id="ACM18644.1"
FT                   /translation="MKKRSLAATVVAMGLVLIPGVHAKTLEDVLKEKGVITEEDYKEVT
FT                   RSKALNYKPGKGFTLTSADEKFQLSLGGRLQTRYTFTDADDNGTSRDSNKFEVKRMKFW
FT                   LNGYAYTKDLTYLLQVDFVQGGSSKLLDHAYLNYRFVDEAQVLAGQTKVPFGRQWLNSS
FT                   GSQQFVDRSTASDMFRPGYEAGVKVHGAVAGGIATYELGYYGGAGQSTFRTSNDNAYAA
FT                   RITANPFGKMAYAEGDLDQSEKPLLSVGANYYRNTLQKSTATAFETNNVTLAGSTGWLG
FT                   KGIGTFANGEKIDINGYGVDAAFKWLGASTQAEYLLGQADGHTSDKTLRAHGFYAQAGY
FT                   CIIPRKLELAFRYSFVDPNRDKANDQQVDTQGAISYYFNKHNLKLQGDVTNSHDQSKGR
FT                   TDDMIYRLQAQVIF"
FT   gene            338043..338855
FT                   /gene="tupA"
FT                   /locus_tag="Geob_0274"
FT   CDS_pept        338043..338855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tupA"
FT                   /locus_tag="Geob_0274"
FT                   /product="tungstate ABC transporter, periplasmic
FT                   tungstate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18645"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B9M987"
FT                   /protein_id="ACM18645.1"
FT                   /translation="MKQWRILLLTLTSLAFFCASAGAEERLKMSTTTSTQDSGLLKVLL
FT                   PPFEKKNNCQVDVIAVGTGQSLKLGEAGDVDVVFVHARKLEDKFIADGFGVNRRDVMYN
FT                   DFVIIGPKDDPAGIARAKTAAEALQMIAAKGATFVSRGDKSGTHIKEKDLWQAAGIAPK
FT                   GGWYVEAGQGMGPVITMATERRGYTLTDRGTYNAFKGKKTDLTVLFQGEKGLFNPYGVI
FT                   AVNPRKHPHVKYDLAMKFIEYVTGPEGQKIIAGYKAYGEPVFFIYGKK"
FT   gene            338874..339587
FT                   /gene="tupC-1"
FT                   /locus_tag="Geob_0275"
FT   CDS_pept        338874..339587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tupC-1"
FT                   /locus_tag="Geob_0275"
FT                   /product="tungstate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18646"
FT                   /db_xref="GOA:B9M988"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M988"
FT                   /protein_id="ACM18646.1"
FT                   /translation="MQNIIELQNVAKNYGNTIALQLNRLAIGEGELYLLAGPNGSGKST
FT                   LLNILGFLTRPDRGELLFSGERVDWKRGTMTRLRRQVTLLHQSPYLFRGNVYDNVAYGL
FT                   SLRGMGGAKAQEVVSETLATVGLDGFQLRKHTELSGGEAQRVAMARALALRPKLLLLDE
FT                   PLANVDQKSARVLEEVIAGLPSMGTTVVMSSHDPQHEKKLPCQVIQLQGGRMNADHLDE
FT                   TESLGNLLGYPAVQI"
FT   gene            complement(339653..340876)
FT                   /locus_tag="Geob_0276"
FT   CDS_pept        complement(339653..340876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0276"
FT                   /product="formaldehyde dehydrogenase-related protein,
FT                   glutathione-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18647"
FT                   /db_xref="GOA:B9M989"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M989"
FT                   /protein_id="ACM18647.1"
FT                   /translation="MKAVVWHGVGDIRLDDVAEPRIEQQTDAIVKITASAICGTDLHMV
FT                   RGTMSGMRPGTILGHEGVGTVEEVGTAVRNFKPGDRVLIPSTIACGYCSYCRDGYYAQC
FT                   DNANPNGMQAGTSFFGGPEKSGPVNGLQAEKARIPFAGVGLVKIPDGVTDEQAILVSDI
FT                   FPTGYMGAELAEIKPGNTVAIFGCGPVGQFAIASAKLFQAGRIFAVDCIPSRLEKAREQ
FT                   GAEVIDFSKEDPVQMIRDMTGGIGCDRAIDAVGVDAEAPHTGPAVREAKEHEEEFRQEV
FT                   AHVAPQTNISGDNWHPGDAPSMTLIWGVECLAKAGTFSVIGVYPESVTLFPIGMAMNKN
FT                   LTIKMGNCNHRKYIPFLLDMVRSGTVDPVRILTRREPLTSAVDAYRAFDMRQSGWLKVE
FT                   LQTREMTH"
FT   gene            341058..341333
FT                   /locus_tag="Geob_0277"
FT   CDS_pept        341058..341333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0277"
FT                   /product="protein of unknown function DUF2795"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18648"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="UniProtKB/TrEMBL:B9M990"
FT                   /protein_id="ACM18648.1"
FT                   /translation="MAPGNVGRGGGQSPANVTKNLKGISFPASKQDLIKHAQHEHADRE
FT                   VISQLQNFEEREYGSMADVMKSYGKEHQGSSRSKSSQQQSQQSKKG"
FT   gene            complement(341410..341850)
FT                   /locus_tag="Geob_0278"
FT   CDS_pept        complement(341410..341850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0278"
FT                   /product="ferritin-like protein of unknown function
FT                   DUF2383"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18649"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR019052"
FT                   /db_xref="UniProtKB/TrEMBL:B9M991"
FT                   /protein_id="ACM18649.1"
FT                   /translation="MDREEILDQLEKLIKLDVDATHAYDQAIKNMDQSIVRDKLLSFQG
FT                   DHRRHIDVLSEKMRELQGTPPDLTADFKGFFIKGFTALRSMMGTKGALQAMETNERLTT
FT                   STYEKSSGLGWPADIAAIVRSNWADEQRHLSFIREALSGGHV"
FT   gene            complement(341888..342397)
FT                   /locus_tag="Geob_0279"
FT   CDS_pept        complement(341888..342397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18650"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B9M992"
FT                   /protein_id="ACM18650.1"
FT                   /translation="MARKQSSETDVFQILRTDHQEVSKLMDKIKQADGQQKQQLFSQLQ
FT                   EELNNHMNQEEKFFYPKLEEIEDLADLVQDSYADHDDIRQILQQMNEQDFNSEEWQANC
FT                   EALEDTKDDHVDVEEEEIFPQAMELVDASVLNQIGEQIAAEKAKTVEPAAAKAPRQQKR
FT                   PPRAHA"
FT   gene            complement(342512..344260)
FT                   /locus_tag="Geob_0280"
FT   CDS_pept        complement(342512..344260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18651"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:B9M993"
FT                   /protein_id="ACM18651.1"
FT                   /translation="MKQARPGLMEVILLFIAMTTLLTAGCGGGGGGAAATPSGTASIHI
FT                   TDAPDLNYDHVWITVTEAWFHKLDTDDLTDAGWIKFPLSTPRTIDLAALTAGQTQEVWS
FT                   GLNLPAGEYGQIRVFLAPTEGPARASLPSGVTFNNEVDYTDSTGAHKVPLRIPSPGQGI
FT                   KVLPETPIIVAGGDLKLALDFNVGEDVVQIFRQGRMSSAQNLAAVPTRAKEFILKARLR
FT                   YFDMNNAGAITGTLVPPATAFGNSSSAFRNISGAFNNMSSSFRTAFQNYTGKNFTIKAE
FT                   QVNPATSLRQARRATSIDSSGRFTLYPLPVFGTATTATYDLVIRGRNVETIIINGVKVH
FT                   KGGNPQQATAVSSRPIRLTTGTEYAVDVNAKPAGAAITFYQTLPTDPVPYEIRFRHIDP
FT                   FSATGSFSTPIELSSGPLHVGAFANGGPITFNPVTPNEGLGGFRAIATAELFNASQLTN
FT                   VSSLTPLIAFTPLAISAPATARTISGKITVKDAGLDQGIMLITHGGTLVDTLDLSDKVK
FT                   VGDNPYTTGNLPGGTTAAPLPGAFYDLFVLGWSAAQPDNTTETGSATGVNLKTGNGTAD
FT                   ITMSKL"
FT   gene            complement(344281..344796)
FT                   /locus_tag="Geob_0281"
FT   CDS_pept        complement(344281..344796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18652"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B9M994"
FT                   /protein_id="ACM18652.1"
FT                   /translation="MAQQSHQFFELLKNDHRRAEQLMQQISAASREQRQEPFITLRNEL
FT                   QAHFQIEEKFFYPKLLPIQDMKALVEDALDEHQEAKDLLLQLEKIGFGAEDWQETFSKL
FT                   EDGIRHHHEDEEQEIFPKCTQFLKDQDLTDMARKSVQEKEHFLTRAAKSSSARPGARRK
FT                   PTRKEIHP"
FT   gene            complement(344844..346037)
FT                   /gene="fdh"
FT                   /locus_tag="Geob_0282"
FT   CDS_pept        complement(344844..346037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdh"
FT                   /locus_tag="Geob_0282"
FT                   /product="formaldehyde dehydrogenase,
FT                   glutathione-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18653"
FT                   /db_xref="GOA:B9M995"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M995"
FT                   /protein_id="ACM18653.1"
FT                   /translation="MKAVCWHGKHNVQVDTVPDPQILNPRDAIVKVTLSGICGSDLHLY
FT                   NGKVPTMKEGDILGHEFMGEVVEVGSAITSISRGDRVIVPFPIACGDCWYCQEGLWALC
FT                   DNSNPNSWMLEKLYGDTGAGIFGYSHLYGGYAGGQAEYVRVPFADTGLEKVPAELGDEK
FT                   VLFLTDILPTGYQAAENCNIRKGDTVAVWGCGPVGLLAMKCAWHLGAGKVFAIDRFPER
FT                   LEMARMHCKAETLNYEETDITEALHNMTGGRGPDSCIDAVGMEAQGTGFEAAYDTVKQT
FT                   LHLENDRPIALRQLIKACRKGGTISVPGVYSGFVDKMPMGAIFAKGLTLRAGQTHVQKY
FT                   LRPLMRLIETGEIDSSFLITHRMSLNDAPMGYELFDRKQDGCVKIVLRPQGTSQTVH"
FT   gene            complement(346072..346824)
FT                   /locus_tag="Geob_0283"
FT   CDS_pept        complement(346072..346824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0283"
FT                   /product="DUF2892 and SRPBCC_8 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18654"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B9M996"
FT                   /protein_id="ACM18654.1"
FT                   /translation="MEAATGATRSGLERGAKQHGKERINVGRNERTASMIGGAALAVSG
FT                   LTKLAQKRILPGMALMAAGGMFLYRGKTGHCDLFEAMGVDTAGTEDKGLSVEKVLTINR
FT                   SPQEVYEFWHNFENIPRFMRHLDTVRTTGGRTSHWKAKGPAGVTVEWDAEILEDYPGQR
FT                   ISWQSLGNADIPNEGSVEFMEAPGGRGTELKVNLSYRPPGGAAGKIAARVAHGINAQVI
FT                   EEDLKRLKQIMETGETATAAYRGSETFH"
FT   gene            complement(347036..348025)
FT                   /gene="galE"
FT                   /locus_tag="Geob_0284"
FT   CDS_pept        complement(347036..348025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="Geob_0284"
FT                   /product="UDP-glucose/UDP-N-acetylglucosamine 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18655"
FT                   /db_xref="GOA:B9M997"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M997"
FT                   /protein_id="ACM18655.1"
FT                   /translation="MPILVTGGCGYIGSHVVRQLSEAGLEVIVYDNLSTGSAEALVNGE
FT                   RLIVGELSDAEMLEQVFRAHSPKTVLHFAAAIVAPESVSDPLKYYGNNTCNTMNLLRTC
FT                   VKFGVERFIFSSTAAVYGLPEEGIASEESPTVPINPYGTSKLMSEWMLRDTSMAHGLKY
FT                   VALRYFNVAGADPEARMGQRTPDATHLIKVCCQAALGMRQQVSIYGTDYPTPDGTGIRD
FT                   YIHVEDLASAHLAALRYLENGGQSEIINVGYGQGSSVREVVEVVRRVSGVEFTAVESPR
FT                   RPGDPASLIARADYARNLLKWTPRHNNLTQIVTDAWRWEQKLFKGKLP"
FT   gene            348304..349965
FT                   /locus_tag="Geob_0285"
FT   CDS_pept        348304..349965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0285"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18656"
FT                   /db_xref="GOA:B9M998"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9M998"
FT                   /protein_id="ACM18656.1"
FT                   /translation="MNSLLIKGATLVDGSGGAACPADVLMAEGRILAVGRGNSSLPADK
FT                   VVDAAGLVLAPGFIDIHSHTDMTLFRYPLVESKAFQGVTLEVTGNCGLSFFPVAAGGER
FT                   QLAEYLALHDFCQPAGGIAWNDLASWSEAVERPGMGINVAPLVGHASLRIAAMGMESRP
FT                   PTPGELEQMQVTLKIALQQGAWGMSTGLIYPPGSYADRDELIALARTLADHGALYTSHI
FT                   RSEGEGLAAALEEAMAIGRESGVRVQISHLKAMGRSNRGHAGEILKKIAAARATGLDIA
FT                   ADQYPYAASATTLAALVPQWAHEGGASSLLLRLQAPELRAQLTAEIDSAMAAREGAAGI
FT                   MISNCRSGQNRHFSGKTIAEIADRWGCNGAAAVIRLLVEEKGEVGAIFFSMAEEDVVAI
FT                   LADPAVMVGSDGHGLNAGDASGEATHPRSYGTFTRVLGRYVRDENLLSLEAAIHKMTGL
FT                   PASRLGLSDRGLVREGYVADLVLFNPATVRDQADYADPHRYATGIVHLFVAGEPVIWDG
FT                   KLTGRRPGRVLRRLSSKKENTFRFEQAIAKGESNVP"
FT   gene            349955..351265
FT                   /locus_tag="Geob_0286"
FT   CDS_pept        349955..351265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0286"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18657"
FT                   /db_xref="GOA:B9M999"
FT                   /db_xref="UniProtKB/TrEMBL:B9M999"
FT                   /protein_id="ACM18657.1"
FT                   /translation="MSLETVPGIFWGLLGLAPLLVYIILVFRNVDILAATVICVVIGAI
FT                   LSQQTLVSLGTALAGSMGSFLALVGLIIMLGRGLGEVLNATKVSHTIVHGIIYSIGVDT
FT                   ERKAMLGIMVACLVIVGLLGTMAGGNAIIAPIVLPIAAALGLSRSTVGVIFQAVGEEAL
FT                   ILGPFSPPVITLLGLTNIGYGEMLLYVSGPVALITLAVTWLMIQRIQRNTRHLTPYEQP
FT                   EELERFEPTRQNRHATLAFTVAFVVAVIYGIAVKAPTSFVVVIMLGLSFITGFTGGLRF
FT                   EQILRHIIHGMAGNVGLFLLFLLLDPFIIFVEKAGGFAALTTLLKPMMESGGKSAIVIT
FT                   GGFLGAFGISGATVATLKLLHEMFNPLLAKYAVSMLAWSLALVVATRVHNFVFPGANMV
FT                   SSLGFAESTDMKSMLRNGWLVAACQLTFLVLFSLFFA"
FT   gene            351297..352064
FT                   /locus_tag="Geob_0287"
FT   CDS_pept        351297..352064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0287"
FT                   /product="SEL1 repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18658"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9A0"
FT                   /protein_id="ACM18658.1"
FT                   /translation="MLKNMYRIPYSNLTATCLFLLLLMAMLLFTGCVQNSGLVSYQQKD
FT                   YAGALRHFQSEGDSAGDFAAGVMHYKGEGVQRDPAEAAVWFQRAANGGHASAQFNLGLL
FT                   YLNGEGVAKDLGEAFCWFSRAAAQGDARAQYNLGLMYARGDGVAEDMAATLNWFRLAAE
FT                   QGYVKAQIYLGGLYARGEGVEKDRREAVRWFRMAAEQESTEAQVYLGVMYTKGDGVEKD
FT                   NDEAAYWLNRAARKGSITAQRYLEKLSAKTTKK"
FT   gene            352270..352473
FT                   /locus_tag="Geob_0288"
FT   CDS_pept        352270..352473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18659"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9A1"
FT                   /protein_id="ACM18659.1"
FT                   /translation="MAEKLKDKDYDLISVIYNASQAADTCNQYMRDADQEGDREARQYF
FT                   NEVLETNANLVQKGKDLLKNRL"
FT   misc_feature    352477..352664
FT                   /note="conserved nucleotide sequence; Geob_R2003"
FT   gene            352745..353278
FT                   /locus_tag="Geob_0289"
FT   CDS_pept        352745..353278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0289"
FT                   /product="outer membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18660"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9A2"
FT                   /protein_id="ACM18660.1"
FT                   /translation="MKKRVSIILLISLFVLSTVTMLAFAADKGLAGKDKDFIKKAASGG
FT                   MMEVELGQLAESKAQNPEVKNFGKRMVTDHGKANEELKTLAQQKNVTLPTKLERKHRSM
FT                   VDKLNKASAAEFDKKYMSDMVKDHKHDVDDFRKATQKVKDPEVKAWAEKTLPVLEQHLQ
FT                   QAQELAAKVGAKVK"
FT   misc_feature    353408..353558
FT                   /note="conserved nucleotide sequence; Geob_R6102"
FT   gene            353609..354388
FT                   /gene="mutM-2"
FT                   /locus_tag="Geob_0290"
FT   CDS_pept        353609..354388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM-2"
FT                   /locus_tag="Geob_0290"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18661"
FT                   /db_xref="GOA:B9M9A3"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9A3"
FT                   /protein_id="ACM18661.1"
FT                   /translation="MPELPDLTVFAENLGKRVTKKMIRSVTCGRNLRLNVSPRELAESL
FT                   QDQVIEGVERWGKEIRFLLGNGKILHVHLMLTGGFVITGKPDKVPFPQLVIGFEDDTSL
FT                   VVTDEKAMAMAALDPEKAEASPDALAVTVDELKRLISRFPKAKAKAFLIDQKVMRGIGN
FT                   AYADEILWEARISPLSLMGKLTPQTIEVLAEKIPAVLQWAIVSIKERNPGITAGEIRDF
FT                   LQVHNPSRKTSPTGRPIIKEKIAQKTTYYTDEQKLYV"
FT   gene            354602..355756
FT                   /locus_tag="Geob_0291"
FT   CDS_pept        354602..355756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0291"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18662"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9A4"
FT                   /protein_id="ACM18662.1"
FT                   /translation="MKRIPILAGNRKGLTSFPVGLVFLAMTATFSLSGCTESQSSPAQA
FT                   KAFAAATTAKQAETVAAPAAAAFATASSAAKTAAGATSKTYTSAKAEAKSPKGKYLAGE
FT                   DPAYAKRCGWPVKCAEPLPGSILPRKRIVAYYGNPLSKRMGALGEFQKDDMLRRLKGEA
FT                   ARWEKADPSTPVQPALHLIAVVAQGEPGKAGKYRMVMPDKIINEVYGWAKEANAVLFID
FT                   IQTGHDDIRNILPRFEWILKNPDVHLGIDPEFNLIKSGKVPGKKIGTYDAEDINYASGY
FT                   LRDLVKKYNLPPKLFTVHRFTRNGVTNFKKIALRPEVQIVMHMDGWGAPWLKRDSYKDY
FT                   IISEPVQYTGFKLFYHNDTKKGDPLMTPQDLLKLEPKPLYVQYQ"
FT   gene            355950..356276
FT                   /locus_tag="Geob_0292"
FT   CDS_pept        355950..356276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0292"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18663"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9A5"
FT                   /protein_id="ACM18663.1"
FT                   /translation="MNKVRRSIVTLTALAALTGLVFTAGCQTGRGTGGSTGSDTGSSTY
FT                   GTGTGGSTGSETTGTGGTTGTGGSTDTSGSTGSSSGGSTGSGTGGSMDSGTSGTKGSGG
FT                   SGWY"
FT   gene            356413..357006
FT                   /locus_tag="Geob_0293"
FT   CDS_pept        356413..357006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0293"
FT                   /product="protein of unknown function DUF1003"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18664"
FT                   /db_xref="GOA:B9M9A6"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9A6"
FT                   /protein_id="ACM18664.1"
FT                   /translation="MAATGLNHSDGAKNGEMAAVVDRNIEALLARRQVEEQEKKREDRI
FT                   ADAITRFTGSMPFVYLHVVVFGSWILINTGWMPFIHPFDPSFVILAMAASVEAIFLSTF
FT                   VLISQNRMQAISDKRAELSLHISLLAEHEVTRIITLVTAVAERMGIEESQNPELKELAK
FT                   DVAPEQVLDRMEQVGGQASGKNLSEREVKTEKGR"
FT   gene            357012..357170
FT                   /locus_tag="Geob_0294"
FT   CDS_pept        357012..357170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18665"
FT                   /db_xref="GOA:B9M9A7"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9A7"
FT                   /protein_id="ACM18665.1"
FT                   /translation="MNQTDWGWFNYGFIFVIILLVVLVLFSYIYFNPRKKGKPPNIDKK
FT                   AGDEGED"
FT   gene            complement(357249..357386)
FT                   /locus_tag="Geob_0295"
FT   CDS_pept        complement(357249..357386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18666"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9A8"
FT                   /protein_id="ACM18666.1"
FT                   /translation="MSELAKGSTYRCSRKECGVEVQVLQECRSQEDCQLSCCGERMQRK
FT                   "
FT   gene            357552..358754
FT                   /locus_tag="Geob_0296"
FT   CDS_pept        357552..358754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0296"
FT                   /product="diguanylate cyclase"
FT                   /note="domains: GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18667"
FT                   /db_xref="GOA:B9M9A9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9A9"
FT                   /protein_id="ACM18667.1"
FT                   /translation="MRPFTLVFRDRDLEKEFRKANYEKNLPQIRVCLALGFLLYASFGI
FT                   LDHWIIPDIEQFAWTVRYYIVCPLLVGVFFLAYSEIRYQYMYPLMVLAGFVAGVGIIAM
FT                   ILGAGAPGCFLYYVGLLLCLMFYYTFFRLPFLAATVLSWTIFLLYEVLVIWTKSIPLPI
FT                   LTNNTFFFIAFNITGMSASYSIERYMRQDFLQRRKIREQTENLKKALLDVEKSRHEAEE
FT                   MAKLDPLTSLYNRRHFFSIAERELARYRRYRHSLSIIMIDLDHFKRVNDTYGHFIGDQV
FT                   LQALAAAIDKLMRKADTPCRYGGEEFAILMPETDLAAAQNLGRRIKDAIESTEIDTRKG
FT                   PIKVTLSMGIASLDGAEDACIEQLVERADHALYQAKYSGRSLIRIWDKSSSAEAQLELL
FT                   T"
FT   gene            complement(358779..359609)
FT                   /gene="otsB"
FT                   /locus_tag="Geob_0297"
FT   CDS_pept        complement(358779..359609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="Geob_0297"
FT                   /product="trehalose-6-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18668"
FT                   /db_xref="GOA:B9M9B0"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9B0"
FT                   /protein_id="ACM18668.1"
FT                   /translation="MAGRGSGFVDQTSHQSLPSALANLQEILQLGRGRQLVIFLDYDGT
FT                   IAPITPTPDSALITPEMHRAMLRLAAKCTVGVISGRDLPDVRQRVNIDSIVYAGSHGFE
FT                   IGGPKGLHVEQPIGIQCLPTLDLTHQEISRQLAEVKGAIVERKRFVITVHYRLVAEQEV
FT                   TLVEAAVDQAIHRHPQLRKTAGKKMFELLPNTDWNKGKAILSLLDILEMNGPEVLPIYL
FT                   GDDTTDEDAFRALQGTGLGIFVGEEAVESAAGYGLRDWEEVREFLLELTPFCRV"
FT   gene            360001..360891
FT                   /locus_tag="Geob_0298"
FT   CDS_pept        360001..360891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0298"
FT                   /product="peptidylprolyl cis-trans isomerase, PpiC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18669"
FT                   /db_xref="GOA:B9M9B1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9B1"
FT                   /protein_id="ACM18669.1"
FT                   /translation="MQVRSYLFALVAGMLLAGTVHAEEVNPVVGKVGDFVLRQADLERV
FT                   IANLTPEAQQKFQGEQEQASLVNQILLTKALAAKARKEGFERKPEVKEQLSYIIDQFLG
FT                   QEYLRKVVTANVEVPDAELKKYYQEHEKDFVVPERVKVRHIYFAAAKDATAEVKAQARA
FT                   KAEKIAEQLKKGGDFAKLAGENSEDTESAANGGDLGYLTPGKTNSEEFEKAAFSLKAGE
FT                   VSPVVETPFGYHIIKVDERQEKRTATFEETKDYISSTLKAQLEEKKAREFLDAVAKEGG
FT                   LQVFPGKKAEEKSGK"
FT   gene            360913..361071
FT                   /locus_tag="Geob_3845"
FT   CDS_pept        360913..361071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_3845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_3845"
FT                   /db_xref="EnsemblGenomes-Tr:AID57969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A068F220"
FT                   /protein_id="AID57969.1"
FT                   /translation="MACQCAGHFCCVAKSTRSWRVFLCPVFHLNRRSVNNKPRSDIDRT
FT                   KRENKLY"
FT   gene            361102..361344
FT                   /locus_tag="Geob_0299"
FT   CDS_pept        361102..361344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0299"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18670"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9B2"
FT                   /protein_id="ACM18670.1"
FT                   /translation="MKNTLSAIALLSFFIMAGCGTTGGTASVGALGGAAAGGGVYEYRL
FT                   HKAKQRIESEHKAGKMDDKEYNARKDEIERLQLLK"
FT   gene            361377..362834
FT                   /locus_tag="Geob_0300"
FT   CDS_pept        361377..362834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0300"
FT                   /product="glucose/sorbosone dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18671"
FT                   /db_xref="GOA:B9M9B3"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9B3"
FT                   /protein_id="ACM18671.1"
FT                   /translation="MGQMKYICIFALYACLVGCYAMHPSSGGGGATELAEDARTVDPED
FT                   IALPFGYRIEAVAMGLTFPTGVTFDEKGNIYVVEAGYSYGEVWETPRLLRVRDGQLEVI
FT                   AEGGKNGPWTGATRHGGAFFVAEGGELNGGRILRITDDGKIAVIADQLPSRGDHHTNGP
FT                   AVGNDGLIYFGIGTATNSGIVGEDNLRFGWLKRYPDFHDTACRDVRLAGENFRTKDVVK
FT                   GEGEVATGAFVPFGTTTVKGQVIKGRIPCNGAILRVKPEGGDLELFAWGFRNPFGLAFS
FT                   PDGELFVTDNGYDDRGSRPVFGAGDPLWLVKQGTWYGWPDYSAGLRLDEGNQFKPFLQE
FT                   KPRLLLSEYPNHPPNPAAILPVHASANGFDFSRSDNFGHRGEAFVAEFGDQSPPTGKSL
FT                   GAVGFKVVRVDVRTGVIHEFAANKGKTTGPASAQGSKGLERPVAARFDPSGEALYVVDF
FT                   GILKETAKGTVPQQKTGVLWRITRELK"
FT   gene            362876..363208
FT                   /locus_tag="Geob_0301"
FT   CDS_pept        362876..363208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0301"
FT                   /product="lipoprotein cytochrome c, 1 heme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18672"
FT                   /db_xref="GOA:B9M9B4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9B4"
FT                   /protein_id="ACM18672.1"
FT                   /translation="MRLIPLLVISLLFLSACGTPRRGENVAGPLTLVTEKEVRGERYFM
FT                   TYCNKCHPLGESGVGHALNNKPLPGPLIRTQVRLGAGAMPAFSKEFLPDEKLDDLIVYL
FT                   QTLRKH"
FT   gene            363214..364380
FT                   /gene="aroB-2"
FT                   /locus_tag="Geob_0302"
FT   CDS_pept        363214..364380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB-2"
FT                   /locus_tag="Geob_0302"
FT                   /product="3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18673"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9B5"
FT                   /protein_id="ACM18673.1"
FT                   /translation="MGQDDAWHKENRERVFWQEFSVPWRFPVIFTRNVFAPANNALATV
FT                   FQAAGPVPVLAIADSGVAEANDGLADAVQAYASSHRNALRLLSPLHVLPGGEKCKNGAA
FT                   QVDRLHRLFHKHKLCRHSVVLAIGGGAFLDMAGYAAATAHRGLRLVRLPTTTLAQNDAG
FT                   IGVKNGYNSFGRKNWVGTFAPPFAVISDLNFLSTLPNRECRAGLAEAVKVAVIKDAGFF
FT                   QLLSGQRKKLAALELEQMEEMIIRCAALHLEHIAAGDPFEQGSARPLDFGHWSAHALEE
FT                   ASGGEILHGEAVAMGMALDCLYAAEKGLLREEERDQIIHLLQDLGFRLSHPVLAELDLE
FT                   GALDRFRQHLGGTLCITLPLGIGCRAEFHQMDLEVLHSSRDRLMAHKG"
FT   gene            364383..364691
FT                   /locus_tag="Geob_0303"
FT   CDS_pept        364383..364691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18674"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9B6"
FT                   /protein_id="ACM18674.1"
FT                   /translation="MRQNIKPTAMELLEWDFVKCRSRLLEIAAFIDRIDRFGGSEEARK
FT                   DFRYRALFQALEIISSGKQNRVREILLLLSDPTLQPLEDVLPPEIAQGAWRNVPGDH"
FT   gene            364681..365484
FT                   /locus_tag="Geob_0304"
FT   CDS_pept        364681..365484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0304"
FT                   /product="metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18675"
FT                   /db_xref="GOA:B9M9B7"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012022"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9B7"
FT                   /protein_id="ACM18675.1"
FT                   /translation="MIIEPHIHMVSRTTDDYRAMAMHGIAIVTEPAFWPGYDRRTAAGF
FT                   ADYFEQLTVAEPVRAAKFGISHHCWLGLNPKEAVDLGLALEVLEILPEYLDRPTVLGLG
FT                   EIGLNRNGRNEIKVLEWQVELAARRNELILVHTPHLEDKLKGTRLILDIIGADSRISTD
FT                   RVLIDHAEEHTVDLILEKGFWAGITLYPHSKCSADRAVDILETSGCERIWLNSAADWGV
FT                   SNPLAVVEAGEEMRRRGFSEEAISGVLFRNPAAFLGQSPRFKVQC"
FT   gene            365478..366554
FT                   /locus_tag="Geob_0305"
FT   CDS_pept        365478..366554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18676"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9B8"
FT                   /protein_id="ACM18676.1"
FT                   /translation="MLTYCTNIHPGHSWDEIVTKVWPQVLQVKEVVAPDAAFPVGLRIS
FT                   ALAARQVTPAAARRFADCCADDGCFIPTINGFPHGQFYGTPVKEGAYLPDWRSPERVRY
FT                   TLDLIRLLRLWLPPSLTGSISTLPIAYGRYMCRDDLGVVRKNLLTVLRELELSASAGKP
FT                   VILALEPEPGCLLETARDVAHFLEAMAFPADLRRLIGICFDCCHAAVLHEEPRRAFSLL
FT                   GEAGIAVTKIHLSSAVRFATNHLQAAALFGDDCYQHQTSVRSHAGTVHFPDLADAINDV
FT                   PLLQGEWRIHYHLPIYDSGNALYGTTNDFIGEVLTWAPPQTLLEIETYTYANLPPKLRQ
FT                   GGVIESIAREFAWLGGKL"
FT   gene            366551..367918
FT                   /locus_tag="Geob_0306"
FT   CDS_pept        366551..367918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0306"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18677"
FT                   /db_xref="GOA:B9M9B9"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9B9"
FT                   /protein_id="ACM18677.1"
FT                   /translation="MKRTVVINVAGLSSSLLGPHTPRINELADSVSRIHPVCPAVTCTM
FT                   QATFLTGRLPAQHGIVGNGWYFRDLAEVFFWRQSNRLIQGEKIWQVGRAINTAFTCANS
FT                   FWWYNMATDADWSVTPRPVYCADGRKLPDCYTQPPHLRQVFTRRFGAFPLFRFWGPATS
FT                   IASTRWIGDAAMAIEELYSPVLHLVYLPHLDYVLQKVGPEGSISRDLRELDEACGRLLD
FT                   FFRNRGCRVIVLSEYGISAVDRPVHPNRIMREAGLLSTKTDLGREYLDPGASRAFAVAD
FT                   HQVAHIYVRQKRDVEGVAALFRQVPGIEHILDSFRKKEWGLGHGRSGELVLVAGKGSWF
FT                   SYYFWMDDGKAPDYARTVNIHAKPGYDPCELFFDPKLKFPALTAGLSLLKQRMGLRTLL
FT                   DVIPIDAGLAKGSHGRIPEDPGELPLLLSSDPQLLNSDSVAAQDVFHVILDHVFRE"
FT   gene            367923..368621
FT                   /locus_tag="Geob_0307"
FT   CDS_pept        367923..368621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18678"
FT                   /db_xref="GOA:B9M9C0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9C0"
FT                   /protein_id="ACM18678.1"
FT                   /translation="MKPVRIYLELCRVSNLPTIWINTLAACLLSGNWQLKKIFLLLLGF
FT                   SLMYCGGMAMNDWLDADMDRQTRPDRPIPSGRIGADEARICWLSLFAVSLCLFFAAGGY
FT                   IAFCAAVILLLFITTYNLGHGLSPLAAIPMAGCRFMIYMISGIVCAGKPNLVLVLLAAV
FT                   QFGYILYLTIKARREKENGQIISQIPLFLAGVPLVDGVAMALTMGIVWLLAGFAGGIAT
FT                   LAAQAKIRGD"
FT   gene            368724..370379
FT                   /gene="hcp-1"
FT                   /locus_tag="Geob_0308"
FT   CDS_pept        368724..370379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcp-1"
FT                   /locus_tag="Geob_0308"
FT                   /product="iron-sulfur-oxygen hybrid cluster protein
FT                   (prismane)"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18679"
FT                   /db_xref="GOA:B9M9C1"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9C1"
FT                   /protein_id="ACM18679.1"
FT                   /translation="MEKAMFCRQCEQAAQGVGCEVMGNCGKNPQVAALLDLMIHGLEGV
FT                   AVYAHRARELGVKDPEVDRFMLDGLFTRVTNVNFDPEDIAGRLRRCYQMKDQARSLFEK
FT                   AYQERKGEKAPEFHSGPEAWQPAEDTAGLITQGRQYGVLTWHQDPDTLSALELVLYGLL
FT                   GMGAFAWHAAELGKEDDEIYAFIHRALAAAADRRITLQDFVSLALECGKMNLRTMELLY
FT                   QGHAERLADPEPMKVNLGTRGGKGIVVSGHDLPMLEEILKQSEGKGVNVYTHGEMLPAN
FT                   GYPRLRKYAHFAGHFGTAWQNQTRELPDFPGAIIFNTNCIQRPDPSYTDRLFTWGEVAW
FT                   PGITHLEGFDFSPVIEKAMQLPDLPEKPGQEILVGFGHEAVFKVAGAVVDAVKTGAIRR
FT                   FFLIGGCDGAKPGRNYFTELAQQVPKDCVILTLACGKNRFNRLEFGDIGGIPRLLDVGQ
FT                   CNDAYSAIRIALALAEAFECGVNELPLSMILSWYEQKAHVILLTLLHLGIKGIRLGPSL
FT                   PAYVSPGVLDFLVQNYDLGPTTTAENDLRQALGA"
FT   gene            370466..371926
FT                   /locus_tag="Geob_0309"
FT   CDS_pept        370466..371926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0309"
FT                   /product="cytochrome c, 5 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18680"
FT                   /db_xref="GOA:B9M9C2"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9C2"
FT                   /protein_id="ACM18680.1"
FT                   /translation="MKHPYAKVAAAIAGVLALAATSVAAPAVFNVDREFYPFYPSLIKW
FT                   NKSPAEFTPPADCGGCHEKQFREWNGSVHQLAFLDPVYQGELNKAVKAVGHEVTRQCEG
FT                   CHSAAGMVTGEIKGSGLAGLSPMALGGVSCDICHSISDTTHWQTPSHEPENGSMILSPG
FT                   LSGKGGTDLVKRGPWKPSADCGGGFHKCEESSLHQQADLCASCHQVYHYDAHFPLEATY
FT                   LEWKHGPYAQKSILCQDCHMVDTATFKRTADEFRKPERGEYHHYFNGANYLLYYLAGAA
FT                   AERTGDRELVASLKEKYQMAVEHLKSAAALEMTPVYRAGQLSELKVRVKNIRAGHNLPT
FT                   SLTNVRQMWLEITAKDEKGKVVLASGAVQKDGTLPENTRIFNSDGMGKDFHFAVDPWVV
FT                   TAFSRHDTIPPHGYKDVFYGMNGAKGAKKVTVEVKLRYRQADQKVAEALLAAVPKDMNL
FT                   KEIYGLEKVPQLPVVDMTMERQTFQVRK"
FT   gene            complement(371929..372330)
FT                   /locus_tag="Geob_0310"
FT   CDS_pept        complement(371929..372330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0310"
FT                   /product="phage tail tube protein gp19, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18681"
FT                   /db_xref="GOA:B9M9C3"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9C3"
FT                   /protein_id="ACM18681.1"
FT                   /translation="MDGEMPFPQFRYLVESHGIFAGFSQVTLDQEDLSLHDREKLKLQT
FT                   ANLVLSSGMLTFGTDLYKWLCSVKPQTIERRTISITLHNDTHQKIAAWQVSSAFPVKVR
FT                   GLQLKSSGHEVVIELIEVEHRGIELIEQL"
FT   gene            372496..372801
FT                   /locus_tag="Geob_0311"
FT   CDS_pept        372496..372801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0311"
FT                   /product="cytochrome c, 3 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18682"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9C4"
FT                   /protein_id="ACM18682.1"
FT                   /translation="MKRAVLIILLLSIGALSAVAFAATPKNPGPEIINLKMGVMILPFS
FT                   HRKHQQDLNNECFHCHPKKTGGKIDNWNKETAHQICISCHDLEEKGPVECKQCHKK"
FT   gene            complement(372883..373266)
FT                   /locus_tag="Geob_0312"
FT   CDS_pept        complement(372883..373266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0312"
FT                   /product="protein of unknown function DUF2267"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18683"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9C5"
FT                   /protein_id="ACM18683.1"
FT                   /translation="MDYRSYMNQVMELPFINDEKAADSAIKTVLGVLASKIDEDWAREL
FT                   TNILPPELDFSTLRGQQQAPVQLSIDDFFSAVAEQMHLDWQQARDLVGRVFHCVKESEE
FT                   GADIMGEIETKLPPDWAAIVDQA"
FT   gene            complement(373286..374737)
FT                   /locus_tag="Geob_0313"
FT   CDS_pept        complement(373286..374737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0313"
FT                   /product="protein of unknown function DUF1222"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18684"
FT                   /db_xref="GOA:B9M9C6"
FT                   /db_xref="InterPro:IPR009613"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9C6"
FT                   /protein_id="ACM18684.1"
FT                   /translation="MESSEYWVPRLLLQRGLGLIYLMGFLVALNQFRPLCGQKGLLPAT
FT                   HYMQLVPFRSAPSIFYLFPSDRAFQLFARLGTGLSLAAVTGLSEAYGTTVSMIVWFLLW
FT                   AIYLSYVNIGQDFYAFGWESLLLECGFLAIFLGPVGVEPPIVIIWLYRWVLFRVMFGAG
FT                   LIKMRGDPCWRDLSCLDYHFETQPMPNPVSRFFHLLPAVLRRCGVAFNHLAELVMPCLY
FT                   FAPQPLAVTGGVVSAAFLFFIIVSGNFAWLNWLAFILCFSTVTTGQLPFLALEVPPFAP
FT                   PPPLFDAACWGVAILVAIRSIQPMLNMISPAQIMNTSFDPFHLVNTYGAFGSITRERYE
FT                   IVVEGTADNAPGTASRWVEYEFRGKPGDPQGIPPLIAPYHLRLDWLMWFAAMPSRSRPL
FT                   WFIHFLAKLLQGDRQVLGLLKKNPFPDKPPLKVRALYYRYRFTTREEHRHTGRHWSREL
FT                   IGEYLPEVSLSSPSFRRILQVYQLE"
FT   gene            375058..375393
FT                   /locus_tag="Geob_0314"
FT   CDS_pept        375058..375393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0314"
FT                   /product="cytochrome c, 1 heme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18685"
FT                   /db_xref="GOA:B9M9C7"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9C7"
FT                   /protein_id="ACM18685.1"
FT                   /translation="MLKKMTNMVFPMVLMLQACLFTYAHADASASRKSAILQQRGPMLQ
FT                   KHASAAVVPERTENGMLYKANCAICHGQAKRGQASSLIENAIRKNTGGMGSLRFLTQEQ
FT                   IRTIADF"
FT   gene            375471..377051
FT                   /locus_tag="Geob_0315"
FT   CDS_pept        375471..377051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0315"
FT                   /product="efflux pump, RND family, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18686"
FT                   /db_xref="GOA:B9M9C8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9C8"
FT                   /protein_id="ACM18686.1"
FT                   /translation="MRRDWLKLPLPIIILVQLLSIDGQCESLPQELNLSRTDAIKMAIT
FT                   GNIEVHNESLSSFMAELDSIRSRSIYNPLLTLSANSGINASPGEPFRTRNTQTTIGLSQ
FT                   NLPTGGSISVTTQTGYATAESEDPELTSRNWQTSLGLNLSQPLLRNAGRETNEFSIFAA
FT                   DSNLQDAVERFRSIIIDTVHAVVTSYNRLYTLRRILETRKAALASAEMLLEGVRQKVTP
FT                   ETPLAMEVADADFAVVQRRKELVEAERNVRDHEAGFRYLIGQEGKATIIPVDPPSREEP
FT                   QETEEQAVVAALGLRPELLQLQISYNVAQVQERIARRQAWPELSLTGSGGLNGTGETMS
FT                   KNWKEIIDGRRRFWTVGMQFSYPIGNTAAVNDYRRSKIRTEQLLNQIRSLSWRIRNEVE
FT                   SDMRALISARLQVRMADMSLRIAEKRLEEYRRNNQAGTSTVQDVIDAQNDLTFARNSQV
FT                   DAVETFASAVSRLWRDMGTLLDHHGIKIDAEHVGKIAGKTALKEESKPEGLGLQLPDLE
FT                   WAMEAFRAK"
FT   gene            377066..378847
FT                   /locus_tag="Geob_0316"
FT   CDS_pept        377066..378847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0316"
FT                   /product="undecaprenyl-phosphate--protein
FT                   glycosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18687"
FT                   /db_xref="GOA:B9M9C9"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9C9"
FT                   /protein_id="ACM18687.1"
FT                   /translation="MTKPETHMPSQAGSISAEPSRACFSPGREDVLIMAAMVVIYLLIA
FT                   LPNLGSFKVPATVWQPLRKGESLVLDLGREVPVSRIYYYCGINDKRFQQTSFSLDYETK
FT                   GRFRPLAHFEKNDCNIWKFQDAGVTTSRLRIVADTAGGALNELVVLEKGAQVPLAGMRI
FT                   SALNSAGTEPQHLLDEQSTFEAGPSFINGFYFDEVYHGRTAYEHLQRMEPYENTHPPLG
FT                   KLFIASGIAVFGMNSFGWRIAGTLFGAALLPVMYLFGRKLFGRSFFAFCAAFLMMVDFM
FT                   HFTQSRIALIDIFGVFFITAMYYFIHDFYVNSCPMAPIKKSAVPLILGGVCFGLGAASK
FT                   WIAIYAGAGLALLVALQLFRSFRNYRGELGTHRFFWCYLLPVICVCLFSFLVIPAIIYL
FT                   LSYLPYLMVEGETHGFMDILRNQLDMFDYHSGLKATHPFSSPWWSWPLDLQPVWFYTAS
FT                   GLLPGRTSTIASFGNPAIWWTGLPAVIAAVIIAARKRERRMAVIFTAFAFQYLPWMFVT
FT                   RLTFIYHFFSAVPFMILCQVYVIQQAMERWPKARWAVSGYLTVAGLLFIIFYPALSGME
FT                   VSTDYIDRLRWLKSWIF"
FT   gene            378863..379825
FT                   /locus_tag="Geob_0317"
FT   CDS_pept        378863..379825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0317"
FT                   /product="undecaprenyl-phosphate glycosyltransferase,
FT                   DPM1-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18688"
FT                   /db_xref="GOA:B9M9D0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9D0"
FT                   /protein_id="ACM18688.1"
FT                   /translation="MSEATKFSIVVPVFNEEKVLPETYRRLHEVMEGLNEPYEIIFVND
FT                   GSSDRTMFILDNICEQDRHIRIIDFAKNFGHQTAITAGMDYADGDAVVVIDADLQDPPE
FT                   LIPQMIDRWREGYDVVYGKRKERKGETLFKRFSAALFYRLMRKMTDVDIPVDTGDFRLI
FT                   DRRVCDALKSIKERNRYIRGIISWLGFRQIGVEFSREERFAGETKYPMKKMLKFAFDAI
FT                   TSFSFKPLKLSSYLGMSLSFFSFVYLMVVVYQKFFTDRTVAGWASSMVISLFFNGIVLM
FT                   MLGIAGEYIGRIYDETKGRPLYVVRRVRNFAVEKDCRGR"
FT   gene            complement(379834..381168)
FT                   /locus_tag="Geob_0318"
FT   CDS_pept        complement(379834..381168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0318"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18689"
FT                   /db_xref="GOA:B9M9D1"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9D1"
FT                   /protein_id="ACM18689.1"
FT                   /translation="MASLLLLGLVPVLFALGMSIGGKYAFHVSGTQDVKPRPWLVWLAM
FT                   ATMLVIRLLLAASMEGYSCDVQTFQAWAVRAAENLSGFYSGGFFADYPPGYMYVLFLIG
FT                   KLKELLDLPDGGSGFLALIKLPAIIADMLTTFLLYRLANLRFGKKAALAVALMYGFNPA
FT                   VILDSAVWGQVDAVFTLFIVLSIFFLTGNHLASSVSWFVVALLIKPQALIFTPLLLASA
FT                   VDRLLLQPVNGIWTRILVAAAAGGLVFMVGVAPFALEEGPLWVFDHYRATLTSYPYATV
FT                   NAYNLFALSGANFTNETASWLFFPYRSWGTLFIVLATLFAFRVYFCASEETRLYLMGMF
FT                   IIAAVFIFSARMHERYLFPVLIFALLAALYAGSMQLLVIFTGFSITHYINVVHVLIAST
FT                   RGITHIPGNDPLLLGTSMANLLLFLYMLRCIARSWSNQEGRLLPE"
FT   gene            complement(381178..381624)
FT                   /locus_tag="Geob_0319"
FT   CDS_pept        complement(381178..381624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0319"
FT                   /product="membrane protein, GtrA superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18690"
FT                   /db_xref="GOA:B9M9D2"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9D2"
FT                   /protein_id="ACM18690.1"
FT                   /translation="MGAQGGKAFSSRQPETLSTLVRQLTRFNLVGILNTTVDFSLFFLL
FT                   DMLGMPYLLAQTCSYSCGIANSYFFNKYWTFGMTGIKSAEMLRFAMVSLTALGISVLLV
FT                   YLFHSTLNFSLLTSKIAATILTMLFSFFGSRQLVFRPETKPIDP"
FT   gene            381816..382457
FT                   /locus_tag="Geob_0320"
FT   CDS_pept        381816..382457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0320"
FT                   /product="cytochrome c, 1 heme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18691"
FT                   /db_xref="GOA:B9M9D3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9D3"
FT                   /protein_id="ACM18691.1"
FT                   /translation="MLRLKKTLAILICMSFLQSGAMAVANDDEDRGKATGGSTYDRDRD
FT                   NDRDRDNDRERDDDRDRDRDKKKDRRHRPHKSPTPSPKPVVSPTPKPSPTPTPTPTPTP
FT                   TATPTPKPSPTPTPTPTATPTPAPTATPTPTPTPTPTPTPTPKPTPTPTPAASGATLYQ
FT                   TYCSGCHGSPTGKGWSASAIQSAINNNRGGMGFLSTLTSSQIQAISTVTK"
FT   gene            complement(382586..383977)
FT                   /locus_tag="Geob_0321"
FT   CDS_pept        complement(382586..383977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0321"
FT                   /product="glycoside hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18692"
FT                   /db_xref="GOA:B9M9D4"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9D4"
FT                   /protein_id="ACM18692.1"
FT                   /translation="MQKVTTVVVSLFLLFSSACCHHPMGAHGTAGGGSTTAAGAAQAFT
FT                   KPVSFSILQDYVKGEDLEEVAKDFRLMKELGLTTWRGSLAWGDYEPAQGQYDFKWLRQF
FT                   VELATQHGMSLRPYIGYTAPWAAGGGTDKEAWNDPPARLQDWSNFVSHLSGALASQKNI
FT                   LSYEIYNEENVRQWWDGTAEQYNQVLQKGAEAIRSSDRTKPVIFGGMVYPDADWVKAAC
FT                   DEYGSGDSFHILPFHAYPETWTEKNIVLENYLDQGYPNHFQGTFIPWADQYCGRKPIWI
FT                   NEAGFANTPGKSETDQANWWARAFATFLASPRVEHLGIYQIKERKQSETVIGGGENYYL
FT                   GISRPDRTRKMAFFTIKRLIGLLDVGNLTIADRELKVEVTSGKKVELYSHLFVRPDGSQ
FT                   VLFVWDKKGEPTLRLHPRPGSAVVEYALDGSPLPFRSYNGKTLEKVKLTPGLVRIFEIK
FT                   AAGKS"
FT   gene            384110..385924
FT                   /locus_tag="Geob_0322"
FT   CDS_pept        384110..385924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0322"
FT                   /product="ABC transporter, ATP-binding/membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18693"
FT                   /db_xref="GOA:B9M9D5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9D5"
FT                   /protein_id="ACM18693.1"
FT                   /translation="METIIQKTKDGILAKVAGLAGLDRVKLTQMRRAIGFVTPHRRTVA
FT                   IILAIMPVIAALGALEPLIYKLVFDRLAGNKGLASVLLAVGAIMLAALIREGFNAISNR
FT                   LSWKVRLAVNYQLLDATTSRLHALPLSYHRGETVGGLMTRLNHGINGFVAAVADIAFGI
FT                   LPGLMYLAISVVVMVRLDWRLSLVVILFAPLPALIGVFASKEQTARESSLLYRWGVVFS
FT                   RFNEVLAGIVTVKSFAMEDAERKRFMGDVSEAHGIVRRGVATDTKIGATQNLVVMLAKA
FT                   CSIGCAVYLISRGETTVGTLMAFLGYQGGLFGPVNSLTSIYQTLRKATISFDIIFSILD
FT                   AEDRLQDAPHAVAVQQVKGEVLFRNVHFAYNEDRTILSNINLHVQPGETVAIVGPSGSG
FT                   KTTLISLLQRFYDPTSGSIRLDGVDLRFLQQRSLRQQIGVVLQDALVFNDTIRNNIAYG
FT                   KPDATKAEIEAAAVAANAHKFICQLPGGYDFIVGERGSRISVGERQRISIARALLKNPS
FT                   LLILDEATSALDAESEALVQDALDRLIKGRTSFIIAHRLSTIVGADRILVLKDGHIIES
FT                   DTHQALMEQGGYYASLVECQSRGLLLAS"
FT   gene            complement(386132..386443)
FT                   /locus_tag="Geob_0323"
FT   CDS_pept        complement(386132..386443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0323"
FT                   /product="toxin, RelE family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18694"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9D6"
FT                   /protein_id="ACM18694.1"
FT                   /translation="MNLMFSDDFVTSLKKHNAIKDVVRKKIDMITANPISLGEPLKGNF
FT                   RGYYSCSVRRNFLIIYLYCSICRKKGDDAIVLCADCQQCPDDTLKFIALGPHDKAYWG"
FT   gene            complement(386440..386694)
FT                   /locus_tag="Geob_0324"
FT   CDS_pept        complement(386440..386694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0324"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18695"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9D7"
FT                   /protein_id="ACM18695.1"
FT                   /translation="MQKARINLTLDSDLIEFVKEYAESQRTTVSEVFTQFALKLKRLKE
FT                   NDPTEIILSDPDFTDSLIETITRIKSGAVKWQSYDEVFK"
FT   gene            386957..387214
FT                   /locus_tag="Geob_0325"
FT   CDS_pept        386957..387214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0325"
FT                   /product="helix-turn-helix XRE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18696"
FT                   /db_xref="GOA:B9M9D8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9D8"
FT                   /protein_id="ACM18696.1"
FT                   /translation="MRRVIMRSPVPESQPLLDAETLGIFVRASRTKTGMGIHEAAAFCG
FT                   VAVGTMQKIEKASGDVKLSSILTVCKMLGISLTIGSRVNS"
FT   gene            387211..388509
FT                   /locus_tag="Geob_0326"
FT   CDS_pept        387211..388509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0326"
FT                   /product="HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18697"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9D9"
FT                   /protein_id="ACM18697.1"
FT                   /translation="MTETLLTYLDGIYLGKIILDGPFEAYGLEYDETWIGGGGFPISPH
FT                   LQFHKSPDDSVRRFLSNLLPEGRWLEELSSSSHISKSNTFGLIAAIGSETTGALTFRIG
FT                   GEGSETNTTNFRPIETQELEERIRERNDRPISLWDGKQRLSTAGVQDKLPVMIMPDGTF
FT                   GFGEGDLASTHILKFDTKQNIHLVLNEFICMTLAHLAGLPAANVKFVRMGEPVLVVERF
FT                   DRKWSGDESIKRLHLIDGCQMLDLLPTYKYERPFGKTGHAAGLRTGASLQMLFDSAKSC
FT                   RVPALTMRDMLNWTLFQLLIGNSDAHAKNISFFLGKEGIDLAPAYDLVCLDVCGDQYDR
FT                   NIAMAIGDVFDPDDIQAWQLAEMCFECKLPQRQTARMLDSLCNNILRSLTKISLPELLT
FT                   PIEEEFARNLIQVITNKVHRYQEYAKQLPGLKI"
FT   gene            388642..389232
FT                   /locus_tag="Geob_0327"
FT   CDS_pept        388642..389232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18698"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9E0"
FT                   /protein_id="ACM18698.1"
FT                   /translation="MYNIRLRTRMIFLAVTLAALCPAILSAAEKASQTATSLVNLVKPH
FT                   EREAQAIRFMLVVAPMGFPEGLADCMVAKTTPAIKDYFAALYAAHLSETELRQAVDFFK
FT                   GEDGRAAVAFRLQHEQNLLNASAKGEQITNEHPEYPLQIRKALEAFSATPAGRHFVGDE
FT                   LEARQPFASEISELRNAGMAQCLADLSVGVGNR"
FT   gene            389348..389767
FT                   /locus_tag="Geob_0328"
FT   CDS_pept        389348..389767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0328"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18699"
FT                   /db_xref="GOA:B9M9E1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9E1"
FT                   /protein_id="ACM18699.1"
FT                   /translation="MKPRINMITLGVGDMEKAAAFYERGLGLPRMPFEGGAAFFMLNGS
FT                   WLSLYPLNALAEDATVAANGTGFRGIALAHVVSSREDVDEVLNQAVKAGGTLIKPAADV
FT                   FWGGYSGYFADPDGHLWEVAWNPHFWPGPTDCDEA"
FT   gene            complement(389887..391146)
FT                   /locus_tag="Geob_0329"
FT   CDS_pept        complement(389887..391146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18700"
FT                   /db_xref="GOA:B9M9E2"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9E2"
FT                   /protein_id="ACM18700.1"
FT                   /translation="MRLITEYRPIFLTWLVWVFLMLILVPYLGARFTLVAPDRTLAWTA
FT                   AATMPESQTRHTYLTGAFLNGHVAWDSEYYLSIAVAGYDDPAMRAIPPDFNWKNQVIRT
FT                   LAEKPSWTSMNYAFFPGYPMLIRIFMTPFLLLGMEELAAATSAGVLVSLGGTLAAMLAL
FT                   YRLGRDMLDRDAGIRASFYLLIAPASMFMAMVYTEGLFLALSFSALMFARERRFVPAGI
FT                   LAFLATFTKAGGVLLLLPLFLYWYGSDGRRAIFQMGKGRHLRDFAFMLAPALAYGIFTL
FT                   TMSSQFHFIESNYFNRNLLNIQGTLAAWKEAVGLMATNPQSLAYYTVELACLTAGIASL
FT                   VWMFRHDKVLTLYSAAILLFSLTSGAAQGMHRYVLALPSFFLAPAALGQHKSFDRAWIM
FT                   LNLPFMIILLTTFVFNQWAG"
FT   gene            complement(391359..392726)
FT                   /locus_tag="Geob_0330"
FT   CDS_pept        complement(391359..392726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0330"
FT                   /product="peptidoglycan-binding outer membrane protein,
FT                   OMP_b-brl and OmpA domain-containing"
FT                   /note="domains: OMP_b-brl, OmpA"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18701"
FT                   /db_xref="GOA:B9M9E3"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9E3"
FT                   /protein_id="ACM18701.1"
FT                   /translation="MKLFNRMLLAAAGTLLLSVGTVSAAGVEPGAFYLSPIVGGYTFDG
FT                   KQHLETQPVGGIRAGYNFTKHLGAEALFDYTRTEGTRSSTKTDFYRYGADALLHIFPDN
FT                   RLVPYIAAGYSGMSLDSNDGTKLTRGVFDYGPGIKYFISDTWALRGDFRHLIFKHEGDS
FT                   YSNYEYNLGLVYSFGAAKEPAPVAKAEPAPAPAPEPAPAPAPVVAPPPAPADSDNDGVI
FT                   DTLDKCPGTPAGVKVDKDGCPVDSDKDGVADYLDKCPGTPAGVQVDKDGCPVDSDKDGV
FT                   ADYLDKCPGTPAGVQVDQDGCPVDSDGDGVADYLDKCPGTPKGTKVKADGCPDLETLSM
FT                   SINIQFVTGKNDIQPKYAGEIKKVADYMQKYPTVKGVIEGHTDNVGSAAANMKLSQRRA
FT                   EAVRSYLIKKHGIAADRLTAKGYGMTRPIADNGTEAGRQQNRRITAVLDSVTVEKQ"
FT   gene            complement(392762..393205)
FT                   /gene="mscL"
FT                   /locus_tag="Geob_0331"
FT   CDS_pept        complement(392762..393205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="Geob_0331"
FT                   /product="large-conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18702"
FT                   /db_xref="GOA:B9M9E4"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M9E4"
FT                   /protein_id="ACM18702.1"
FT                   /translation="MFKEFKEFAVKGNAVDLAVGVIIGAAFGKIVTSLVNDILMPPLGL
FT                   LTGKMDFSNLFINLSGTPVDTVAKAKAAGIPTINYGLFFNNIIDFVLVAFSVFLVVKQI
FT                   NRLRRPETPPPPSTRQCPFCLSPIPLAASRCPQCTSAVEPTAT"
FT   gene            complement(393384..393911)
FT                   /locus_tag="Geob_0332"
FT   CDS_pept        complement(393384..393911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0332"
FT                   /product="phosphatidylethanolamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18703"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYX1"
FT                   /protein_id="ACM18703.1"
FT                   /translation="MEKILAAMMIILACTALAIAGGAKKGGMKMKISSPAFTDSQSIPD
FT                   RYTCNGNNISPPLRFENIPARAKSLALIVDDPDAPAGTWTHWIVWNMSPRTRELAENAA
FT                   PREAIVGKNDFYHNSYGGPCPPSGTHRYFFRLYALDAVLQTAGHATRAELEKALQPHII
FT                   ETAELMGTYQKK"
FT   gene            complement(393922..394578)
FT                   /locus_tag="Geob_0333"
FT   CDS_pept        complement(393922..394578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0333"
FT                   /product="haloacid dehalogenase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18704"
FT                   /db_xref="GOA:B9LYX2"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYX2"
FT                   /protein_id="ACM18704.1"
FT                   /translation="MAKVVIFDLVGTLFSLETVNRLLEKEGLKGDSWFQESIQTAMAAT
FT                   LAERYLPFRDVVELSLTNLVEIHGLTAVSIPAVMEKLKELQPMAGAVECLKKLKGQKAR
FT                   LAVLTNSGKPAAVALLERSGLATHFEMIVSTDEVEKCKPHPSTYLLAMDRLGAEPEDCW
FT                   MVAAHGWDIYGAAAAGFHTVWVMNRDRRWPFPGLPPGATISALGELPEVIGTWGK"
FT   gene            complement(394602..395012)
FT                   /locus_tag="Geob_0334"
FT   CDS_pept        complement(394602..395012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0334"
FT                   /product="peptidylprolyl cis-trans isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18705"
FT                   /db_xref="GOA:B9LYX3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYX3"
FT                   /protein_id="ACM18705.1"
FT                   /translation="MRAEMGKRVTISFVCRLEDGTLYDFTEATMLSFIVGQGHTLPSLD
FT                   AGVIGMSRGEHRTIRLPATEVDAFPLVAPGTSSTAGIPAGSSRAPNGYEFAPGADGDAV
FT                   TPSQPHSRWAKPRVATGAWLVFHVKLLKVEDV"
FT   gene            complement(395246..396085)
FT                   /locus_tag="Geob_0335"
FT   CDS_pept        complement(395246..396085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18706"
FT                   /db_xref="GOA:B9LYX4"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYX4"
FT                   /protein_id="ACM18706.1"
FT                   /translation="METRTIETRTTEKRTYFPWISWGSIFGGLASGMGTYLLLALLGLA
FT                   AGLTAVDPQSAEPVGKASLITGIWTSVSLVLSAFVGGYVAARMSGLTRLADGMLHGLVA
FT                   WSVSTLVFAFVITTSIGSVIGGAFSVFGQGAKAITGGAAVTAGGVSGSPGAQTQLESLL
FT                   KGSSGKGDISKESVATLQQRLSSGDREGAVNVMVSDMGFTQDRAESMVNQGMALFGSAR
FT                   NLPEQARGAASSAVSGLTKVSWGLFGGVLLSMALGIAGGAVGSKAAIKRRSPIFHRG"
FT   gene            complement(396258..398747)
FT                   /gene="ligD"
FT                   /locus_tag="Geob_0336"
FT   CDS_pept        complement(396258..398747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligD"
FT                   /locus_tag="Geob_0336"
FT                   /product="DNA ligase D, ATP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18707"
FT                   /db_xref="GOA:B9LYX5"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYX5"
FT                   /protein_id="ACM18707.1"
FT                   /translation="MTLDDYRKKRDFDRTPEPQGRAGPSEPALRFVVQKHAASHLHYDL
FT                   RLELDGVLKSWAVPKGPSLDPAVKRLAMMVEDHPFDYRNFEGIIPAGNYGAGAVIIWDE
FT                   GTCHAYGTEERSESERILRQGLAKGDLKFILHGHKLKGRFALVKIRSGKGNSWLLVKKD
FT                   DEHATAADITRHDRSVVSGRRLDELGPEGEEPVMADMPGEAAPMPHNVKPMLATLVKDA
FT                   FDHPDWVFEIKLDGYRTIAEISAGSVLLYSRNLLPFNNRFPTIAAALAGLGREAILDGE
FT                   VTAMDENGRSDFQLLQNHDRTGEGSILYFIFDLLYLDGRDLRNLPLLTRKTLLQEILPD
FT                   LPQVRYCEHIGETGIAFFQAAQDNGLEGIVAKLADSRYETGKRSSAWLKVKATLRQEAI
FT                   ICGFTEPRGSRKKFGTLVLGAYDKGELVYIGTSGGGFDEASLNELHDMLLPLVQGDSPF
FT                   KTRAATRMPAQWVKPVLVCEVSFSEWTSDGVMRQPVFLGLRQDKDPVTIIRETFPGPMA
FT                   APPPSAEKAGLAEKELTIGSRRLKLTNLDKVFWPAEGYTKRDVIDYYRTISPYLLPHLR
FT                   DRPESLYRTPNGIEEAGFFQKDVRDMVADWPLTEAIYSESQHKTITFLICQDEESLIYM
FT                   ANLGCIEINPWLSRLGSLDNPDYLVIDLDPEEIGFEKVVETALAVKEVLDRAGAVGFPK
FT                   TSGATGMHIYVPLGARYDYETAGRFAHLIATLANHLVPDFTSLERSPAKRQGKVYLDFL
FT                   QNKRGQTLAAPYSIRPRTGATVSTPLYWSEVAPGLEPRDFTIRTVPRRIEKTGDIFVRV
FT                   LGPGIHMERCIETLERL"
FT   misc_feature    complement(398768..398938)
FT                   /note="conserved nucleotide sequence; Geob_R5011"
FT   gene            complement(398954..399733)
FT                   /locus_tag="Geob_0337"
FT   CDS_pept        complement(398954..399733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0337"
FT                   /product="DNA-binding Ku protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18708"
FT                   /db_xref="GOA:B9LYX6"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYX6"
FT                   /protein_id="ACM18708.1"
FT                   /translation="MKAIWTGSISFGLVNIPVKLFSGSESNSLDLNLLHKTDLHPINYI
FT                   KVCKAENREVPMSEIVKGYQHASGEYIVLTEQDFEIASVEKTHLIDILDFVDEQEIDSR
FT                   YFERPYYLEPDKTGAKPYALLREALKKSGKVGIASYVLRNRGSIGIVKPLEDVLVLNQM
FT                   RYQEEVRSHAELKLPQGENLRQQEIDLALMLIDQYSTRFDPAKYKDSYMDDLKRIIEEK
FT                   AQGIQPQPQGKRPQPSNVVDMMALLKKSLEEKKRKAA"
FT   gene            399818..401011
FT                   /locus_tag="Geob_0338"
FT   CDS_pept        399818..401011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0338"
FT                   /product="glycoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18709"
FT                   /db_xref="GOA:B9LYX7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYX7"
FT                   /protein_id="ACM18709.1"
FT                   /translation="METMEVADLELIEVCYEKAVLLLHANSSEAGILAATITRKAAGRN
FT                   YTAIFGRDAAICALGMLVSGDVELVRVARQGLATLAQYQAPNGQIPKYVKPETGEVDFW
FT                   YTGCIDATLWWLIAVSFYDRLCPEEHLGAGLAEKSALALNWLQCQEHQAWYLLQQNEAS
FT                   DWADIMPRSGFVLYSNVLWHWVKRLYNLPTACHTRDYANLLFNPYGNVVPEKRRPRLLV
FT                   HYIRNRSKGTPFYLSFVNFTVWGMEIDVFGNVLAALTGLAAPSRGCELVRAILALEAHR
FT                   PFPLRVVGRPIQIREPLWRLYMHRHRQNFPWQYHNGGIWPFAGGFWVMLLARLGKREKA
FT                   LVELTRLARANQVNDWEFNEWFHGVTGEPLGMVGQSWNAAMFILAFRTVIDKKRYVY"
FT   gene            401107..401499
FT                   /locus_tag="Geob_0339"
FT   CDS_pept        401107..401499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0339"
FT                   /product="rhodanese homology domain superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18710"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYX8"
FT                   /protein_id="ACM18710.1"
FT                   /translation="MAKLLSEQFEITADDLKSRMKSGKPVFLVNLRHHGDWDVGLIKAR
FT                   GALRVADDELEQHLGEIPHDQEIVICYLGPGDRPSVEVAQMLQRKGWRDVHPLRGGFSA
FT                   YLDAGLPVEDLKGRSIAKKRMLLSGA"
FT   gene            complement(401519..402280)
FT                   /locus_tag="Geob_0340"
FT   CDS_pept        complement(401519..402280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18711"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYX9"
FT                   /protein_id="ACM18711.1"
FT                   /translation="MAQIKGTGILERGNIYFLYRPKVQKEQARGERDVERFYMVLSPEG
FT                   KNIFREIIIGQKALPGIRKKERNWAFVKNVTRQAKELEEEFGELEYSTKTRGEREVPAA
FT                   RPAGEGIYAIVRHDNHTHLAYSLELPEQPRQVQRALNIATEGSYIISVKNPGKTSPPGT
FT                   GLKSGQKAGYPQELLAAFRDRRFADADPPELLDYPGTELMLIGAEEKPGEELGIGLSTD
FT                   KETGASADIFTDLKLNRKEHPVKPLFEGKWE"
FT   gene            complement(402280..402816)
FT                   /locus_tag="Geob_0341"
FT   CDS_pept        complement(402280..402816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18712"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYY0"
FT                   /protein_id="ACM18712.1"
FT                   /translation="MGKSTDETGQVTPNQTDRIREEIRYTEAEITDTLQTIEKRFAPAH
FT                   MKAEAKVKLREYSLTGLVKITEAVKKKPVPAALIGVGALWLIFRKKKKPRPEAELPGAA
FT                   LMEVMPRKMKKNPVKTMKHYLSILRIAIAAGTAARAIYLQSKSGQRTPAGAKAVTVTEV
FT                   PRAGAFPETVRENVY"
FT   gene            complement(402783..403181)
FT                   /locus_tag="Geob_0342"
FT   CDS_pept        complement(402783..403181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0342"
FT                   /product="protein of unknown function DUF1469"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18713"
FT                   /db_xref="GOA:B9LYY1"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYY1"
FT                   /protein_id="ACM18713.1"
FT                   /translation="MTEKKDRPLGDLFSELIQETRTLFKKEVELMRVELSEKVEGLKKD
FT                   LVAVGIAAVLLYAGLLTFIAAMVFGLAVFIPLWLSALLISIVFIGIGGALLVKAKKDVS
FT                   QMKLAPEKSKETFKETAQWAKAQMKPVR"
FT   gene            403435..403842
FT                   /locus_tag="Geob_0343"
FT   CDS_pept        403435..403842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18714"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYY2"
FT                   /protein_id="ACM18714.1"
FT                   /translation="MKKYMLLAAASLFLGLTGCAKEVVVPPSAELPAVIGEAKATKDPN
FT                   GNTRVRLRVEHMAPPQNLQPPKSVYVVWVETPEKQRFNLGQLRVDEKRRGQLDATTAFK
FT                   VFRLVVTPEDFPTVTEPTGPEVLATGVLEAK"
FT   misc_feature    complement(403863..404050)
FT                   /note="conserved nucleotide sequence; Geob_R2004"
FT   gene            complement(404097..404276)
FT                   /locus_tag="Geob_0344"
FT   CDS_pept        complement(404097..404276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0344"
FT                   /product="protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18715"
FT                   /db_xref="GOA:B9LYY3"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LYY3"
FT                   /protein_id="ACM18715.1"
FT                   /translation="MLRWAAIFFIIAIVAAVFGFTGIASAAAGIAKFLFILFLVVALIM
FT                   LILGITAGTKITRH"
FT   gene            complement(404469..404762)
FT                   /locus_tag="Geob_0345"
FT   CDS_pept        complement(404469..404762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0345"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18716"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYY4"
FT                   /protein_id="ACM18716.1"
FT                   /translation="MKSVKKAVYTIAALIALGGMVFSTGCKKEGGTGGGTGGDTGGTSG
FT                   SGTGGSTGGTGTDTGGTSGTGTGGSTGTGTGGGTDTGTGAGGTFGVMTSGGR"
FT   gene            404924..406006
FT                   /locus_tag="Geob_0346"
FT   CDS_pept        404924..406006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0346"
FT                   /product="membrane protein, UPF0118 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18717"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYY5"
FT                   /protein_id="ACM18717.1"
FT                   /translation="MDKRVYLSIIGAIATAGIAALLGLLAAPILEPLAWALIIGIATIP
FT                   YYNRLTQRIPNRPGRCAGLMVLAVTVCFVLPIAGLITTIAQNAPAWFQTAQGLVRDFAT
FT                   SGSTILHRIPFIDRITSLVEKSGIDVGGYAAKSAGPISGGIVNAATNMAKGLAELMFIL
FT                   VVALFILFFVYRDGERVMSTAVTRFAPDGNNMRRYLSRIRATTTAVAVGTLFTCLVQGI
FT                   IAGIGYFFADVPAPVLFAGLTSVAALVPVVGTAIIWVPLAAYVAFKGAYVTAGLLALWC
FT                   VFMVGLADNAIRPIAVGAKGNVPVPAVVLGAICGVTTIGLLGLILGPIIFATVINLWHE
FT                   LATVERSETAQGEETRPPSD"
FT   gene            406027..407784
FT                   /locus_tag="Geob_0347"
FT   CDS_pept        406027..407784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0347"
FT                   /product="outer membrane surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18718"
FT                   /db_xref="GOA:B9LYY6"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYY6"
FT                   /protein_id="ACM18718.1"
FT                   /translation="MGNKGAYLIAMLIALLAFLPPVSMAAESVEIVVTGVEDEARTNVQ
FT                   EALALPPGMVREGKVDRLWLERFARQAPDRVRTALQPFGYYNAQVETNLSEERGYFRLM
FT                   AQVSLGEPVRISALDVALTGAGAGEGRLKDLVDVFPLEKGDILLQQPYDQAKGGLEAAA
FT                   EELGFLDARFTAHEIRIDPPRTSARIRLVMDTGERYFFDGATIEGAPDYPESFLRRYLS
FT                   FKSGEPFSYSRLGQTQLNFNNSERFKEIVVTPHKEEAANNTIPVSVQLKQAYRRSLRPG
FT                   LGYGTDTGGRFSLRYRDLNMLHRGHEYYANLFISQRLQGFASGYVIPDADDIRSSTSLQ
FT                   LNLQREETTYVSRLVALELDKNRSFGRGELGTAYIRLQRESFTIGSENSSSRLVLPGLR
FT                   FTKDHYGDLIRPERGFRYFFDVRGTHQLIGSDVGLIQLITEGSDLMPLPWRLSLHTRAK
FT                   VGLTLLNDPMADLPASLRFFAGGDQSVRGYSYKSLGPRDATGEVVGGRHLLVGSIELER
FT                   ALFKDWGLSVFYDIGNAFNSFTSVKLYSGAGVGVHYYTRVGVVNLSIARQLGVDNPAFH
FT                   IHFTIGLEL"
FT   gene            407781..411767
FT                   /locus_tag="Geob_0348"
FT   CDS_pept        407781..411767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0348"
FT                   /product="protein of unknown function, DUF490-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18719"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYY7"
FT                   /protein_id="ACM18719.1"
FT                   /translation="MKRAIAYGLAVLLAVLLTAAIVAMGWIFGTTAGARWTLQSLSRYT
FT                   PLQISAARVEGRLLDSLRLEGVKIRSGLKQATIGQLEFQWRPVWLVTGSLVVDELVLAA
FT                   VAVRDDTPSTKKPLDLSWPRLPGLADHVDAEIRSLRLTDLRYRHADAEPVQVKNLAATI
FT                   SWRDGVLSLPSMTMTTDGGKVKGKMAAGFHRPSLAMDLVMTPAKPVAQMDSLSVSGRLL
FT                   PATAPEQLVGPVLVTGRARGAPQLEIKTELGLTRNALNLRRLKIIRPGSRGAITGEGSI
FT                   NLAAVEPEVKLSLIAADLDLSRELKMPTDLSGSLTLTGSSKRYQGQFSIGNRGKGWRDA
FT                   SLAATFRGGDKGLSLAPLNGSMLGGTVAGMLEVDWLGGITAKGRLQGKNLDPARLAKDW
FT                   TGNVNFNAAAEVAVPKQGSLQGKADVVLLESRLHGQPLSGRVKGELAGKNLQIANLDLH
FT                   GRGFDLHGSGDVSRRFDLAAVVTDLSRLVPETAGELRLAGWGVWKDGSAAGSISGSGRK
FT                   LKGRGLGIENVNFEGRVPQGKDQPVHLAAFLQKAAYRQFQADSIRLKMDGRISDHLLSL
FT                   EMTAPEASINLALAGSYSGGSWQGTINRFYGRDRIGPWRLLAPTRLQASSAKLSLARMA
FT                   LAGTGRERLEARAEFSPGPVTGDVDVQWEAISLNRLTPWLQGVQVTGLSNGAMAGSVLS
FT                   GDRLSFNIKAGGQAKVTREGRTVTIERANLNGAGSEKGIHLDLDVKAAEGVQLEAKLAT
FT                   AAPARLALPEQGTMELKWRVADLALLQPWMKGNIKVAGGLEGAAKGKFLPENRLEMTGD
FT                   VTLTGGNLHWQKPEGEGTMALKDASLKWSWRGDTLRGSVGLTLAEFGQARGSFTLPVPA
FT                   AFPVSPDPHGAVSAALSGRVQEQGVLSAFMPGLVQETHGQVDVDLGVGGVWQEPRLHGK
FT                   LQLSQAGAYLPAAGITLRDVTLSANLDKDQVGITLSAISGPGRLKGEGVALLKGWQLDS
FT                   YRGIITGDRFQLIHLPELEASGSPQLSFDGTLKKLAVRGEVRLPVLLIHGQPPRAGIQP
FT                   SNDVILEGAPAEKKAPPLALDIQVRVTLGDRVLVKAEGIDAQMGGSMDLTLASLDNISS
FT                   KGEIKVVKGRYKAYGLDLAIARGRVFYAGGPVNEPLLDILALRTVGEVRAGVTVSGTPR
FT                   TPVIKLYSVPAMPDMDILAYMVLGHPLGASSEQAGLMAQAAGLLLSTGQSVVLQDQIKN
FT                   RLGLSTIEIESGKQDAAEKMGYKQIPVTPSGVAPAKQADAGVSQSILTLGKYLTPQLYI
FT                   SYGRSLFTGANLFRLRYDISRRLQLETETGSESGVDLYYKMNFN"
FT   gene            complement(411764..412291)
FT                   /gene="hemG"
FT                   /locus_tag="Geob_0349"
FT   CDS_pept        complement(411764..412291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemG"
FT                   /locus_tag="Geob_0349"
FT                   /product="protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18720"
FT                   /db_xref="GOA:B9LYY8"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYY8"
FT                   /protein_id="ACM18720.1"
FT                   /translation="MAKFLIVYSTTDGQTRKICHRLQQVVEQQGHQVAMVPVEDADRID
FT                   LASYDKIVIGASIRYGKHSPLITRFIEKNRTLLESKPNAFFSVNVVARKPEKNIPEKNP
FT                   YLQKFLRRISWKPRELAVFAGKIDYPSYTPFDRFMIRLIMWMTKGPTDPKTVIEFTDWE
FT                   KVDQFGRRMAKI"
FT   gene            complement(412345..413028)
FT                   /locus_tag="Geob_0350"
FT   CDS_pept        complement(412345..413028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0350"
FT                   /product="KWG repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18721"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYY9"
FT                   /protein_id="ACM18721.1"
FT                   /translation="MKRLIFSLACLVLSLALPAFGGQQKKQGAVLYEIKRDGKIGFINH
FT                   QGKEVIAPRFDDVRGGFIEGLTRVQVNDLWGFMDRSGKVVVSPVYDDNDEFSEGLAKVR
FT                   SKKKWGFVDHGGKVKIPLEFEDAGNFRDGMAKVKIDGRWGFVDKAGRKVVPAQYKDVDD
FT                   FTEGLARIKSDGKWGYVGKSGKIAIQPAFENADAFVDGLALVEIDGKKGYIDHSGRFVW
FT                   GPVKY"
FT   gene            413222..413554
FT                   /pseudo
FT                   /locus_tag="Geob_0351"
FT                   /note="toxin, RelE family; internal stop codon"
FT   gene            413544..413858
FT                   /locus_tag="Geob_0352"
FT   CDS_pept        413544..413858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0352"
FT                   /product="antitoxin, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18722"
FT                   /db_xref="GOA:B9LYZ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYZ0"
FT                   /protein_id="ACM18722.1"
FT                   /translation="MSYKPVSYHPKKELEKDLQDPNFKQAWDALDDEFAALDALLAARK
FT                   QAGLTQEQVAAKMGVSQPSLARVEASLGSHRHSPSLEMLRKYAAAVNCKLEIKLVPQRS
FT                   "
FT   gene            complement(413931..415097)
FT                   /locus_tag="Geob_0353"
FT   CDS_pept        complement(413931..415097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0353"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18723"
FT                   /db_xref="GOA:B9LYZ1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024050"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYZ1"
FT                   /protein_id="ACM18723.1"
FT                   /translation="MEIKLKYGCNSHQTPANLIIPENSGFQVLNGTPSYINILDALGAW
FT                   QLARELKIATSKPGAASFKHTSPAGAAVAGALPDSYCASQFLSQSDLSPVATAYVRARG
FT                   GDRMCSFGDVAAVSDIVDVSLANVLKSEVSDLIIAPGFEPAALEILKAKKQGTYLILQI
FT                   DPDYEPAEIEQREVFGFGLQQKRNTAPVSAALFQNSVTIGKSVSPDITETLIVATIALK
FT                   FTQSNSVCLAYEGQVIGMGAGQQSRVHCTRLACDKADKWLLQQHPKTLNLAFREGLKKP
FT                   DKANIVDQFLLWDQLSEAEKKQMRTGFMKEPDPISAQERLEWVKQFPGICLSSDAYIPF
FT                   RDNIDRANRSNVQFVAHAGSSLRDEEVTEAAKQYDMTMLHTGLRLFLH"
FT   gene            complement(415291..415637)
FT                   /pseudo
FT                   /locus_tag="Geob_0354"
FT                   /note="hypothetical protein; frameshifted"
FT   gene            415932..416426
FT                   /locus_tag="Geob_0355"
FT   CDS_pept        415932..416426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0355"
FT                   /product="outer membrane lipoprotein, Slp family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18724"
FT                   /db_xref="GOA:B9LYZ2"
FT                   /db_xref="InterPro:IPR004658"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYZ2"
FT                   /protein_id="ACM18724.1"
FT                   /translation="MRLCLLLVLMMMSLSGCAGVFSDETLNRVEWDVPFSVLRVQPEQY
FT                   EGRQFLLGGAIVAVRNGRHGGELEVAQLSTDDNGHIKDNPTSGGRFLARSGDFLDPAIF
FT                   RRGMLVSLVGPVTGKEVRELAGRDYAYPVLEIREIHLWRPEERSREPRFHFGFGIGTFI
FT                   H"
FT   misc_feature    416424..416570
FT                   /note="conserved nucleotide sequence; Geob_R6002"
FT   gene            complement(416555..417136)
FT                   /locus_tag="Geob_0356"
FT   CDS_pept        complement(416555..417136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0356"
FT                   /product="NUDIX hydrolase, coenzyme A pyrophosphatase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18725"
FT                   /db_xref="GOA:B9LYZ3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYZ3"
FT                   /protein_id="ACM18725.1"
FT                   /translation="MDSFEQIQRVLGRHRPRTGKPGDHAAVAMILRERRDGLSVLLIQR
FT                   SVNEKDYWSGQIGLPGGRTESADNGPMNTAQRETREELGLDLSVARYLGRLNDIAPSGL
FT                   NIVVSCFVYALRDEPVLHPAPQEVAEAFWFPLRNMDDPAGHARIRFLFKGRMRSFPAVS
FT                   IPGPRQRQLWGITYDLLHQLKKAMTPNRLL"
FT   misc_feature    417233..417462
FT                   /note="conserved nucleotide sequence; Geob_R5012"
FT   gene            complement(417518..417736)
FT                   /locus_tag="Geob_0357"
FT   CDS_pept        complement(417518..417736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0357"
FT                   /product="zinc finger protein, CDGSH-type domain
FT                   pair-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18726"
FT                   /db_xref="GOA:B9LYZ4"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYZ4"
FT                   /protein_id="ACM18726.1"
FT                   /translation="MTQAQGPIVLELEPGTYYRCTCGKAATPFCDGAHQVTDCTPISFE
FT                   VKEKQQVYLCNCGKTANAPFCDGSCAK"
FT   gene            complement(417758..418348)
FT                   /locus_tag="Geob_0358"
FT   CDS_pept        complement(417758..418348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0358"
FT                   /product="periplasmic protein YceI"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18727"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYZ5"
FT                   /protein_id="ACM18727.1"
FT                   /translation="MKRIVTSIAAIIALSLPVIASASSWKIDADHSNVGFKVRHLMVSN
FT                   VKGSFEKVAGVLELNDKDITKSKVDVTIDTASINTNAAKRDEHLRSADFFDVAKYPTMT
FT                   FVSKSVAKAGKKLKVTGNLTLHGVTRPVVLDVDALTKESKDPWGNFRRGTTATTTINRK
FT                   DFGLVWNAALETGGVAVGEEIAIILEIELIKNK"
FT   misc_feature    418571..418799
FT                   /note="conserved nucleotide sequence; Geob_R5013"
FT   misc_feature    418836..418898
FT                   /note="conserved nucleotide sequence; Geob_R2005"
FT   gene            complement(419009..419812)
FT                   /locus_tag="Geob_0359"
FT   CDS_pept        complement(419009..419812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0359"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18728"
FT                   /db_xref="GOA:B9LYZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYZ6"
FT                   /protein_id="ACM18728.1"
FT                   /translation="MNAAANTAQIVLEGVEKRFRSARGEMQTALTQVDLQIGAGEFVCL
FT                   VGPSGCGKTTLINLMAGFERPSSGLVTIDGKPVSGPDPDHIMIFQDYGLYPWRSVLGNV
FT                   LFGLQARGISAAEARPRALAALELVGLAHAAEKHPHELSGGMKQRVAIARALAVEPSIL
FT                   FMDEPFAALDAFTRLHLQDELLRIWEETRSTVVFVTHDLDEAIALGQRVVLMASGPGRV
FT                   QKVLNIPLAHPRDRTSDDFATVRRELFEEFHLVHKRAAMAAEYTI"
FT   gene            complement(419809..420576)
FT                   /locus_tag="Geob_0360"
FT   CDS_pept        complement(419809..420576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0360"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18729"
FT                   /db_xref="GOA:B9LYZ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYZ7"
FT                   /protein_id="ACM18729.1"
FT                   /translation="MNGFISKLARLALPLTSLIAFTLLWQVAARRYPPEQFPAPSDVVR
FT                   AIVELADMGTLWSHMGISLARFGAAYLLAVLAGIPLGLFLGRFIRCHKAIDPLIQVLRP
FT                   ISPIAWFPLAVLWFGIGNAPAVFIIFLASFYPVLLATISAVRAVPPVYLKVAGNFGARA
FT                   DMTFLRVIVPAAFPGIMVGLHIAVGTGWIHLVAGEMLGAQSGLGFMIVDARNFLRTDQI
FT                   MAGMLLVGLLGLAIYRGMKSLERIIGRRWGVSQ"
FT   gene            complement(420608..421561)
FT                   /locus_tag="Geob_0361"
FT   CDS_pept        complement(420608..421561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0361"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, aliphatic sulfonates"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18730"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYZ8"
FT                   /protein_id="ACM18730.1"
FT                   /translation="MNRRQFLKASGLALAATAAPGLIGSVFAGSKVNLKIGYLPLSDHL
FT                   LMIAAEREQFRTVGIKPVKFSSWPEIAEALKNGAIDGAFLLTPIALTLRQKGVPVKAVL
FT                   LGHRNGSAVTVRNNIGINRVEDLKGKTIAVPSPFSTHNILLRKLLTDKHMDPARDVKII
FT                   DMAPPEMLNALATGRIHGYIVAEPFGAQAEARNVGKILTLSKDIWPNHICCVLNLRETV
FT                   INSHPEAVQELVTGFTRTAAFIEGNPAAAAKASTRILGQRPELIEKVLTSPRDRLSFLN
FT                   LAPARADFAATQDYMIKFGIAKSKTDLAGYLDGRFA"
FT   gene            complement(421554..423581)
FT                   /gene="cooS-1"
FT                   /locus_tag="Geob_0362"
FT   CDS_pept        complement(421554..423581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cooS-1"
FT                   /locus_tag="Geob_0362"
FT                   /product="carbon monoxide dehydrogenase, catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18731"
FT                   /db_xref="GOA:B9LYZ9"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010047"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:B9LYZ9"
FT                   /protein_id="ACM18731.1"
FT                   /translation="MSRRQGFPSKADVIERTPDRAVREMLQHMGKIGIETPFDRFDTQK
FT                   PHCGFGLSGTCCKNCHMGPCRITAKSPRGVCGADAHLVVARNILRWTAAGVAAHGARGR
FT                   EVMLALKGAADGALDLPILGPDKVIATAKAFGIFEDGKTIKELAAEIAMILLDDLCRTL
FT                   PGPHRTLEAMAPPERLQVWRELDILPVGAYHEVFEALHRTTTGTDGEWENVTRQMLRCG
FT                   LAFAWSSVVGSAIAMDCLYGLPKRSRISTNLGAISEDTVNIAVHGHSPVLVAAIVKAAR
FT                   RSDLIAAARQAGAATIRLYGICCSGHSALAKFGDITPLTNAVGAELALATGAIDLWVAD
FT                   VQDVFPGIMDVAACFHTRVVTTSDSTRLPGAEHIAFDHHHSNLGEADTLAERIVRLGIQ
FT                   AYGGRQSGKVFIPAARMEAEVGFSVENILATFGGADTLLEHLRSGRIRGVVNLVGCNNP
FT                   KVVYEEAVVKVADELIAHDVLALTNGCAAYALLKLGFCLPEALSGAGQGLNSALTQHNL
FT                   PPVWHMGECLDNARASVFFRTISNAANEPLKRLPLAFSSPEWSNEKGLGAALGFRLLGL
FT                   NSYHCIAPPVDGSEKVARFIYEDTRELLGAVMVIDQDPVALARRIVADFDERRAALGWD
FT                   KGSEPATTRLSALQRQQEHSHAHLHGHPHTHNDTEDHNHE"
FT   gene            complement(423740..425257)
FT                   /locus_tag="Geob_0363"
FT   CDS_pept        complement(423740..425257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0363"
FT                   /product="serine carboxypeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18732"
FT                   /db_xref="GOA:B9LZ00"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ00"
FT                   /protein_id="ACM18732.1"
FT                   /translation="MFRFFILVAALLINTPYPAGAHQEPAAAAEAPPREMKQVEEKPVV
FT                   SSHRLSIGKKELNYQVTAGHLPVISDSGETEARIFFIAYTLENRQPENRRPLLFVFNGG
FT                   PGSSSVWLHLGTIGPKRVQMLPDGTMPPPPYRLTDNEYTWLDQADLVFIDPVGTGYSRA
FT                   AKPDLAKKFSSVQGDIEAVGKFVRLYLGRYGRWSSPLFLVGESYGAFRAAGLADYLLEH
FT                   GIAMNGTILISAIMNMQTVSFDPGNDLPYALYLPSYTATAWYHGKLATQAADPDKILQE
FT                   AEAWTENEYLTALAKGDRLSPDERKTIAGKLSQFTGLSPAFIEGHNLRIDSRTFVRELL
FT                   RDRQLVTGTMDSRFLAANVDPSSPHGFDPTVAAIRPPYTTLFNDYIRNEIGFRSDMEYF
FT                   ILGGGIGRWDWEAKNGYADTSEDLREAMAKNPYMKLFVAMGCFDLATPHFSTEYTLNHL
FT                   GLTPALRKNLTIRRYQGGHMMYLDLAALSRLTKDVTAFIDDSLAAAP"
FT   gene            complement(425370..426545)
FT                   /locus_tag="Geob_0364"
FT   CDS_pept        complement(425370..426545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0364"
FT                   /product="efflux pump, RND family, membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18733"
FT                   /db_xref="GOA:B9LZ01"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ01"
FT                   /protein_id="ACM18733.1"
FT                   /translation="MPHLSEPGKRPALGGHSLILWVLIIALAVTVFWSSHYRIDQSARG
FT                   AGTVIATSRVQVIQAVDGGVLKSLKVREGDSVKQGQVLAVLDQTRFAAQVMELDSRLAA
FT                   LHGQAARLRAEVTGASEIRFPTNLGRFPELLDVQKALFTQKRQSLDEELRTLGVAVRLA
FT                   REDARLVAELAKTGDVSRSEVIKAERALNDAEAQLINRKNKYYQDARAELAKTEDDIGQ
FT                   NEQVRTPRAQQLADSVMRSPVSGIVKNVRVTTQGGVLRAGEELLQIVPLDDVLIVEAKI
FT                   RPSDIALVKPDLKATIRFDAFDYTMYGSVDGTVSYVSADTIKEEGKTGELTYYRVHVAT
FT                   SAKPVKTTTGRTLEILPGMTAQVDIRTGDRTVLDYLLKPLRKTLTESMGER"
FT   gene            complement(426549..428696)
FT                   /locus_tag="Geob_0365"
FT   CDS_pept        complement(426549..428696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0365"
FT                   /product="ABC transporter, ATP-binding/membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18734"
FT                   /db_xref="GOA:B9LZ02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ02"
FT                   /protein_id="ACM18734.1"
FT                   /translation="MANSDGLKGPQATAITSGVLGKLLLMHGLPVPKGALAEACSTMQP
FT                   EDADILPAERLMGILRTVQKNGVQVVQLRWSRLDRRHLPVLVWHGGEWQIASHGSGRVV
FT                   TLAGEKGSAGPVPVAELEDAPVLWLQVETPDPAVGEVLKSSAAQLLLQEVLQEKRWLVE
FT                   VLIATAAVNLLAVASSLFSMQVYDRVVPTMAYTTLTALSVGMAIVVAVDWMLKHIRARI
FT                   VDTLAKQVDLAVSQRLFEHVMGLRLDARPRSLGSLAAQMSGLEPARGFFSSTIVFALAD
FT                   LPFCLLFIGLIAAIGGRVSIVYLVLLVIALVWGWVAQKQLRRLARQEITRGHERHGLLV
FT                   EMIQGAETIQAAGAGWRFAELWRTITATMGAHALQSRTITSTTLTTTGTLGTLAYVAAI
FT                   VVGVTRIEAGDLTTGGLIACTILGGRVIAPIAQGVQLQVQWYHVRESLAMVNRLLALET
FT                   GRPEDGSLLAPETLTDRLDLEGVRFAYPNSPVMRLQLPELHFAAGDRVVLLGPNGCGKS
FT                   TLLKVAAGLYRPSEGQVRLGGADIWELDSQVINERIGYLPQDIHLFKGTLKSNLLLGGG
FT                   ASDGKLLEVAQLLGIDRIAADNPRSMELEISEGGTGLSGGQRQLVGLARLFLAQPRVWL
FT                   LDEPTSSLDLESENRIIEALREAVRPTDILLIATHRPRLAVLANRVILMGRGRVIADGK
FT                   PEEVLQQQPRRGRRLVQTVGA"
FT   gene            complement(428711..429970)
FT                   /locus_tag="Geob_0366"
FT   CDS_pept        complement(428711..429970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0366"
FT                   /product="efflux pump, RND family, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18735"
FT                   /db_xref="GOA:B9LZ03"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ03"
FT                   /protein_id="ACM18735.1"
FT                   /translation="MAGWCRALLVCSLSLPLLPLPLSAQDAPRTEGIVAALRNAVALHP
FT                   SIKSRLNELNALDLELQSEKARRLPSLSLQAQALTDEQSQVFARVQQPLWVGGRIDGTI
FT                   EQAGMRLRSGHASLLALQRQLMEETAAAYAVLIGFSRRLAAIDRNVAEQEKLLGLISRR
FT                   QAGSIASEADVRLARARLTLAITQREQAKGELQRALADLQALTQEPVGPLLPIPDRLLA
FT                   LPDFTGIATGIVEASATVHQRQADVEVVRTEVELRRADLMPSLYARLDQNIYGRDGKRD
FT                   LPVTTKAGLVLEGSLEGAGLAGWKRIKSAEARIDAARKDVETARTDARRRAEMLLAVTA
FT                   SLQSVMESNELLVTATEETLASFMRQYDAGRKTWVDVLNAQRELSDARLALEQTRSSLQ
FT                   ENTLRLAVQIGKLDSIVIGP"
FT   gene            complement(429970..432549)
FT                   /locus_tag="Geob_0367"
FT   CDS_pept        complement(429970..432549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0367"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18736"
FT                   /db_xref="GOA:B9LZ04"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ04"
FT                   /protein_id="ACM18736.1"
FT                   /translation="MTDASFLEPAGCEDYSRRIPAGLQCGNAASQAKTPRTRAAHALTA
FT                   AMENERKTALAVLAEFPAPRDRDDRETLLSVGSAWFKLGAPQTAIPFLQRAWQGNDRHP
FT                   IVAARLGACLLAAGHVTEALPVLERAVDLLSGSGGAWLNLARGYLAVGEAEKALEALDR
FT                   AAPLPGKDEHLYRMSRVDALSRLDRQEEAESMMRQAFDRGDRGATAALVHLLGARGQHE
FT                   EAWHLLMDALGDMPDETDLMGLAAELAQVRGQFGEAAHWLKRALEKEPDNARLWSCLAM
FT                   LSSRHLGVNCAREAADTALALTEDTGGPLRAHALAAHAHVLAEGDQRAEAEGAYREALA
FT                   LAPRFAPALTGLGNLLMQRGRVEEATALYQTLKEIAPLQGWSQLIQAREVPEETAVLEQ
FT                   LALAARRPSLEGPVQSHLLFTLAAAWEKKEDYDRAWQFAAEANRAAQEHVSYRPEQHRA
FT                   RVEREMARFSAAFMGSRAGYGIRSRLPTFVLGMPRSGTTLVEQILGSHSKVFGAGELSL
FT                   IPELIRTFNAWEMKLGTRRSYPECIDDLGKEESRRFAEKHLAQLQAYAPTAERIVDKLP
FT                   HNFEHIGLIKLLFPDAAILHLKREPRDVAVSNFFTDYACKFSGMGFAYDLAWIGEQLVD
FT                   HQRLMDHWHRVFPGQILEVDYDALVEDVEGWARRIIDYLGLPWEDEVLSFRQLDRPVKT
FT                   ASVWQVRQPVYTTSKAKWKRYAEHLEPLESTLADIPPLPDPLPLPRVPAGLFLEGMAHL
FT                   QAGRFTDAEAAFRTLTAARPAHAAAHHFLGAALLQQQKPVEARKAMRRSVELLPIHRQW
FT                   LENLLAVEEALGNRREAEELAAMIAGRSDTGPCSPGNNSDHLASGAA"
FT   gene            complement(432549..435938)
FT                   /locus_tag="Geob_0368"
FT   CDS_pept        complement(432549..435938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0368"
FT                   /product="cadherin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18737"
FT                   /db_xref="GOA:B9LZ05"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ05"
FT                   /protein_id="ACM18737.1"
FT                   /translation="MAKKIVTDEAKLTSGMIAVREKGGHAIPVAPGDRGAQAFSPSMVK
FT                   KAFGNVEPEDQPQDDKKTIVAAVEGKEADGAVTAAMPVQAETAEPRPATGSDIAKTGDK
FT                   DEDRSSGNGGWWLLGGAGLAAVATGIGLAFSGDDSDGSPQGMHSNDTEVFNPANPGSSP
FT                   ANSGSNLANFMPNLGNYAVTLAENSAKGTPVGKVSATDADGDTITYTIIAGNDNGAFAI
FT                   DAASGAITVADASKLDFEATREFTLTVQASDGRLSDTGTVTINLVDRNDNAPVITSGSS
FT                   GTVAENAPTDTVIYQAAARDADTETTITYSLKPGEDTSLLTIDPGSGTVTLNNSADFET
FT                   KTSYTFTVIAGDGVNSSEQAVTVSVLNLNDNSPILTSGAGGSVAENAPISTVIYQAAAS
FT                   DADGDASFTYSLKPGGDADLLHVDSATGAVTLRSLADFESKPGYSFTVAVSDGIHTTEQ
FT                   EIAVSVTDVNEAPVITSNGGEATAAISVSENQAAVTTVTATDVDAGDSRTFSITGGADA
FT                   ALFAIDAETGALTFLAAPDREKPADVDHNNIYDVQVAVTDRGGLSDVQDLAVSVTDVRE
FT                   HVVVEASGTWLDLNANGIRDGEDRIRAVFTPGTGNVDLAAVHGVIHYNNIPSGAIDLNG
FT                   FGADDRIEIDAQAFIDNGHEGLQILTRPHITTLDAFAKFAISHSGKTDNGLEDLATGTR
FT                   YFNHNTYEALAAPPRTAGVSLTLHDAGNLHFKSNDGPTAIEGQLASGLPSGVPLQQVVD
FT                   FVHLPEKPAVIHVVVERDGAVIDTDGDGVRDSGENRLAVFDAGGSADLGGTAGVTVHFN
FT                   DVPLNALNLTGFGADDKVELDVQALEQHNVLRSATRLAGLTALTTITNILNPIRVGYTF
FT                   NSAGSSPARLIVRETPLSIPFNGLPANANAVMGIADMGANKGNGALAYWSDSGNALNDA
FT                   RHILPSYTGNNEGGVLETLNSNAPHGGLVDFVWPENVMVDGSGAWIDANGDGRRDAGET
FT                   TAVDLKGDLAANPVTVHVNGIPTTPLDFSGFGSDDRLVVDMDALRHGNDQRVLASQLTA
FT                   AGRPWTDGYGFSGGTAGAGGKTGVFLAGNTLKFGHGTPGTGTVSLQYTAAGEREGIIAL
FT                   DARALAHHFDQVMFVDSGAGPA"
FT   gene            complement(436293..437327)
FT                   /locus_tag="Geob_0369"
FT   CDS_pept        complement(436293..437327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0369"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18738"
FT                   /db_xref="GOA:B9LZ06"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ06"
FT                   /protein_id="ACM18738.1"
FT                   /translation="MIHSPSLIHRRPRPGLAACCRAAILAVAIFMLGQAAAVSAPAGMV
FT                   LEKGTAYGAAPEQSIQDGLSDSEDSVSLPLLGTVETSRLSLPVLTLVIAGLDSFNPCAF
FT                   FVLFFLLSLLLHAHSRKRMVIIGGIFVLFSGLLYFVFMAAWLNFFLLVGRLKYIAAVAG
FT                   AVAIVIATINIKDYFFFKRGISLTIPEQAKPRLFERMRNIMRAGSVPAMLAATIFLAFT
FT                   ANLYELICTAGFPMIYTRALTLQPLPMPVYYLYLALYNVVYVIPLAGIVALFAITLGSH
FT                   RLSERHGRVLKLLSGVMMFLLGLILLIKPHLLASAVASAAVLVVALVTSGLIVRLAPQN
FT                   NEKT"
FT   gene            complement(437336..437488)
FT                   /locus_tag="Geob_0370"
FT   CDS_pept        complement(437336..437488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18739"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ07"
FT                   /protein_id="ACM18739.2"
FT                   /translation="MGVLKRFGERYRKRRKEAIPSANCEVCGERLDMDRENGEEHCPVC
FT                   ENPEQ"
FT   gene            437758..439056
FT                   /locus_tag="Geob_0371"
FT   CDS_pept        437758..439056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0371"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18740"
FT                   /db_xref="GOA:B9LZ08"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ08"
FT                   /protein_id="ACM18740.1"
FT                   /translation="MAATIDLMDKLKTLAEGAKYDVSCASSGSHRRNRDGIGNAASCGI
FT                   CHSWTADGRCVSLLKILMTNCCIYDCAYCVNRRSNDIPRTGLTPAEVAELTIGFYRRNY
FT                   IEGLFLSSGVVGSPDRTMELLIAAVRTLRETYRFNGYIHLKLVPGADPLLVQQAGLVAD
FT                   RVSVNLELPTRESLALLAPDKSREAVVEPMRQVSSLIVTNRAERKESRKVSPFAPAGQS
FT                   TQLIVGASGESDRQIVTLSEQLYGKMDLKRVYYSAYIPVNDDRRLPARPLSPLRREHRL
FT                   YQADWLLRYYGFSAHELLDEQCPNLESDLDPKTCWALRHRELFPVEVNRAEYGVLLRVP
FT                   GIGIRSAQRIVAARRQGSLCLDDLPLLGVVMKRARYFLTARGRYAGDCSPESAMLRSRL
FT                   MAAPAKRDQGQLSLAFPEAAETEAVASVIRGEL"
FT   gene            439053..439802
FT                   /locus_tag="Geob_0372"
FT   CDS_pept        439053..439802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18741"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ09"
FT                   /protein_id="ACM18741.1"
FT                   /translation="MMGGDYCYDGSDAGLLTLLADIVPRGIEPRTIGVEPPQQEDLFAA
FT                   PVLVATDQELAERFWVELTRRLPPVSLEQLHRAWYADHPGRELVICRFMLLVWREGGRA
FT                   GAMLAHPYVVPLWKLAQQVGREAHRYLGFVRFQETTSGYYYASLEPDHRVLSLIAGHFA
FT                   DRFRDQHWVIHDVRHGEGIVYDCTRRRWLLLPMMTEGDPELTPAEETFQRLWRSYFAVL
FT                   AIGERENLAMQQGKVPLKVRPWLVEFR"
FT   gene            complement(439969..440044)
FT                   /locus_tag="Geob_R0002"
FT   tRNA            complement(439969..440044)
FT                   /locus_tag="Geob_R0002"
FT                   /product="tRNA-Asn"
FT   gene            complement(440096..440683)
FT                   /gene="mglA"
FT                   /locus_tag="Geob_0373"
FT   CDS_pept        complement(440096..440683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglA"
FT                   /locus_tag="Geob_0373"
FT                   /product="cell polarity determinant GTPase MglA"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18742"
FT                   /db_xref="GOA:B9LZ10"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ10"
FT                   /protein_id="ACM18742.1"
FT                   /translation="MSFINYASREINCKIVYYGPGLCGKTTNLQFVYQKTAADAKGKMI
FT                   SLATETERTLFFDFLPLALGEIRGFKTRFHLYTVPGQVFYDASRKLILKGVDGVVFVAD
FT                   SQEERMEANIESVENLRINLTEQGYDLDKIPYVVQYNKRDLPNVVSIEELRKELNPTNV
FT                   PDFEACATTGEGVFETLKAVAKLILVDLKKGK"
FT   gene            complement(440704..441195)
FT                   /gene="mglB"
FT                   /locus_tag="Geob_0374"
FT   CDS_pept        complement(440704..441195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglB"
FT                   /locus_tag="Geob_0374"
FT                   /product="cell polarity determinant GTPase-activating
FT                   protein MglB"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18743"
FT                   /db_xref="GOA:B9LZ11"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ11"
FT                   /protein_id="ACM18743.1"
FT                   /translation="MSNPQMVMYDEEFKQINAVIEKLLKEANSKVIFLVDKNGQLITGV
FT                   GETERFDTTSLASLTAGNIAATGGLAKLIGEKEFSILFHEGEKDNLHISIVGGRVILVV
FT                   LFDNRSSLGLVRLRVKKASEELTTIFGRLMQKAEEKEKSGETDFPFAEITDDDIDNLFS
FT                   "
FT   gene            complement(441347..444928)
FT                   /gene="por"
FT                   /locus_tag="Geob_0375"
FT   CDS_pept        complement(441347..444928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="por"
FT                   /locus_tag="Geob_0375"
FT                   /product="pyruvate:ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18744"
FT                   /db_xref="GOA:B9LZ12"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ12"
FT                   /protein_id="ACM18744.1"
FT                   /translation="MSRRMVTIDGNTAAAHVAHATNEVIAIYPITPSSVMGEISDEKSA
FT                   NGEKNIWDTVPLVTEMQSEGGASGAVHGALQAGALTTTFTASQGLLLMIPNMFKIAGEL
FT                   TSTVFHVSARAIAAQALSIFGDHSDVMACRSTGWAMLCSNNVQEVMDFALIAQAATLRA
FT                   RVPFVHFFDGFRTSHEVQKVEELTFDDMRAMINDDLVLAHRARALSPDHPVMRGSAQNP
FT                   DVYFQGRESVNQYYGPTIGIVQEEMDKFAKLVGRQYKLVEYVGAADAERVIIVMGSAAD
FT                   TIHETVETLVAKGEKVGLLKIRLFRPFPTDAFVAAIPASVKKIAVLDRTKEPGSLGEPL
FT                   YLDIRTAIGEAMADKKTSFTQYPVIVGGRYGLGSKEFTPAMAKSVFDNLKEDKPKSNFV
FT                   TGIKEDVCNTSLAFDPSFANAAAGTYSAMFYGLGSDGTVGANKNSIKIIGEKTDNNVQA
FT                   YFVYDSKKAGSVTTSHLRFGKNIIRSPYLIDRADFIACHNFTFLEKYDMLSKAKEGSTF
FT                   LLCSPFDKDQVWDKMPVEVQQQIIDKKLKFYVINAIKLGEELGLGARINVIMQTAFFKI
FT                   SSIIPLEIALDAIKDAIKKSYGKAGEKVVDMNNKAVDAALENVFQVTVPATASSQLKKP
FT                   PVVGSHAPAFVQDVTAEIIAGRGDDLPVSAMPSDGTFPTATSQYEKRNIAVDIPVWDES
FT                   LCIQCGICSFVCPHATIRMKAYDPSLLGKAPKTFKSVDAKGAEFAGKKFTLQVAPEDCT
FT                   GCAACVHNCPAKSKEKPNHKAINMQFQPPLREAEAENYDFFLSLPETEAKLVKRETLKG
FT                   SQLIRPLFEYSGACAGCGETPYLKLMSQLFGDRALIANATGCTSIYGGNLPTTPWAKRA
FT                   DGRGPAWSNSLFEDNAEFGFGMRLTVDKFTEAATELLDELMNCGCKSCASLIGTMKEIR
FT                   NADQSTQEGIEAQRERVATLKKGLETCTEPAAKRLISLADYLVKKSVWIVGGDGWAYDI
FT                   GYGGLDHVIASGKNVNLLVLDTEVYSNTGGQASKSTPLGAVAQFAAGGKAMPKKDLAMI
FT                   AMAYGNVYVAKVALSNPAQVVKAFIEAEAYDGPSLIIAYAHCIAHGIDMTTAVDEQKNA
FT                   VASGHWPLIRYNPELAAEGKNPLQLDSKAPTISFEQYAYGENRYRVLKKSNPEAAAALM
FT                   KQATQWTSRRFELYEKMAAMSYDADKK"
FT   gene            complement(444983..445576)
FT                   /gene="recR"
FT                   /locus_tag="Geob_0376"
FT   CDS_pept        complement(444983..445576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="Geob_0376"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18745"
FT                   /db_xref="GOA:B9LZ13"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ13"
FT                   /protein_id="ACM18745.1"
FT                   /translation="MIHFSRSLTRLLGELKKLPGVGDKTALRLAFHLLKSPDNLTALAE
FT                   SLLEVKAGVRFCSVCFGITEDDPCHLCSTERDRTTICVVEEPQDILAMERSRAFKGRYH
FT                   VLHGALSPLNGITPGDLKIAELMKRLESGAIREVLIATNFTVEGEATALYLTRLIKPLS
FT                   IRVTRLAHGIPLGSDLEFIDAATVQRAVEGRSEL"
FT   gene            complement(445751..446065)
FT                   /locus_tag="Geob_0377"
FT   CDS_pept        complement(445751..446065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0377"
FT                   /product="DNA-binding protein, YbaB/EbfC family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18746"
FT                   /db_xref="GOA:B9LZ14"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ14"
FT                   /protein_id="ACM18746.1"
FT                   /translation="MSKGLASIMKQAQMMQQKMGKLQEEASQKTVEATAGGGAVTAVVN
FT                   GKNQLLALTIKKEAVDPEDVEMLQDLVVAAVNEALTKVQSEMAEQMSKITGGINIPGLF
FT                   "
FT   gene            complement(446134..447864)
FT                   /gene="dnaX"
FT                   /locus_tag="Geob_0378"
FT   CDS_pept        complement(446134..447864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="Geob_0378"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18747"
FT                   /db_xref="GOA:B9LZ15"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ15"
FT                   /protein_id="ACM18747.1"
FT                   /translation="MSYLVLARKWRPQTFSDLIGQEHVSRTLQNAIDTGRIAHAFLFTG
FT                   ARGVGKTSSARILAKALNCEHGLTTEPCNSCPSCSEITDGNSVDVFEIDGASNTGVDDI
FT                   RELRDNVKYLPSKSRYKIFIIDEVHMLTNNAFNALLKTLEEPPAHVKFIFATTEPHKLP
FT                   ITILSRCQRFDFKRIPLQKIVDRLRYIVDQEKVSISSDALAIVARKGDGSMRDSLSTLD
FT                   QVLAFCGENVADDDVASLLGVVDRRLLLEASQAVFSRDNKSVLEIVKQVDSFGYSMRQF
FT                   CQELIDHFRNLAILRAIDNASDILDLSETECSELKNLAATVATADLQRHLTILLKAENE
FT                   MAHSNFARLVLEMALLKMAALAPVIPVNEILDRLKALESGTTLPSVASSSPVWEKSQPV
FT                   AAQQNATTRTPSPPQKIEERQPKREPLEAAAQSAPTADETAAPHVDSTWPGFVTFVKGK
FT                   KPVLATFLEVGRPITVSGKLVEVGYAEGSFELSKMQDADSMEDLKTLSHAFFGSQPTIR
FT                   FKSLSGETVGAPPSLQEKKSLEETKRKQQLKEKALAHPAINAALEVFGGQVNEVSELNK
FT                   "
FT   gene            complement(447946..448047)
FT                   /gene="ffs"
FT                   /locus_tag="Geob_R0003"
FT   ncRNA           complement(447946..448047)
FT                   /gene="ffs"
FT                   /locus_tag="Geob_R0003"
FT                   /product="signal recognition particle, RNA component"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(448101..448191)
FT                   /locus_tag="Geob_R0004"
FT   tRNA            complement(448101..448191)
FT                   /locus_tag="Geob_R0004"
FT                   /product="tRNA-Ser"
FT   gene            448355..450595
FT                   /gene="pcrA"
FT                   /locus_tag="Geob_0379"
FT   CDS_pept        448355..450595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="Geob_0379"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18748"
FT                   /db_xref="GOA:B9LZ16"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ16"
FT                   /protein_id="ACM18748.1"
FT                   /translation="MNLLHNLNPPQKDAVLHGEGPLLILAGAGSGKTRVIVHRIAYLIT
FT                   ERGVPPWQILAVTFTNKAAAEMRGRVEKLLPGGETPLISTFHSACARILRREIHHLGYD
FT                   SSFAIYDDKDGEKLIKEIVAELHLDEKRFPAKLFTAAIDECKNAGRTPDDLPMGDYMAD
FT                   KIGQVYAAYQKRLQQCNALDFGDLVLLTVRLFEEFPEVLARYQDRYRWIQVDEYQDTNP
FT                   IQYRLVKLLAGNRQNLCVVGDDDQSIYRWRGADIRNILDFEDDFPRVKVVKLEQNYRST
FT                   STILSAAGAVVAKNRGRKAKTLWTENPPGEPVVYRRLMDEREEARFVCRQIEQYVRKGG
FT                   DLAGVAVFYRANAQSRVVEDAMVADGIPYHMIGGMRFYARQEIKDILAYLRVLVNPADE
FT                   VSLKRIVNTPARGIGHATMEKITELARRKGILLYEALSEAAEGGLLAAGPRGKIAGFVE
FT                   LLEQFRQLMDAVPLTELTSRIIQETGYAMKLKEERTDEAQDRLANLEELLSALEEFERR
FT                   TEERTLAAFLEQVALISDLEQEGKGSESATLMTLHSAKGLEFPLVFMIGMEEKLFPHSR
FT                   SLEEPEQMEEERRLCYVGMTRARERLFLTNARRRRIFGQEQYNPPSRFLADIPRELLDV
FT                   EDEGYQQPTFGFGSGLGAMPPCEPAVAKGPVHNLASVFEMELEPELANEVQVVPDETVD
FT                   GVWLGMKVRHGKFGVGTVRRIEGSGNEQKVIVWFNSIGPKKLLVKFAGLERV"
FT   gene            450751..451038
FT                   /gene="gatC"
FT                   /locus_tag="Geob_0380"
FT   CDS_pept        450751..451038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="Geob_0380"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18749"
FT                   /db_xref="GOA:B9LZ17"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ17"
FT                   /protein_id="ACM18749.1"
FT                   /translation="MKINKDEVEKVALLARLELTGEEAEMFTGQMDAILAYVDKLNELN
FT                   TDGIVPTAHAVPMENAFRADEVRDSIGIDNALANAPKRAESFFRVPKVIE"
FT   gene            451092..452549
FT                   /gene="gatA"
FT                   /locus_tag="Geob_0381"
FT   CDS_pept        451092..452549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="Geob_0381"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18750"
FT                   /db_xref="GOA:B9LZ18"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ18"
FT                   /protein_id="ACM18750.1"
FT                   /translation="MELFELTIHELHDKLKKKEVSSVEATESMLARIEAVEPKVNAFIT
FT                   VTADQALKDAAEADKRIADGDMDKLTGIPVALKDIFLTKGVRTTCASRILENFIPPYDA
FT                   TSVARLKARGAVLVGKLNQDEFAMGSSTESSYFGKTSNPWNLECIPGGSSGGSAAAIAA
FT                   QQATATLGTDTGGSIRQPASHCGCVGLKPTYGRVSRYGVIAYASSLDQVGPVTRDVTDC
FT                   AIMLEAVAGYDAKDSTSVDLPVPEYTKALTGQVKGLKIGLPREYFIEGLDPDVQKAMDE
FT                   AIATYRQMGAEFQEVSLPHTDYAVATYYLVATAEASSNLARYDGARFGHRSHEAQSLLD
FT                   MYRKSRAEGFGEEVKRRIMLGTYALSSGYYDAYYLKAQKVRTLIMHDFIKAFEQVDVLL
FT                   TPVAPTPAFRIGEKTSDPLQMYLSDIFTIPVNLAGTCGISVPAGLSRAGLPIGLQLIGK
FT                   PFGEENILRAAHAFEQNTDWHKRRAAL"
FT   gene            452572..454011
FT                   /gene="gatB"
FT                   /locus_tag="Geob_0382"
FT   CDS_pept        452572..454011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="Geob_0382"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18751"
FT                   /db_xref="GOA:B9LZ19"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ19"
FT                   /protein_id="ACM18751.1"
FT                   /translation="MEYRAVIGLEVHVQLNTNTKIFCGCSTKFGAEPNSQTCPVCLGMP
FT                   GALPVLNRKVVEYAIKAGLATNCEIAPRSIFARKNYFYPDLPKGYQISQYELPICSAGH
FT                   LDIQVEGTAKRIGITRIHMEEDAGKLVHADVPGVGDDSCVDLNRACTPLLEIVSEPDLR
FT                   SADEAVAYLKKLHQIVVYLGISDGNMEEGSFRCDANVSVMRVGADKFGTRTETKNVNSF
FT                   KFVKQAIEYEIERQIEVIEDGGKIVQETRLFDPNTGVTRSMRGKEEAHDYRYFPDPDLV
FT                   PLVISNDWVEDVRLGLPELPEAKRLRYMDELGLPAYDAEVLTASRELADYFEACLEFHS
FT                   QPKPVANWVMGEVTRALNEENRSITDAPVTPQLLAELLQLIDKGTISGKIAKTVFDEMW
FT                   RTGKAPAKVVEEKGLVQVSDTGEIEKIIDEVLAREAGQVAEYRSGKDKLFGFFVGQVMR
FT                   ASKGKANPAVVNELLLKKLQG"
FT   misc_feature    454034..454203
FT                   /note="conserved nucleotide sequence; Geob_R5014"
FT   gene            454237..455277
FT                   /gene="mtnA"
FT                   /locus_tag="Geob_0383"
FT   CDS_pept        454237..455277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnA"
FT                   /locus_tag="Geob_0383"
FT                   /product="S-methyl-5-thio-alpha-D-ribose-1-phosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18752"
FT                   /db_xref="GOA:B9LZ20"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ20"
FT                   /protein_id="ACM18752.1"
FT                   /translation="MSFRTIEWRDNKVVMIDQTRLPGEEVYNVYEDFQSVAEAIRGMII
FT                   RGAPAIGVAAAMGVALGAREIIADTYESFSRQLTNVCDVLARTRPTAVNLFWAIERMKR
FT                   VAESNKDRDLHFIRETLKAEAIRIEEEDLEICRAIGRHGAPLIREGATVLTHCNAGGLA
FT                   TAGYGTALGVIRAAHEAGKNIQVFADETRPWLQGARLTAWELMKDGIPVTLIADNMAGY
FT                   FMKKGAITACVVGADRIAANGDTANKIGTYSVAVLAKENKIPFYVAAPVSTLDLSLKSG
FT                   DEIPIEERHACEVTHLQGLPVAPEGVKVRNPAFDVTPAKYIAGIITEKGVVRGDYEREL
FT                   KALVGQ"
FT   gene            455274..458447
FT                   /gene="glnE"
FT                   /locus_tag="Geob_0384"
FT   CDS_pept        455274..458447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="Geob_0384"
FT                   /product="glutamate--ammonia ligase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18753"
FT                   /db_xref="GOA:B9LZ21"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ21"
FT                   /protein_id="ACM18753.1"
FT                   /translation="MIRNGQFADELQAALACDPECDGDRLLIAFLEKKGYAYGPRSATN
FT                   LRLLAYIFDTEILSAIALGALATPTPDMALNNLERISCIVSKDELLTICGKKVMLARLL
FT                   TICGSSPFLTNIICRDQSYFHELFTCKGIDLRRSEADMLAALRRQMGPHVAWQDIFPLL
FT                   RRFKLTEILRIAARDLNGLAPLEEVTAELSSLAAACLQVAYEEARRQLVAEHGLPLMQT
FT                   PEGEADLTIIGMGKFGGRELNFSSDIDIIFFYSSDHGETSGIVDGQGQTRGNISLHAFF
FT                   VKLAEMVSKAVSQVTEDGFVFRVDLGLRPEGKSGDVATSIRSAEIYYESWGQSWERAAM
FT                   LKARPVAGSLELGEKFLAAIQPFVHRKYLDYNLIEDMMAMKKKIDASLARSQEGEYNIK
FT                   LGRGGIREVEFFIQALQLVYAGKNPALRVKNSLQALETLRDARIITAEDCADLSEAYRF
FT                   LRFVEHRIQVVQERQTHSLPRKEDEMLALARRCGYLRPNGLAKFSEVLESHRRRVSAIY
FT                   GALFLSRDERLKEEVQPEVYFFFDRKADPDLIKDMLAERRFENVDAAYENLLMLRDGPP
FT                   RAHLTERGRRMLENIAPLLLQEIFSSPDPDMALTNLERFLCAVGSRSTFFALLAENKEI
FT                   LKLMVSLFGMSEFLSKIFISHPELLDSMVSRSYATSMKNLAVMEGELASLLEQAEDFEE
FT                   KLDTLRRYRHEEFLRIGLNDIYGKMGQTEIAVQLTTLADVCLAAACRMAKQELHRFGRP
FT                   TYKEQDDSVQQAHFAVLAMGKLGGNELNYHSDLDVIYIYDHQGMTDGEKQITNHEYFAK
FT                   LAQKIILILTTQTREGYVYKIDTRLRPSGNAGPLVTSLDSFVNYHREDAQIWERQALTR
FT                   ARVAFGIGSLKSKVEEIVHQAVYGTGCGDEVRKEIHRLRMRMENELAKESEGSYNIKTG
FT                   RGGIVDIEFIVQYLQLKHGVACPEIRSTNTLVAMKGMKACGLIGEEPFNVLQSGYKFLR
FT                   RLENRLRIIHDYSMNDLGGPAKYLNKLARRLGYDPQLKHPGEALIRDYEQITGEVRRVY
FT                   DHIFVVEGE"
FT   gene            458449..458835
FT                   /locus_tag="Geob_0385"
FT   CDS_pept        458449..458835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0385"
FT                   /product="acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18754"
FT                   /db_xref="GOA:B9LZ22"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ22"
FT                   /protein_id="ACM18754.1"
FT                   /translation="MEIRVYYEDTDVGGVVYHANYLHYFERARTEFFRRRGLSVRELHE
FT                   RGCIFPVVRAEVDFRAPARHDDLLRVETEVLEVGKSSFVLGQQVIRAVDDMLLVTGTIK
FT                   LVCVGPGMKAKRLPADLLEAFRGE"
FT   gene            458873..459121
FT                   /locus_tag="Geob_0386"
FT   CDS_pept        458873..459121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18755"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ23"
FT                   /protein_id="ACM18755.1"
FT                   /translation="MKTIILLCAITTILAGCSSSSQPQGGEKYQGREETKKLEGASAVG
FT                   YDGTAIRKNVDNTLNKNDDRNQDLDEAMKSASDGQKP"
FT   gene            459287..459562
FT                   /locus_tag="Geob_0387"
FT   CDS_pept        459287..459562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0387"
FT                   /product="toxin, RelE family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18756"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ24"
FT                   /protein_id="ACM18756.1"
FT                   /translation="MKWTVTFTGKARKQKEKLPLKIRELLFQLAKDIEASGPVRGDWPN
FT                   YGKLVNNRHHCHLKKGHPTYVAVWTEDRGAITVEIIYAGTHEKAPY"
FT   gene            459531..459881
FT                   /locus_tag="Geob_0388"
FT   CDS_pept        459531..459881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0388"
FT                   /product="antitoxin, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18757"
FT                   /db_xref="GOA:B9LZ25"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ25"
FT                   /protein_id="ACM18757.1"
FT                   /translation="MRVHMKKHPTEEIVTVTLRVPRSKVLLLRQYAESIKAGDEKNFSI
FT                   AETFPEYMGKEQEVALRAYRNREGLTQKRLAEMTGIPQHHISEMENGKRSIGKERAKRL
FT                   AEALNCDYRRLL"
FT   gene            460008..461183
FT                   /locus_tag="Geob_0389"
FT   CDS_pept        460008..461183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18758"
FT                   /db_xref="GOA:B9LZ26"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ26"
FT                   /protein_id="ACM18758.1"
FT                   /translation="MGILSNTVSICQFRVAGDFPAGDLFQWASQRLAGNGFKSIDQGTA
FT                   ELSVGWVHLDDHRQSDFAAPGAFWRDHYLVFTLRRDQRRLPAALVKAYQQVAEHEYLAE
FT                   NPGLSRVPKQKKEDMKEAVRSMLLAKTLPVPSTWDAVWDTRTGLVTFASLSPAIIELFE
FT                   GQFKKTFEGLRLVAVHPYARAEQVVTEALKPALAQANQAGSDAALDLIRSNQWLGWDFF
FT                   LWVMFRTMHDTSEYRITCGGHGEMNEPFAAYVNDRLVLLSSGENGQQKITVAGPQDHFS
FT                   EVRTALQNGKRITEATLYLEKEEHTWRVTLKGELFHFASLKAPAVRLEKDDSVDEHSEK
FT                   EAVFFERMFVLEQGLQLFDSLYSIFLELRLGSGWEEESTRIGKWLAESDAL"
FT   gene            complement(461574..462065)
FT                   /gene="lspA"
FT                   /locus_tag="Geob_0391"
FT   CDS_pept        complement(461574..462065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="Geob_0391"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18760"
FT                   /db_xref="GOA:B9LZ28"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ28"
FT                   /protein_id="ACM18760.1"
FT                   /translation="MSFKYIVFSAIAVLVIIIDQLTKLYIDRVMDLHSSITVIENFFNI
FT                   TYMRNKGAAFSFLSNFSYRIPFFILVSVVAILVILSVVYRLRQDQKFAVVSLALIFAGA
FT                   LGNLIDRVRLGEVIDFLDVHWYRHHWPAFNVADSAICVGVFLLAVDMYLEERRQKKQGP
FT                   "
FT   gene            complement(462086..464860)
FT                   /gene="ileS"
FT                   /locus_tag="Geob_0392"
FT   CDS_pept        complement(462086..464860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="Geob_0392"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18761"
FT                   /db_xref="GOA:B9LZ29"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ29"
FT                   /protein_id="ACM18761.1"
FT                   /translation="MDYKDTLNLPVTDFPMKANLAQREPEMLETWEKNRLYKKMEDTGK
FT                   GKPKYILHDGPPYANGHIHIGHALNKILKDIVLKSKRMSGFDAPYIPGWDCHGLPIELQ
FT                   VEKNLGSKKHEITKLEMRKQCREYAKKFVDIQKQEFERLGVLGEWDNPYLTMNYSYEGI
FT                   TAHELARFAENGGLYKGKKPVHWCSSCGTALAEAEVEYADHKSPSVFVKFQLKDDISKE
FT                   LPALSGKKVSPVIWTTTPWTIPANLAIAMHPEFDYVAVDTGAEVLIVAEGLKEAFFKAT
FT                   GVNGVVIATFKAAALEKKLCRHPFYDRDSIILLGDHVTLEAGTGCVHTAPGHGQEDYEL
FT                   GLKFGLDIYNPVDNRGRFLETIPFFGGQYVFDANPNVIAKLEEVGALVGKGEISHSYPH
FT                   CWRCKKPIIFRATEQWFISMESNDLRRKALTEINTVSWIPKWGKERIFGMIENRPDWCV
FT                   SRQRNWGVPITVFYCKACGEALADGKIMHHVADLFEKESSDIWYEREAKELLPTGTTCP
FT                   ACGKTEFDKEMDILDVWFDSGVSHAAVLEHRDNLSSPADMYLEGSDQHRGWFHSSLLAS
FT                   VGTRGVAPYKAVLTHGFVVDGSGRKMSKSVGNVVAPEDVIKKYGAEVLRLWVAAQDYRD
FT                   DLRISQEILTRLSEAYRRIRNTCRYILGNIADFDPKRDSVDYGDMPEIDRWALHQLELL
FT                   KEKVLKAYENCEFHVLYHAVNSFCTVEMSAFYLDILKDRVYTSRKDSVERRSAQTAMYQ
FT                   ILDALVKLTAPVLSFTTDEVWRYMPAPAEESVHLSQFPQLKPEYRDNALVERWETIIKV
FT                   RAEVSKALEQARVQKVIGHSLDAAIALSAPAQLRSLIEPYAAELKSIFIVSKAELVDTL
FT                   GGDFYSAEGIADLQIKVSAAPGEKCERCWCYDEELGKDSEHPGICPKCLSAVK"
FT   gene            465015..466835
FT                   /locus_tag="Geob_0393"
FT   CDS_pept        465015..466835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0393"
FT                   /product="Kup system potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18762"
FT                   /db_xref="GOA:B9LZ30"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ30"
FT                   /protein_id="ACM18762.1"
FT                   /translation="MRDDHSESFWGGIVKAMGLVFGDVGTSPIYTLTVVFALTPATRSN
FT                   VFGILSLVFWTMTILVTVEYAWLAMGLGRKGQGGEIVLREIILKLVKSSRLVAFAGFLS
FT                   FLGVSLLLGDGVITPAISILSAVEGLLLIPSFSGLSQSILVAIAAAIAIGLFLIQHKGT
FT                   DKVAGAFGPIMVVWFGSLALSGLISISAMPEIVSAVSPHHAFLFFRENGFSGFFVLSEV
FT                   ILCSTGGEALYADMGHLGRRPIVRAWYFVFVALFLNYLGQGVFALHHPGAKNLLFSMVQ
FT                   DQAPILYVPFLLLTIMATIIASQAIISGVFSIVYQGITTRLMPLMKVDYTSSHLKSQIY
FT                   IGAVNWGLMVAVIIVMMVFKASSNLAAAYGMAVTGSMTITGIMMIIVFSHTLKKWKVPI
FT                   AVLVTLLDVIYLSSTFSKIPHGAYWSIILASVPFITIMIWTKGQRALYRALKPLDIDTF
FT                   LVSFEQIYAKGKNIPGTGLFFTKDWQTIPPYVVHCMIRSNIIYERNVMISIVRTDEPFG
FT                   LAINHKTDITAGFEGFEVVLGYMEIIDIESILKEHGIREKVIFYGIEDIATANPVWRLF
FT                   ALLKKLTPTFVQFNKLPASRLQGVVTRVEM"
FT   misc_feature    466921..466951
FT                   /note="conserved nucleotide sequence; Geob_R6103"
FT   gene            complement(467010..469340)
FT                   /locus_tag="Geob_0394"
FT   CDS_pept        complement(467010..469340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0394"
FT                   /product="ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18763"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ31"
FT                   /protein_id="ACM18763.1"
FT                   /translation="MTDLHQALQHIKGSVSGWEQREPLPFEEFLQLLAARPEQLVRNVF
FT                   QVFHDMVVSQVTEKADEYPEDPESIHYVSYDCSKLFVENADHPFFADRLFANRLINLVE
FT                   AWRRGAQQNKIYIFEGPPGSGKSTFLNRLLIKFEEYANSDEGLRFETVWRLDRQKFGGI
FT                   PRHETSHFLDRLSKLIDEYEFDQNQIIEAQSSMQERDDFVEVVCPSHDSPILMIPKDFR
FT                   RQFFQNLFGNDESKLHLLDEKAYEWVFRNQPCTICSSLYLALLRKLKDPAEVLKMVYAY
FT                   PYRFNRRLGEGISVFSPGDKPMKHMVFTNDMLQNRLNSLLRDSNQVNYIFSQYAKTNNG
FT                   IYALMDIKSHNTDRLIELHNIISEGVHKVEDLEENVNSLFIALMNPEDKKNIENFPSFS
FT                   DRIQYIKIPYVLDLNTEVEIYRNIFGKQIDDSFLPRVLHNFARIIISTRMQRHSDAMQE
FT                   WIPDPAKYAMFCDENLQLLKMEIYTGYIPPWLDEEDRKRLMAKRRRKIIAESEIEGESG
FT                   FSGRDAINIFNDFYSTYARKDALINMSVLSNYFTKVRPDLGHLVPEGFIDSLLRLYAYT
FT                   VLQEVKESLYYYNEEQISREIRNYLFSINFEPGRTETCRFTGDRLEISESFFEGIENRL
FT                   LGPKVERETRLTFRGQTQKEYTARTLTQEILAEGKDVTRTSLFQELRERYIFNLKEKAL
FT                   DPFLENANFRRAIKDYGRPEFKTYDKKIRNDVTFLINNLCSKFRYTKNGAREVCLYVID
FT                   TDLARRFSRNSPEPAKETTLTSD"
FT   gene            complement(469333..470979)
FT                   /locus_tag="Geob_0395"
FT   CDS_pept        complement(469333..470979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0395"
FT                   /product="SpoVR-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18764"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ32"
FT                   /protein_id="ACM18764.1"
FT                   /translation="MELISQHAKQIMEGCKERAKDAGLRFQDETLEYIVTNRDMLELSP
FT                   KAMIPTLYDYWVHDVEVLKGLRKYELYPYNPYETVINTRPPISFYNDNNPDWLNVMIFY
FT                   HVLAHIDFFQNNLFYRLTWDYDLNGQALADKRLIARLRSEKGRWVDYVIEFGRAVDNLV
FT                   GYFDELSRASRALVPSLSSNVDYYFDTFLQSVKKVRIQEYVKEVERYNQAMAQYGELGE
FT                   KTFFADTLKKHPELEAVFSRQAPEKGKPRLDLLQHLMEYSPFLNRDENKWMKSVLEIVR
FT                   NTSVYFQPQIRTKIMNEGWASYWHEKLFLLDDRIREHEVDFARVHAGVTSLPRVGLNPY
FT                   ALGMRVFATIDEMADKGKRSLEFQMLRDIHTREKYDKRTGEGVDYIFKVREDFCDFTFI
FT                   NTFIDQDFLNRHKLFVVDRRLDHQKMVWQYYVKSRKAEDYRRMILDTLYHPPHMEIGKD
FT                   TSDGSLYLTHRFEEKPLVREFIGNTMMGIEYLWGGPVQLETSEVMPSPPEMERQLHAPG
FT                   EAHRINWQRVLYRMEKKKLTKTTIGTESGHD"
FT   gene            complement(470999..472228)
FT                   /locus_tag="Geob_0396"
FT   CDS_pept        complement(470999..472228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0396"
FT                   /product="VWFA superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18765"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ33"
FT                   /protein_id="ACM18765.1"
FT                   /translation="MPDFAPDKNPFASLELPTAEGTYTTRIRSIHELLERDKMREKDGF
FT                   PRKIRIGKLVKPTRGGKEKFVVIPTTVEEKFYHDRVPSPTDEENATGGTGKEEEGDILG
FT                   ERPVRPEEGAGEGEAGQGEGESHELESTAYDLGKILTETFELPNLKEKGKKSSLTRYTY
FT                   DLTDRNRGFGQLLDKKATMRKILETNISLGNVPNVTDIDTTRFLISPKDKIYRILSRDI
FT                   DYESQALVFFIRDYSGSMEGKATELVVSQHVMIYCWLLYQFARQVESRFILHDNEAREV
FT                   PDFESYYRLRVAGGTKVASAYRLVNEIVEKESLAKDYNIYIFHGTDGDDWDTEGVEAIP
FT                   EIKQMLTYTNRMGITIAEHAYAAGRHSEVEQYLTTSGLLKERADVLRLDVLDEEAEEPR
FT                   LIEGIKKLIS"
FT   gene            complement(472228..474288)
FT                   /gene="prkA"
FT                   /locus_tag="Geob_0397"
FT   CDS_pept        complement(472228..474288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkA"
FT                   /locus_tag="Geob_0397"
FT                   /product="protein serine/threonine kinase PrkA"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18766"
FT                   /db_xref="GOA:B9LZ34"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ34"
FT                   /protein_id="ACM18766.1"
FT                   /translation="MNSSHTCTLDQHLTEVKEGKRCFENAFQGVARMILEGKIEKIVVN
FT                   GKTTYDFMIFRTGKKHPVGMYDEINSFVSFVKDAAEGGSSKEMAFVLVGEPGNGKTFFV
FT                   EYLCAKYREFLSRPENRRYTFQLVNMDKLGSYGRIATIESQTYEDPMILAMNLFDNLDE
FT                   SREFLARTVGFSDKEIAKLFENYRPLGADSGYIWNDLRKYTGGNLEEMLKFVEVVPVPL
FT                   TETLGTITGKYAAKDKITSSAVDLLGDESIQRLLHITDVNNPYRFDLRRGALARVAGGG
FT                   IHFSDEIYKNKKDLVQVYLGVIQNRLIEIDGYRWPIDTLIIATSNNSEFNHFLAEREEA
FT                   PIIDRCRVCYVSHNTNYRMQEALTTYAIGTETKTTLTKEELHQDPNLNYSASVATVMTR
FT                   LPRSEKLTPIETLKLAAGEVAGEKSLKTLAEVVDMLSQEPDITKRFGQKGLGQRNLGRA
FT                   VQLMVESSETNEGRCMIAVDIFKTLERVVLDYVSDANDRAKYLEDLKIAKSLYRERIMT
FT                   EMFNAYMDEPFAIRKDVLNYVNMIIGIDAENLGPDKMWKYKDPQTGQLKAVRIDERYVR
FT                   NIEERIGLKTEEQRESFRTSIRKIYGQKISVEPNYDFMDNLELVKAVTDVRLKSDIAGA
FT                   GSLIGALANRTNEENQKLYDRMITTMLDKLHYCRTCAQKTIEYFCSQEDEI"
FT   misc_feature    474477..474586
FT                   /note="conserved nucleotide sequence; Geob_R2006"
FT   gene            complement(474593..476242)
FT                   /gene="groEL"
FT                   /locus_tag="Geob_0398"
FT   CDS_pept        complement(474593..476242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="Geob_0398"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18767"
FT                   /db_xref="GOA:B9LZ35"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ35"
FT                   /protein_id="ACM18767.1"
FT                   /translation="MAKVIKFDQEGRNAFLKGVNTLADAVKVTLGPKGRNVVIEKSFGA
FT                   PLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAK
FT                   LVAAGHNPMEIKRGIDKAVETLVAELKSISKPIKDHKEIAQVGTISANNDKTIGDIIAE
FT                   AMEKVGKEGVITVEEAKAMETSLETVEGMQFDRGYLSPYFVTDPERMEANLENANILIH
FT                   DKKISNMKDLLPVLEQTAKSGRPLVIIAEDIEGEALATLVVNKLRGVLNICAVKAPGFG
FT                   DRRKAMLEDIAVLTGGKVISEEVGFKLENTTMDMLGQAKKITIDKDNTTIIDGAGAEGD
FT                   IAGRVKMIRAQIEETSSDYDREKLQERLAKLVGGVAVIKVGAATEVEMKEKKARVEDAL
FT                   HATRAAVDEGIVPGGGVAYLRAMSTLDALNLPTEQQFGVNVIKRALEEPIRQIAQNAGV
FT                   DGSIVVDKVKNGKDAFGYNAADDEYVDMIQAGIIDPTKVSRSALQNASSIAGLMLTTEA
FT                   MIADKPKEEGAMPAMPGGMGGMGGMGGMGGMM"
FT   gene            complement(476289..476579)
FT                   /gene="groES"
FT                   /locus_tag="Geob_0399"
FT   CDS_pept        complement(476289..476579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="Geob_0399"
FT                   /product="chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18768"
FT                   /db_xref="GOA:B9LZ36"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ36"
FT                   /protein_id="ACM18768.1"
FT                   /translation="MKLRPMQDRIIVKRVEEETKTAGGIYIPETAKEKPQEGEVVAVGN
FT                   GKRTEDGKILPLDVKVGDKVLFGKYSGTEVKVEGQDYLIMREDDILGVIEK"
FT   gene            complement(476757..477329)
FT                   /locus_tag="Geob_0400"
FT   CDS_pept        complement(476757..477329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0400"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18769"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ37"
FT                   /protein_id="ACM18769.1"
FT                   /translation="MGNTSATVKASYLLLLIAMLLLFGCASGPRVTMSPAFNPAPEDNI
FT                   VYLVPFSQSLVPNDFSDTVFNEFVDNLNKNRSRTDVQWYYILKEDLKDIDPAWLTRQVY
FT                   ISGELWGYVENAGCCSTELRAKARLNLFEMEQRDATLEMQFPVEAFFEHDRSTLSNERQ
FT                   RMAKRLATEMADAITDIFARRKSHQSH"
FT   gene            complement(477329..477601)
FT                   /locus_tag="Geob_0401"
FT   CDS_pept        complement(477329..477601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18770"
FT                   /db_xref="InterPro:IPR007463"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ38"
FT                   /protein_id="ACM18770.1"
FT                   /translation="MQISEDRISHIAHKIYDKLWRDDLADFPDEARSLNAIKDSIAAFF
FT                   SVAEDIDQAVRKKLASYSQAKVPGSREWEVLYQKHYAEELAKRKW"
FT   gene            complement(477638..477925)
FT                   /locus_tag="Geob_0402"
FT   CDS_pept        complement(477638..477925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18771"
FT                   /db_xref="InterPro:IPR007463"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ39"
FT                   /protein_id="ACM18771.1"
FT                   /translation="MRLKEDQIGRMAEKVLGDLSAAGLIELKQDRVAALNAIKSAITAD
FT                   IKAEEALEKDAAQLLDQTLRGMGSGATGIDQHKMLRMIKEKLAKERKIVL"
FT   gene            478107..479123
FT                   /gene="aroG-1"
FT                   /locus_tag="Geob_0403"
FT   CDS_pept        478107..479123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG-1"
FT                   /locus_tag="Geob_0403"
FT                   /product="3-deoxy-D-arabino-heptulosonate-7-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18772"
FT                   /db_xref="GOA:B9LZ40"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ40"
FT                   /protein_id="ACM18772.1"
FT                   /translation="MLIVMSYTAGQAEIDAVVNAVEGMGYKARPIPGSERTAIGVLGNT
FT                   GYVDDVVIRDLPGVQEVIHVSKPYKLVSRAFHPQSSIIEVCGVRIGEGCPPVVAAGPCA
FT                   VEGKEQIIKTALAVKAAGAVMLRGGAFKPRTGPHTFQGLREEGLKLLAAAGKESGLPIV
FT                   TEVMSPENVSVVAEYADLLQVGARNMQNFDLLRELGRIRKPVLLKRGMSATIEEFLAAA
FT                   EYILAEGNPNVILCERGIRTFETATRNTLDLSVVPLIKEMSHLPIMVDPSHATGKRTLV
FT                   SPMAKAALVAGAHGVLVEVHPEPEKALSDGPQSLTFQGFDKLMEEIVKLRQFLGFAG"
FT   gene            479177..479352
FT                   /locus_tag="Geob_R0005"
FT   ncRNA           479177..479352
FT                   /locus_tag="Geob_R0005"
FT                   /product="6S RNA, stationary phase repressor of
FT                   sigma-70-containing RNA polymerase activity"
FT                   /ncRNA_class="scRNA"
FT   gene            479485..480723
FT                   /locus_tag="Geob_0404"
FT   CDS_pept        479485..480723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0404"
FT                   /product="membrane protein, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18773"
FT                   /db_xref="GOA:B9LZ41"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ41"
FT                   /protein_id="ACM18773.1"
FT                   /translation="MNDHAFNRNYSRYALSLLLAVNLLNYIDRQVLYAVFPLIKADMNL
FT                   SDTELGFLGSSFMICYMISAPFFGRIGDRGNRINLASFGLITWSLATGLAGFAPGYRAL
FT                   LAARTVVGVGEASFGTVSPGLLSDFFPKEKRGRVLSYFYLAIPVGSALGYLLGGVIGQR
FT                   LGWHAAFLLVGLPGLLLAVPVYFLRDPRREHGRTEVETGRTGENAFVALLRNRSFVIAT
FT                   MAMAAMTFALGGLSQWMPSFFNRVHGLDVERGNTLFGAITVVAGITGTLAGGWLGDRLQ
FT                   QKSSKGYLLVSGWGFVIGAPVAAVAILAPSLTTSLAAIFIAEFFLFFNTGPLNTVLVNV
FT                   TAPSLRATAFAVNIFFIHALGDAFSPTILGFCSDLWGIRSALLIAPTAIVVAAVFCFFC
FT                   TPYIEADMQKAGD"
FT   gene            480726..481382
FT                   /locus_tag="Geob_0405"
FT   CDS_pept        480726..481382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0405"
FT                   /product="(acyl)-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18774"
FT                   /db_xref="GOA:B9LZ42"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ42"
FT                   /protein_id="ACM18774.1"
FT                   /translation="MVYRLLRLVFSLYLRSFHLLRIKGMHQIPLNGPLILCANHSSYFD
FT                   SMLLALCTTRQIHFLIYRSFYHHPLLGWFVRKCGAIAVTQNGNDKEALDRSLAILRQGG
FT                   VIGVFPEGRLSVTGIPDEAKSGAALLAVASGAPIIPVTISGAHAVFAKGRKRPSPGTII
FT                   VEVHAPVHPDRSKRKDKAYLRALTDWVMGRIERRLAAHRRRKAYFAKKRLSERKG"
FT   gene            481390..483207
FT                   /gene="recQ"
FT                   /locus_tag="Geob_0406"
FT   CDS_pept        481390..483207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="Geob_0406"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18775"
FT                   /db_xref="GOA:B9LZ43"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ43"
FT                   /protein_id="ACM18775.1"
FT                   /translation="MEANPQQTLLKVFGYKSFRQPQQEIVEGLIRGEDAFVIMPTGGGK
FT                   SLCYQIPALHRPGVAIVVSPLISLMKDQVDALQANGVKAAFYNSSLSEAKARQVLAQMH
FT                   DDALDLLYVAPERLMSEPFLERLEDVKVALFAIDEAHCVSQWGHDFRPEYVQLGRLRQL
FT                   FPQVPLIALTATADPQTRNDIIERLGLGTAACYVAGFDRPNIRYLVTEKHKPFDQLRSF
FT                   LSSRQPGEPGIVYALSRKRVEEVAARLVQSGVAAAPYHAGLPERERSRVQEAFQRDELQ
FT                   VVVATVAFGMGIDKSNIRFVVHYDLPKNIESYYQETGRAGRDGLPAEALLLFGYGDIAV
FT                   ARGLIENGTNAEQKRIELHKLNAMVGFAEAVTCRRRVLLGYFGAALNHDCGNCDVCIDP
FT                   PQRYDATVEAQKALSCVFRVGQRFGMGHVIDVLRGAGNQRIQSLGHDRLSTYGIGKDIS
FT                   VDMWGSIIRQLVHLGYLEQDLASYSVLKLTPAARVLLRGEERLVLARPRHKTASAQKAP
FT                   RNKGEVPCDDALFQTLRALRKRLADEAGVPPFVVFSDATLTEMAAMRPVDAEGLLSVSG
FT                   VGIHKLGRYGEEFLTVLREYTANNAPAST"
FT   misc_feature    483220..483279
FT                   /note="conserved nucleotide sequence; Geob_R5015"
FT   gene            complement(483367..484767)
FT                   /gene="degP-1"
FT                   /locus_tag="Geob_0407"
FT   CDS_pept        complement(483367..484767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP-1"
FT                   /locus_tag="Geob_0407"
FT                   /product="periplasmic trypsin-like serine protease DegP"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18776"
FT                   /db_xref="GOA:B9LZ44"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ44"
FT                   /protein_id="ACM18776.1"
FT                   /translation="MYCRPSRLFALFTCSLALSVMLCGVAMAKPVLPDFVELAKKLKPT
FT                   VVNISTAKTIKPQRRFQRPFNSPFGNDPFQDFFDRFFDESQQHPYKQKSLGSGFIISDE
FT                   GYIITNNHVVAEADEIKVKLSDGREFKGEIKGTDEKLDLALLKISTKDHLPVAALGDSD
FT                   KIEIGEWVMAIGNPFGLSQTVTAGIISAQGRVIGSGPYDDFIQTDASINPGNSGGPLFN
FT                   AQGEVIGINTAIVAGGQGIGFAIPVNMAKNIIPMLKEKGKVTRGWIGVSIQPITPELAQ
FT                   SFELKGEKGALIAEVVKDGPAEKAGLKSGDIILEFNGRAIHEMNELPRMVAATPVDKQV
FT                   NVKILREGKPVDLSINVERLKDGEDGDQAGVSQEKLGITVRELSKDLAAKLGIKEQKGV
FT                   VITDVKPESSAEQTGIAKGDIIREINGSKINSVGDYEKAVNGHKKGTVMRMLLRRGDMS
FT                   LFVAFRVD"
FT   gene            complement(484868..486280)
FT                   /locus_tag="Geob_0408"
FT   CDS_pept        complement(484868..486280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0408"
FT                   /product="sensor histidine kinase, HAMP domain-containing"
FT                   /note="domains: HAMP, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18777"
FT                   /db_xref="GOA:B9LZ45"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ45"
FT                   /protein_id="ACM18777.1"
FT                   /translation="MFFFRSIRFRLTLWYLVTLALILLLFSTFIYLTISKRLYAEVDRE
FT                   LLAIAEAVASPTLEPFRRSAPTVLDQILEDFIGPSVANKFVQIADASGKVFSSSTNLQN
FT                   ISLPLDKTSLIISGIGNSTYHTHSNSLRYPIRSITMPIMENGRMVQVVQVGMLLDYTSD
FT                   ILEKLLVIFAVSIPLALIMLWYAGWFLAGRALKPVELITTSARKISAENLGHRLEIINP
FT                   SDEIGRLAKTFNITLDRLENAFNRTRQFSMDVSHELRTPLTILRGETEVGLRWGGDADE
FT                   LKKILRSNMEEINRMSDIIGDLLELSRAEEGKLVLDPVPVELHELLQDICTKAAPDARE
FT                   KRIILDLPNAASLHVAGDPARLQQIFLNLIDNAIKYTPCDGKVSLAVDSEPGWAKVSVT
FT                   DTGPGIPEADLPHIFEQFYRVDKARNRNDGGSGLGLSMVRAFSEAHGGRVEIFSLPGSG
FT                   CTFTVFLPLSHH"
FT   gene            complement(486285..486959)
FT                   /locus_tag="Geob_0409"
FT   CDS_pept        complement(486285..486959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0409"
FT                   /product="winged helix-turn-helix transcriptional response
FT                   regulator"
FT                   /note="domains: REC, trans_reg_C"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18778"
FT                   /db_xref="GOA:B9LZ46"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ46"
FT                   /protein_id="ACM18778.1"
FT                   /translation="MRILVVEDEKKVLSFIKRGLEEEQYEVVTAGDGEEGLKMAMEKNF
FT                   DLLILDWMLPKMDGLSVLKELKSQKNTTPVLMLTAKDSVEDIVAGLDSGSDDYLTKPFA
FT                   FAELLARVRALLRRSEQDRGAEIRFSDLRLDPVTHKVWRKDKEIDLTAKEYGLLEYFMR
FT                   NPHEVLTRTMIAEHVWDYTFDSFTNIIDVYVNYLRKKIDRDADKKLIHTVRGVGYILKE
FT                   ED"
FT   gene            complement(487017..487826)
FT                   /locus_tag="Geob_0410"
FT   CDS_pept        complement(487017..487826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0410"
FT                   /product="ADP--[pyruvate phosphate dikinase]-threonine
FT                   phosphotransferase and [pyruvate phosphate
FT                   dikinase]-phosphothreonine--phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18779"
FT                   /db_xref="GOA:B9LZ47"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ47"
FT                   /protein_id="ACM18779.1"
FT                   /translation="MQRIYLFSDATGETVERVVRAALTQFRNVDVKLHRMSRLRTREDI
FT                   SISLDEAAKQPGVIFYTLVDNELAQYLYNEANLRQLEAIDLITPLLYRLASLLGIQPQK
FT                   EPGLLYQLNSEYYKRMEAVDFTVKQDDGQEPRNLHKADIVLVGVSRTSKTPLSMYLAHK
FT                   GYKVANVPLVMGIEPPSELYQVDNSRVVGLMIDAQRLVDIRTARLRNMRQNPRGSYADY
FT                   QRVEEELDFCRRIYRKHPQWQVIDVTNKSVEESAAEILRRFETGIKD"
FT   gene            complement(487921..489081)
FT                   /locus_tag="Geob_0411"
FT   CDS_pept        complement(487921..489081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0411"
FT                   /product="zinc-dependent amidohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18780"
FT                   /db_xref="GOA:B9LZ48"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ48"
FT                   /protein_id="ACM18780.1"
FT                   /translation="MTAVKKSIVDAVDDRRQELTAIADQLYHDPETGLREFRTSALLIE
FT                   KLAENGFKIERGIAGLETAFRATWGTSGPSIAILAEMDALPAMGHACGHNIIAAAAIGA
FT                   ALALRQSLPEKLARIVVLGTPAEELGIGKFELVKHGAFDHIDFAMMVHPSSRRQVIKMF
FT                   LGLARIRFTFFGRSAHAAAYPEEGINALDAVILTFNGINALRQQLRQDVRVHGIITDGG
FT                   TAPNIIPERAACYFYVRADDGEELSRCLERVKWCAHGAAEATGCSLEIDADERVLAPMK
FT                   INRAFSALYSSQLAYLGLEEANAPADKNKGSSDIGNVSQVVPTIHPHVPIGNGLHIHSD
FT                   EFARATVSQKGKEAVIEGAKTLAMTAAELALSPEIQEKIKNEFRSL"
FT   gene            489241..490185
FT                   /gene="prmA"
FT                   /locus_tag="Geob_0412"
FT   CDS_pept        489241..490185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="Geob_0412"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18781"
FT                   /db_xref="GOA:B9LZ49"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ49"
FT                   /protein_id="ACM18781.1"
FT                   /translation="MNMVWTEISCEVPAAMVDLLADFLVELSGNGVSIENLSLDTFSLD
FT                   TIEDSPLKTVKAYFAVDNALEAHLDAVGAFLSANGPDFAGFVFKNPAVNAIDAEDWANN
FT                   WKKYFKPVRIGSRLVIKPTWEEYSASPGDLILKLDPGMAFGTGGHPTTKMCLEALEHIF
FT                   LAEGAFKGVAPVAPVTVLDVGTGSGVLSIGAAKLGAERITAIDIDADAVVVAGENVALN
FT                   ECSDVVELSTTPLQELTGNFDLVLANILAEELVRLAAELAVKVAPAGFLVLSGILSEKE
FT                   NFVLDGFSPYGLKLIEIRREGEWSCISLYLEPR"
FT   gene            490185..490925
FT                   /gene="rsmE"
FT                   /locus_tag="Geob_0413"
FT   CDS_pept        490185..490925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmE"
FT                   /locus_tag="Geob_0413"
FT                   /product="16S rRNA (uridine1498-N3-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18782"
FT                   /db_xref="GOA:B9LZ50"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ50"
FT                   /protein_id="ACM18782.1"
FT                   /translation="MRRFIVDKRDIDDAEAVITGYLYRHMAKVLRLKQGTAVMLTDGEG
FT                   GEYEGVIESIDSTSLRVRVVRRETLMVDDGGPQITIYQGLPKGDKLEYILQKCTELGAA
FT                   GIVPFAASRSIARISPQRSAGRVDRWQKIAAEAARQSRRATVPRVSLADDLSQVLQLAQ
FT                   HSVKLLLWEEEKANLLRETLSGLSAPNDIGVLIGPEGGFSPEEAAAASSAGFIPISMGR
FT                   RIVRTETASLIILSILQYHWGDLG"
FT   gene            490992..491570
FT                   /locus_tag="Geob_0414"
FT   CDS_pept        490992..491570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18783"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ51"
FT                   /protein_id="ACM18783.1"
FT                   /translation="MKCPKCGYNSFEFLDQCKKCSNDLVLFKKSNGIRSVLMPIMERGD
FT                   GVPAAGIASSGLQPDQAVGQHDDETFSWDEPVAEITPAPAGDKAGMADFPFGETATGNE
FT                   ASLDDLLETSATLERATVADGADKNKAPANGPAAGFETSSGEFEMADFFSEDKQEKKAE
FT                   TIPQQGKPAQDGLDGDFDFLFSSDENEKK"
FT   gene            complement(491586..492737)
FT                   /locus_tag="Geob_0415"
FT   CDS_pept        complement(491586..492737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0415"
FT                   /product="ribonuclease D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18784"
FT                   /db_xref="GOA:B9LZ52"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ52"
FT                   /protein_id="ACM18784.2"
FT                   /translation="MQKQSDSTNSPAKGIIETQKDLNLLVEQLSRENILAFDLEADSLH
FT                   HYTEKVCLIQVSNLSQTALIDPLAPVDLSPLAPVLADRGIRKVFHGADYDMRSLYRDFG
FT                   LEVCNMFDTMIACQFLGEKEVGLAAALKKRFGVELNKKYQKADWSKRPFSAEMIEYAKM
FT                   DTALLIRLYLQLEEELRAKGRLEWVEEESELVSCVRAASRDHEPLFIRFKGAAKLKPRA
FT                   LAVLEELLRMRDEKARKKDVPPFRILGNEPLRELAELQPRTLADLNGIPGLTQKLIETF
FT                   GREILKVVAKGAAIPVARLPHFPSTARMIRDRDQEARLKRLKEWREAKAVELGLGVGII
FT                   ANNSLLEALADTAPSSPEALAEIPFIKCWQRKEFAAELLDIIQ"
FT   gene            complement(492795..493838)
FT                   /gene="hisC"
FT                   /locus_tag="Geob_0416"
FT   CDS_pept        complement(492795..493838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="Geob_0416"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18785"
FT                   /db_xref="GOA:B9LZ53"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ53"
FT                   /protein_id="ACM18785.1"
FT                   /translation="MIKLRKNIANMAGYVPGYQPEDPAAYIKLNTNENSYPPSPKVIEA
FT                   IIAEVGEGLKRYPDAASRAAREAAAELYGFPPEWVIMANGSDEVLNNLIRAFADEGDEI
FT                   AFVYPSYSYYATLAEVQGARVKTFGLTEDWKLKDFPKIYEGRIFFLTNPNAPLGFTFSQ
FT                   TYIEELAGRVSGTLVIDETYADFAEVTSLELVRKYDNVVVTRTFSKSYSLAGMRLGLAV
FT                   ARPEVISALDKIRDHYNLDRLAQAAAVAALHDQEYLRETVGKIQETRQWFCDQLGKLGY
FT                   TVIPSHGNYVFATPPDRNGERIYQGLFDRKILVRHFSDPNLAHGLRISIGTQAEMEKTI
FT                   VALVEIG"
FT   gene            complement(493862..494926)
FT                   /gene="mqnC-1"
FT                   /locus_tag="Geob_0417"
FT   CDS_pept        complement(493862..494926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqnC-1"
FT                   /locus_tag="Geob_0417"
FT                   /product="dehypoxanthinylfutalosine cyclase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18786"
FT                   /db_xref="GOA:B9LZ54"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ54"
FT                   /protein_id="ACM18786.1"
FT                   /translation="MLKKIATKIEVNEQLSREEALWLLNDGTLLELGRLADHIRRRLHP
FT                   DNRVTFVVDRNVNYTNICESQCRFCAFYRTKDADDAYMLEEEAIFAKIAELVQQGGTQL
FT                   LMQGGLHPDLGIEFFEKLFAGIKSRFPQVQNHSLSPAEVTHIASQSGLTIRQTLERLHR
FT                   AGLDSIPGGGAEILVDSVRQQISPKKIGWQQWAAVMREAALLGMPTTATMMFGSCEQAE
FT                   DIVEHLFRVRELQASGGTFTAFIPWTYQPGNTELGGTTATGVEYLKVLSLSRIVLDNIA
FT                   NIQGSWVTQGAKIAQIALYFGANDLGGTMLEENVVAAAGCSFRMSREEMIDLIRGAGFI
FT                   PARRTTTYEILDEY"
FT   gene            complement(494965..496047)
FT                   /gene="mqnC-2"
FT                   /locus_tag="Geob_0418"
FT   CDS_pept        complement(494965..496047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqnC-2"
FT                   /locus_tag="Geob_0418"
FT                   /product="dehypoxanthinylfutalosine cyclase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18787"
FT                   /db_xref="GOA:B9LZ55"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ55"
FT                   /protein_id="ACM18787.1"
FT                   /translation="MITMAAIAEKVRDKRRIDEDEALFLFRHHDLLAIGELAAMANERK
FT                   NGRKVFFNVNRHINHTNICVNRCKFCAFARAADQPGAYLYDLDEIRNRATEALQQGATE
FT                   IHIVGGLHPDLPFDFYLEMLRTVREVSPSLHIKAFTAVEIDYLAKLCDCSISDTLVKLK
FT                   EAGLGSLPGGGAEIFREGIRQQLCPEKISGERWLAIMEEVHRAGLKSNATMLYGHLESF
FT                   ADRVDHMRRLRELQDRTGGFQVFIPLAFQPENSPLTITKGTGTTGVDDLKTLAIARIYL
FT                   DNFDNIKAYWVMLGEKVAQVALAFGVNDLDGTVVEEKIGHDAGAASPQAMSRDGIIALI
FT                   RKAGREPVERDTLYNELRTY"
FT   gene            complement(496044..496667)
FT                   /locus_tag="Geob_0419"
FT   CDS_pept        complement(496044..496667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0419"
FT                   /product="menaquinone biosynthesis decarboxylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18788"
FT                   /db_xref="GOA:B9LZ56"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ56"
FT                   /protein_id="ACM18788.1"
FT                   /translation="MSIRRFTLAITGASGAFYGLRTAEEILKSGAHLTLLVTRAGFAVL
FT                   KEECSLNWHGNPAQIRDMICGHFNVDPVKLAYHAEDDLYAPIASGSAAAHAMIVAPCSM
FT                   GSLSRIAGGNSGNLIERCADVMLKEKKPLILVPRETPLNEIHLKNMLKLARMHAAIIPA
FT                   MPAFYHHPRSINDMVDFVVGRVLDMAGVEHDLFCRWGQPERDDR"
FT   gene            complement(496664..497572)
FT                   /locus_tag="Geob_0420"
FT   CDS_pept        complement(496664..497572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0420"
FT                   /product="menaquinone biosynthesis polyprenyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18789"
FT                   /db_xref="GOA:B9LZ57"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ57"
FT                   /protein_id="ACM18789.1"
FT                   /translation="MAGNESMEIKLQQGSIWRRVTIFLEMIKFSHTIFALPFAFTGAVL
FT                   AAGGLPSIYQTFWILMAMVGARTAAMSLNRLIDADIDGRNPRTKGRAIPAGLLSKGMVA
FT                   LFICLSVALMLWAARMLNPLCFYLSPIALFFLVLYSYCKRFTALAHVVLGLCLAAAPLG
FT                   AWIAITGNFSLPAVLLALAVLVWVAGFDILYALQDLEFDRTSGLHSIPVSLGVNGSLWM
FT                   ARLLHLLMIALLTSIYLIMQLGILFLIGLIITAILAGYEHWLLRKGDLTKLDAAFFNMN
FT                   GYISVVIFLFTLFDILVRRTA"
FT   gene            complement(497901..498131)
FT                   /pseudo
FT                   /locus_tag="Geob_0421"
FT                   /note="metalloprotease domain protein; C-terminal fragment"
FT   gene            498331..498407
FT                   /locus_tag="Geob_R0006"
FT   tRNA            498331..498407
FT                   /locus_tag="Geob_R0006"
FT                   /product="tRNA-Pro"
FT   misc_feature    complement(498599..498786)
FT                   /note="conserved nucleotide sequence; Geob_R2007"
FT   gene            498800..500041
FT                   /locus_tag="Geob_0422"
FT   CDS_pept        498800..500041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0422"
FT                   /product="sodium/dicarboxylate symporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18791"
FT                   /db_xref="GOA:B9LZ59"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ59"
FT                   /protein_id="ACM18791.1"
FT                   /translation="MKLLKTYGFSLLLILSISAGLLLGSFHPGAARAIRPLGDLFLNLL
FT                   FMIIVPLVFFTVSSSIAVSADSRRLTRTSSAMVIVFLATSLVAAVGALLFMLIVQPSPG
FT                   AGVVLKGQPVQEVPSLLAQLVKAFTASDFPELISRRSMLPLIVFSIGVGLATRSSKEAG
FT                   ASFGRFLAGGAQVFIRMVDYVMYAAPIGLLAWFAATVVDTGEALAAAYFNVFIVYYTFS
FT                   AFYFVAGFSLYAFLAGGVVAVRRFWAHMLEPSLTALGTCSSMATMPVNLEAAPKMGVPQ
FT                   GISDVVIPVGAALHKDGSVIGGVLKILFAMSLFHQELTFSRLIVVVGVAILVGVVMGAI
FT                   PSGGMIGEMLILSVFGFPPETLPLLAAISVIIDPLATLLNATGDNVAAMLVTRLTDGVA
FT                   WEEKEGGQPWARKA"
FT   gene            500023..500706
FT                   /locus_tag="Geob_0423"
FT   CDS_pept        500023..500706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0423"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18792"
FT                   /db_xref="GOA:B9LZ60"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ60"
FT                   /protein_id="ACM18792.1"
FT                   /translation="MGKKSLALFLLFSLFMLTGCRHQRPWQSSQDCLLRLPMESRQAVV
FT                   VTTDGLSSSGAAIHLFERENGTWRPVDGPIAAVVGRNGLAQPGEKREGDGRTPMGTFLL
FT                   ERGFGYEPLQTKIPYIVLTPDMIWIDDPSSPLYNTLTMKGEGLGLSHEIMRRTDDLYKY
FT                   GIVIEYNTKETLPGAGSAIFFHIWRNDEAPTSGCVAAAETDILRILHWLDPRQHPMAVI
FT                   GDACP"
FT   misc_feature    complement(500711..500815)
FT                   /note="conserved nucleotide sequence; Geob_R8101"
FT   gene            500926..501867
FT                   /locus_tag="Geob_0424"
FT   CDS_pept        500926..501867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0424"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18793"
FT                   /db_xref="GOA:B9LZ61"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ61"
FT                   /protein_id="ACM18793.1"
FT                   /translation="MKIGIVGCGFVGATAAYAMVMRGVGRKLVMVDVNRARARAEAADI
FT                   SHAVPFAHALEVIAGEYEELEGASVVLVAAGVGQKPGETRLQLLERNAAIFKEVIPQVL
FT                   RHAGDAVLLVASNPVDVLTHLAASIAGELGIPSSRVVGSGTTLDTARFRSLLSSSLGID
FT                   PRHVHAYVLGEHGDSEVLGWSTVTVGGMPLDAFAHRKGASFPPGLIASIDHQVRHAAYE
FT                   IISGKQATYYGIGSALANIVEVMVYDRRSILTVCTPLPEVEGVENVTIALPHLVGGRGV
FT                   LETFPPALDHMEREALRNSARIVRNAIESINV"
FT   gene            complement(501955..502239)
FT                   /locus_tag="Geob_0425"
FT   CDS_pept        complement(501955..502239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18794"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ62"
FT                   /protein_id="ACM18794.1"
FT                   /translation="MAEKCSGTGAMLSFLAGAAVGTGLALLYAPKTGKEVRGRITDLSN
FT                   DTVSKMKGYGSQAQEKMKSFYNTGRDMFREKKEQMSATMETGEEPLGRA"
FT   gene            502491..502826
FT                   /locus_tag="Geob_0426"
FT   CDS_pept        502491..502826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18795"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ63"
FT                   /protein_id="ACM18795.2"
FT                   /translation="MYNSFLTKSLTLSLVMVITFGLAARGINLPIMPGLSASTERVKPR
FT                   PRAIIKSPSKTCQGTLKKSGIPSLLAFSKPNQLHLAVIRPVFLEHAVHRLCCSFPNRTD
FT                   RAPPTLT"
FT   gene            502929..503924
FT                   /locus_tag="Geob_0427"
FT   CDS_pept        502929..503924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0427"
FT                   /product="UDP-4-deoxy-4-formamido-beta-L-arabinopyranose--undecaprenyl-phosphate
FT                   4-deoxy-4-formamido-alpha-L-arabinopyranosyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18796"
FT                   /db_xref="GOA:B9LZ64"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ64"
FT                   /protein_id="ACM18796.1"
FT                   /translation="MTRLSVVIPVYNAEKTIESLCNTLFDLYRNSFELEVVLVNDNSRD
FT                   STHIICQRLHEANPETVTYIRLARNFGEHSAVMAGLNNATGDYAVIMDDDFQNPPEEIS
FT                   RMVAEIEKGYDVVYTHYPVKRDSIFRNLGSAFNDKMANVILQKPADLYLSSFKIMNRFL
FT                   INEVIIYTGPDPYIDAIIFRSTSNIGRVEVRHDKRRHGRSNYTIGKLISLWGNMVVSYS
FT                   LIPLRILGLAGFIMTLIGVYVGGTSLLDAILPYRQDPTEYETLIALTTFFRGFQLLAVS
FT                   VVGEYVGRIYLALNCDPQFVIREKFSAQKKLQFAAVHTGLNHGYNKKTGN"
FT   gene            503896..505326
FT                   /locus_tag="Geob_0428"
FT   CDS_pept        503896..505326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0428"
FT                   /product="NDP-hexose 2,3-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18797"
FT                   /db_xref="InterPro:IPR005212"
FT                   /db_xref="InterPro:IPR038153"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ65"
FT                   /protein_id="ACM18797.1"
FT                   /translation="MATIRKQAIRVDQGSEMAAVRSHVLGFGGDVAAEIHYSRTTSKSI
FT                   HSDDYIEAWIARRLASPRLQVKPIPLAAMGHWLIESGTGNIIHDSGMFFTITGVKARHR
FT                   SLGGDMEWDQPIIDQPEIGILGILVKSINGVLHFCLQAKEEPGNINSVQLSPTVQATYS
FT                   NYTKAHGGAVPPLVGYFLNPQRQRVLFAKLQTEDGGRFLFKSNRNMIVRVGEGELEELP
FT                   DPFIWLTLRQIALLLRRDNLVHACTRSIISSLVLSRASQTSCAEGVMSLAEAIQWLDDE
FT                   KAANHITVKRQGLKTLKEWSLDEDCCFSHREKRFFRVIGIDVKSVGREVSAWSQPILDN
FT                   PEMGIIGLLTQVRQGERHFLMQAKAEVGNRSMVQLGPTVQFTPSNYAGNEKLPKPFLFD
FT                   DFSAGSLFPFSWQNYQAEEGARFYREAHLHRIAELPEGDELPLPQGFCWMSETQLRFFL
FT                   HLGETVNSCARSIISCLL"
FT   gene            505407..506393
FT                   /locus_tag="Geob_0429"
FT   CDS_pept        505407..506393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0429"
FT                   /product="NDP-hexose 3-oxoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18798"
FT                   /db_xref="GOA:B9LZ66"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ66"
FT                   /protein_id="ACM18798.1"
FT                   /translation="MTGCSEKLPIGILGCSDIARRKFIPALGKTKSAVLQAIASSHPVK
FT                   AAIAHPDLPVEPVSYEALLADPGIRLLYISLPNHLHEEFALRALQGGKHVICEKPLGLS
FT                   TASVKRMLACAEEKGLLLFENLMYLHHPQHAAVKKVIERGEIGRIRTLRSVFCFPCPGD
FT                   GNFRLDPARGGGAFNDLARYAVSTARHFLRGRCHSFRGYALDRNGLNVAIHGTALTTAQ
FT                   EVFTYSLAFGQSYESSYEIVGEQGKIRVDRAYTTPSEMANHIQVTSGGKDASFTIPPAD
FT                   HFQLMIQDACSMVLSGRGFKEMHTRNLQLADMAEQMEKGCHHEELRY"
FT   gene            506374..507507
FT                   /locus_tag="Geob_0430"
FT   CDS_pept        506374..507507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0430"
FT                   /product="aminotransferase, AHBA_syn family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18799"
FT                   /db_xref="GOA:B9LZ67"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ67"
FT                   /protein_id="ACM18799.1"
FT                   /translation="MKNSDTDVIQVRYWDYRDNYQQHREKILDVVDKVFSSGRLILGSM
FT                   VSEFEEEFSAFCGAQFGIGVNSGTDALFLALKALNIGAGAEVITVSNTAVPTVAAIRSA
FT                   GATPVFVDVEDDTFLMDVTRLEQAVTSATRCILPVHLYGQAVDMAPLLQLAANRNIHVV
FT                   EDCAQAAGALYQGKRVGSFGDIGTFSFYPTKILGAYGDAGMTVTNRPELKERLKRLRFY
FT                   GMEGGYYSEEEGYNSRLDEVQAAILKLQLPELNEEVMGRAKLAAIYNEGLRGLGDVTLP
FT                   VVRDGRTHQWYLYTIRTGRRDALMQHLTAAGIETRINYPTPIHLMRGYRFLGYGEGSLP
FT                   VTERLAGEILSLPMYPQLPESHAERVIEAIREFFQGH"
FT   gene            507553..508305
FT                   /locus_tag="Geob_0431"
FT   CDS_pept        507553..508305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0431"
FT                   /product="SAM-dependent methyltransferase, type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18800"
FT                   /db_xref="GOA:B9LZ68"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ68"
FT                   /protein_id="ACM18800.1"
FT                   /translation="MNEREYERMFRVEDSHWWYAGLHELILETVAGEKHEEPLAILDAG
FT                   CGTGRLCQLLQSFGTVAGCDASPQALAFSRSRGVSGLFHADLNNVDLGEKRYDVITSID
FT                   VLYHQAVTDEENIISRFYRALKPGGLLVLNLVAFEFLRSTHDIAVHTRKRYTLGGLLPS
FT                   LKGQGYSIEKATYRLGLLFFPIAFYRLAKKLLPRSSQREQVDSDVYLPPSVINSLLLQL
FT                   VRAENSFLHHCSLPFGTSVYIAARRPLI"
FT   gene            508429..508578
FT                   /locus_tag="Geob_0432"
FT   CDS_pept        508429..508578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18801"
FT                   /db_xref="GOA:B9LZ69"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ69"
FT                   /protein_id="ACM18801.1"
FT                   /translation="MLWTIVVVLLILWLLGLVTSYTLGGLVHLLLIIAIIMVIVNLISG
FT                   RRPL"
FT   gene            508791..510551
FT                   /gene="ftsH-3"
FT                   /locus_tag="Geob_0433"
FT   CDS_pept        508791..510551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH-3"
FT                   /locus_tag="Geob_0433"
FT                   /product="cell division ATP-dependent zinc protease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18802"
FT                   /db_xref="GOA:B9LZ70"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ70"
FT                   /protein_id="ACM18802.1"
FT                   /translation="MSSKQIRLIKILVLLLIFTAVAFGASTWKERRDEEKNRISYTAFV
FT                   DKVNAGEISKVRSEGDAITAHGQSGARFILHRPMDAELSKLLLARHIDFAATPPAAPSH
FT                   WVELCLLLVVLVPIFLIMKKLALFGRSKAKLSDRSSTDTCFTDVAGADEAKSDLLETVE
FT                   FLRDPGKFSRLGGKMLTGILLVGPPGTGKTLLARAVAGEAGVPFFSMSGSEFVEMYVGV
FT                   GSSRVRDLFAQGHKAAPCIIFIDELDAVGRKRDAGGNGANDERDQTLNQLLVEMDGFCV
FT                   NKGVVVIAATNRPEVLDPALLRPGRFDRQVTVGTPDIKGREDILKVHTRDVPLDEGVDL
FT                   RLVARGTPGFSGADLANLINEAAIIAAKGGKPTVEMADLDMARDKVLMGAERKSMVLSD
FT                   QVKLSTAWHEAGHVMVAKLVPGCDPVHKVSIIPRGRALGVTVQIPEEDIYSYTKEMLLA
FT                   HIKVLMGGRAAEDLVFNTTTTGAGNDLARATDVARKMVCEWGMSEAFGPVAFGSHESTK
FT                   TGDGAAVKGFSDATAVEIDTEIRSIVTTSYDQVRRLLQANMETMEALTRELVARETLGS
FT                   ADIDTIFSRQ"
FT   gene            510766..510924
FT                   /locus_tag="Geob_0434"
FT   CDS_pept        510766..510924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18803"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ71"
FT                   /protein_id="ACM18803.1"
FT                   /translation="MNRALFKATNHDLERLSAEELRIYLEIVDLMVADGMTQVEAEDQA
FT                   YLSFFTK"
FT   gene            510948..511652
FT                   /locus_tag="Geob_0435"
FT   CDS_pept        510948..511652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0435"
FT                   /product="response regulator, PilZ domain-containing"
FT                   /note="domains: REC, PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18804"
FT                   /db_xref="GOA:B9LZ72"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ72"
FT                   /protein_id="ACM18804.1"
FT                   /translation="MRKILLVSDSPSFRERNKSLLEKARFRLFTAASALEALQLQREIG
FT                   ADLIIAMLDLPDMGGDMLCSMIRQGKDTCLVPIMLVCYHSPEAMARAERCGANAWIIKP
FT                   VHPHLLLREVCNLLTTQKPREHRVKLKTHVNGIYESMKFSGISHNISVSGVLCETALEL
FT                   APDDLIKNMSIKVNAGEVMTDGKVVRKVALSDGRFNYGVQFLNPSNACRQQIGKFVAAS
FT                   LVAHAPLSKGRG"
FT   gene            511966..513939
FT                   /locus_tag="Geob_0436"
FT   CDS_pept        511966..513939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0436"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18805"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ73"
FT                   /protein_id="ACM18805.1"
FT                   /translation="MRKASQLSGKKPESANKGISSSSADLDQINLWHEPFVHVMLIVVA
FT                   GFVVYFNTITTPFLFDDITYLVTNPAIREFSFFTDSDRLFSLGILPDVKNNFLLRPVSY
FT                   FTYALNYAVHGLDVRGYHLTNLIIHIGNGLLVYLMVSLALHTPAMLTDDEKENSAQAVS
FT                   HTWFPLFSALFFVCHPLQTQAVTYIIQRFTSLVVLFYLGSLVLYAKSRLAKTATSQRVW
FT                   YVLALFSAVIAMNTKENAFTLPLAIILFELMFFSGHMGRRLVRLIPFLLTMLIIPIRLA
FT                   QLSSMAKPVEADVLVDSINLVNFSGVSSWHYLITQFGVIATYLRLLVLPIGQNFDYDYH
FT                   LQTQFFSLGVMLPLFLLLLIMGTGVYLYCRSWGPDRPQAPLYKLAAFGIFWFFLTLSVE
FT                   SSIVPIDDLIFEHRVYLPSIGFFLSALALAAIIYRRLANRFIFTSTMANGLLAVILISL
FT                   SIAGVVRNSVWQDEVSFWRDITDKSPNKARAHYGLGAALVQQAALENKIDSGTSKNGGR
FT                   EKMEAGLKELRTAIKLRPDYLLAHVCLGKTLSDLKQFDEATTELLTAARLNPNSPLPHI
FT                   FLGESYENRGEFTNARNEYTTAIAADPTHPEAHLRLGKLHAKEGNLPDAIAELEKSYLV
FT                   YPNETTQKQIDDLKAKLTLAGK"
FT   gene            514143..515780
FT                   /locus_tag="Geob_0437"
FT   CDS_pept        514143..515780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0437"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18806"
FT                   /db_xref="GOA:B9LZ74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ74"
FT                   /protein_id="ACM18806.1"
FT                   /translation="MITATNITLGYGKRILFKDVNIKFTPGNCYGLIGANGAGKSTFLK
FT                   ILSGEISPDKGEVSIGPRERMAVLRQDQFAFDEETVFNTVIMGHGQLYKVMAEREAIYA
FT                   KPDFSEADGVRSAELEAEFAEMNGYEAESEAAVLLNGLGIPEELRQKRMKELEGGDKVR
FT                   VLLAQALFGNPDVLLLDEPTNNLDLKSITWLEDFLSRFANTVIVVSHDRHFLNQVCTHT
FT                   ADIDFSRIQVYVGNYDFWYHASQLNLKQKQNENRKVSEKAEELKAFIQRFSSNASKAKQ
FT                   ATSRKKLLDKLTLEDMPVSSRKYPHIMFKPERPCGDIILEVKGLTKVVDGVKVLDNFDL
FT                   IVRKGDKIAFVGGNGLARTTLFQILAGEMEPDSGSFRWGVTINHAYFPKEHSAYFDNDL
FT                   TLIQWLGQYSPPTEGETFARGFLGRMLFSGDEATKKTSVLSGGEKVRCMLARMMLTGAN
FT                   VLILDEPTNHLDLESITALNDGLIAYGDVILFASHDHEFVSTVANRIIELTPCGVIDRV
FT                   MGFDDYLESAEVAAERDRLYHGHADLTL"
FT   gene            515807..516256
FT                   /locus_tag="Geob_0438"
FT   CDS_pept        515807..516256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18807"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ75"
FT                   /protein_id="ACM18807.1"
FT                   /translation="MNELDQALEALRQNMDDPKSQSKFYDLFLNASFHVPTLKEEIKGA
FT                   DEGGAEGQALPLVMESEGNDYLMLFDSKERLLAWTGEDVASVQVPGHVLAATSQPPLHW
FT                   ALNVGTEFSKQFLPDEIAWLREVVERCNAAAAEEAEGQGTENPDT"
FT   gene            complement(516344..517414)
FT                   /gene="pilT-3"
FT                   /locus_tag="Geob_0439"
FT   CDS_pept        complement(516344..517414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT-3"
FT                   /locus_tag="Geob_0439"
FT                   /product="twitching motility pilus retraction ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18808"
FT                   /db_xref="GOA:B9LZ76"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ76"
FT                   /protein_id="ACM18808.1"
FT                   /translation="MARIDALFKMMNEQGASDLHLSTGSPPIFRLNGEMERLNFKSLGH
FT                   EDLRSILYEILSETQIADFEKRKDLDFAYSVPGIARFRGNMLMQHRGIAAVFRIIPSKI
FT                   LTADQLNLPEGVRKLTALKKGLVLVTGPTGSGKSTTLAAMIDLINSTRREHILTLEDPL
FT                   EFIHENKMSLFNQRQIGEHSESFAAALRAALREDPDVILVGEMRDLETISLAMSAAETG
FT                   HLVFGTLHTSSAAKTVDRIIDVFPKDAQEQVRAMLSESLKGVISQQLLRNADGKGRSAA
FT                   LEIMMGTPAIGNLIREGKTFQIPSIMQTAKKDGMQLMDQHILDLLKTKKVSPEEAYRCS
FT                   ADKKQFEQYLPERPQQ"
FT   gene            complement(517434..519089)
FT                   /locus_tag="Geob_0440"
FT   CDS_pept        complement(517434..519089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0440"
FT                   /product="PilB/PulE/GspE family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18809"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ77"
FT                   /protein_id="ACM18809.1"
FT                   /translation="MDKLVKEGSLGSILLHSQIITEQELQAALEEQQTSGIRIGEALIK
FT                   LGIVTQEDIDWALSNQLNIPYVRLKKENIGREAVECVPAELARRYNLMPLFLSGDDLSI
FT                   AIADPLNKDAIRAVESTTGCLVTVSVGLIREIREMQELFYGAEIVPASFGFSSSLFPPK
FT                   IIDNINADLSGAKLLDYLLLSIVKNRLSSVSLQPVGDSVLVTGRATGVTKELGAFEPGY
FT                   YPELILHIRRMAKMNGLHETSARGVLAFRLKGRTLHYQVCMLRGEGGDYVTIKLHLSST
FT                   FPSTLSEIGLSSEKEAEYRNLAAIDKGLLLFSMRDADERCRLMDLYLDERNTQGQTVLI
FT                   LGNNVGRGKKKFPRIPVSRNITELSAVIMATFDHDPDIIVIEDATDAYAFIAAGKAAMH
FT                   GKLVMAGVSFGDVPVTFKNLIHYWQKNYFIPTFLKGVVSLKGLITLCPHCKESYAPSRE
FT                   ETAALRIEVPIADCYRAKGCPACEHTGYAGRKYLMGLIAFDSSMLEAFENARDSTEIVK
FT                   HLSGRGYRGIGEEALELLVAGEISPEEYAVSIIY"
FT   gene            519277..520284
FT                   /locus_tag="Geob_0441"
FT   CDS_pept        519277..520284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0441"
FT                   /product="thiamin biosynthesis protein ThiI-related adenine
FT                   nucleotide alpha-hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18810"
FT                   /db_xref="GOA:B9LZ78"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ78"
FT                   /protein_id="ACM18810.1"
FT                   /translation="MQKKALALLSGGLDSTLAVKVMLDQGIAVEALNFTSPFCTCTSKN
FT                   AGCKSEAVRVAEEFGIPIKVMHKGLDYLEIVGNPRHGYGKGMNPCIDCRIFLLTKAREY
FT                   MQASGAHFVITGEVLGQRPMSQRRDTLRVIERESGLEGLLLRPLSAKHFAPTIPEQEGW
FT                   VDRDRLLAIQGRSRKEQMQLAEDLDVKNYPCPAGGCLLTEVSFVPKVKDVFDHSDSLNL
FT                   RDFRLIKLGRHFRIGDRTKVIVGRDEAENNLLESAVQAGEATLRWEEGSSPLTVVTGKQ
FT                   DEALLEKAAKILLRYTKAEPDTECIIKAIVDGSEKQLKVKKDYSEAIVEGLRIG"
FT   gene            complement(520314..521279)
FT                   /locus_tag="Geob_0442"
FT   CDS_pept        complement(520314..521279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0442"
FT                   /product="biosynthetic peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18811"
FT                   /db_xref="GOA:B9LZ79"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ79"
FT                   /protein_id="ACM18811.1"
FT                   /translation="MKKIFVILAGLAILYAAYIGVSLMLLPSVSDLQKRRASMTIQVRD
FT                   WHGKYHPFVVGPKNRYWTSGASIPPEMKWAVILAEDANFYKHEGIDVKAIKNAIKYDLE
FT                   KKTFARGASTITQQVAKNLFLSREKTISRKVKEVVLARRMEQELTKGRIIELYLNLVEL
FT                   GPMVYGIGHGAHYYFGKPASALTPRECAIFAAMLPGPRVAYNPYRNMGKVLKRSNMILR
FT                   LLLNKGVLSQAEYRQALAESPNIGRLQKKVDESIKKEEVLLPNISSAKNEEESKAEPTT
FT                   DGEGAVNGAQPDMEEDSRQNVPPATEEQAQPEADTQAEQK"
FT   gene            complement(521276..522292)
FT                   /gene="pdxA"
FT                   /locus_tag="Geob_0443"
FT   CDS_pept        complement(521276..522292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="Geob_0443"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18812"
FT                   /db_xref="GOA:B9LZ80"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ80"
FT                   /protein_id="ACM18812.1"
FT                   /translation="MGFDIRPAIAVTMGDPAGIGPEIIVKSMARREILASCRPVIIGDR
FT                   SVLQRAIDLLAADLRITTVEEMPDRDPASGELYLKPLSDLAPQDMEYGKPTAAGGDAVF
FT                   RYITEAARLCLKGEVDAMATAPINKEAMNAAGHHYPGHTELLAELTGTDNFVMMLAGSR
FT                   LRVTLVTIHEALADVPRLVTFDKVLATIRTTNGDLARYFTPRPRLAVLALNPHCGEGGM
FT                   FGNEDQDIIRPAVEAARSEGIDATGPLSADTLFHLAVKGDYDAVICMYHDQGLIPLKLL
FT                   HFDDGVNVTLGLPIIRTSVDHGTAYNLAGKGIASEESMVAAIKMAAEMAVVRQTRKA"
FT   gene            complement(522503..522889)
FT                   /locus_tag="Geob_0444"
FT   CDS_pept        complement(522503..522889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18813"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ81"
FT                   /protein_id="ACM18813.1"
FT                   /translation="MSDKKNELKFKYIFDDSYNPVYVNGAHGGVTPRGELVVNFYLERQ
FT                   PLPNSISHELAANGSIGRESAVEPADLQRSFVRFISSGVVLSHQTAKEIHFWLGEKLKE
FT                   MEAIENAKTALNSPPGSDRSKITH"
FT   gene            523033..523560
FT                   /locus_tag="Geob_0445"
FT   CDS_pept        523033..523560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0445"
FT                   /product="iron-sulfur cluster-binding oxidoreductase,
FT                   UPF0153 superfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18814"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZ82"
FT                   /protein_id="ACM18814.1"
FT                   /translation="MKSLGNYRALLAKVDEMTAGISTAHAAHITCHRGCDSCCRHLSLS
FT                   LVEGVALAEALSSLPEDKACFLREKAKAATADGPCPLLDNGECALYVHRPIICRTHGLP
FT                   ILVSEGDGQRIDFCPLNFRNVQTLPGDAVVALERLNTILAAVNKFFVTEYHAAGTSGKD
FT                   RLSIAEALLLEV"
FT   gene            complement(523658..524074)
FT                   /gene="atpC"
FT                   /locus_tag="Geob_0446"
FT   CDS_pept        complement(523658..524074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="Geob_0446"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18815"
FT                   /db_xref="GOA:B9LZ83"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ83"
FT                   /protein_id="ACM18815.1"
FT                   /translation="MAEKLKVELVTPYKKVLTEEVDEITATGALGEFGVLPGHAPFLTS
FT                   LKIGELSYKKDGVISHLALNWGYFEVENDKVTVLVETAEKADEIDLERAKSALGRAEEA
FT                   LKKLNPEDKSFRVYEAALERALIRVQVAGKSGRR"
FT   gene            complement(524116..525528)
FT                   /gene="atpD"
FT                   /locus_tag="Geob_0447"
FT   CDS_pept        complement(524116..525528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="Geob_0447"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18816"
FT                   /db_xref="GOA:B9LZ84"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ84"
FT                   /protein_id="ACM18816.1"
FT                   /translation="MSQNIGKISQVIGAVIDVEFEPGKLPPIYNALRVTNPAIDDNENN
FT                   LVLEVAQHLGENSVRTIAMDSTDGLVRGQAVLDTGKQISVPVGRKTLGRILNVIGEPVD
FT                   EMGPVNADKEYGIHREAPEFVDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGK
FT                   TVLIMELINNIAKQHGGFSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPG
FT                   ARARVALSALSIAEYFRDEEGQNVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLA
FT                   TEMGELQERITSTNKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIY
FT                   PAVDPLDSTSRILDPQVIGEEHYAIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLVV
FT                   ARARKIQRFLSQPFHVAEAFTGSPGKYVELKDTIKGFKEIVDGKHDDIPEQAFYMVGTI
FT                   EEAIEKAKKLAV"
FT   gene            complement(525583..526446)
FT                   /gene="atpG"
FT                   /locus_tag="Geob_0448"
FT   CDS_pept        complement(525583..526446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="Geob_0448"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18817"
FT                   /db_xref="GOA:B9LZ85"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ85"
FT                   /protein_id="ACM18817.1"
FT                   /translation="MASLKSIKKRIVSVKNTGQITKAMKMVSAAKLRRAQENVVAARPY
FT                   AAKLGEVLGRLSRNQDADSSPLMIKRTTGKALLIVVTSDRGLCGGFNANLCKAAERFVK
FT                   ERGAEFTDLSIMTIGRKGYEFLKNRQKIRKNFGTVFSNLNYQTAALLAQEVIQGYLDEE
FT                   FDEVFIIYNAFRSVMSQDITLEQLLPVTPPEAADEEYAPEYIYEPSKSELLGELLPKHI
FT                   EVQIFKSLLESVASEHGARMTAMDSASKNANEMIGKLTLQYNRARQAAITTELMEIISG
FT                   AESIKG"
FT   gene            complement(526465..527973)
FT                   /gene="atpA"
FT                   /locus_tag="Geob_0449"
FT   CDS_pept        complement(526465..527973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="Geob_0449"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18818"
FT                   /db_xref="GOA:B9LZ86"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ86"
FT                   /protein_id="ACM18818.1"
FT                   /translation="MEIRAEEISEIIRKQIKEYGSEVEVAETGTIISIGDGIARIHGLD
FT                   KAMAGELLEFPGGISGMALNLEEDNVGAAILGEFSEIKEGDTVKRTNRIVEVPVGEALI
FT                   GRVVNAIGQPIDGKGPINTDKFGKVEVKAPGIVKRKSVHQPMQTGLKAIDAMVPIGRGQ
FT                   RELIIGDRQTGKTAVAIDTIINQKGGDVVCIYVAIGQKRSTVAQVVSKLQEHGAMDYTI
FT                   IVAATASEPAPLQFISPYTGVTMGEYFRDNGKHALIIYDDLSKQAVAYRQLSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERACKVSDACGAGSLTALPIIETQAGDVSAYIPTNVISITDG
FT                   QIYLESDLFYSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLSLAQYREMAAFAQFG
FT                   SDLDKATQMQLARGERLVEVLKQPQYRPIPNEKQVLIIFAANNGYIDEYPVASLGRYES
FT                   ELYSFFDARKSDLLAELRDKKAIDDDIKAKIVSALEEFKKEFTA"
FT   gene            complement(527983..528525)
FT                   /gene="atpH"
FT                   /locus_tag="Geob_0450"
FT   CDS_pept        complement(527983..528525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="Geob_0450"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18819"
FT                   /db_xref="GOA:B9LZ87"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZ87"
FT                   /protein_id="ACM18819.1"
FT                   /translation="MSTNAIAKRYAKALVQIGAEEGNVDKFSGELSQFTGVLAGSTSLT
FT                   AVFSNPAYGIEAKKEILKEIMTKLGLSNNVANFLQLLLDRNRLPFLPQIVESFNSFADD
FT                   LSGVIRPTLTSGLPLEQSQIDEIKNSLTKATGKKVVLKVEVDPSLIGGVVTKIGDKVFD
FT                   GSIKTQLAKIQDILQKG"
FT   gene            complement(528522..529139)
FT                   /gene="atpF"
FT                   /locus_tag="Geob_0451"
FT   CDS_pept        complement(528522..529139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="Geob_0451"
FT                   /product="ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18820"
FT                   /db_xref="GOA:B9LZK6"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZK6"
FT                   /protein_id="ACM18820.1"
FT                   /translation="MRSMRKYITPTPAKVTLAICVLLVALAALGFASEGGEGAHQVDTG
FT                   KQMKDFAWRCLDFAALFALLAWALKKANVKGALADRRTGIEKMLKEAVEAKEQAEKKFA
FT                   EYSEKLEKANREIEDISAAMKQEGELEKARIIAEAKAAAQKIKEQAEQTAQQEVLKAKA
FT                   ELREEAARLAVEIAEKKLKENINKGDQDKLVGNYISKVVTLH"
FT   gene            complement(529140..529565)
FT                   /gene="atpX"
FT                   /locus_tag="Geob_0452"
FT   CDS_pept        complement(529140..529565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpX"
FT                   /locus_tag="Geob_0452"
FT                   /product="ATP synthase F0, B' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18821"
FT                   /db_xref="GOA:B9LZK7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZK7"
FT                   /protein_id="ACM18821.1"
FT                   /translation="MINLDFSFVFQLVNFLLLMLVLNIFLFKPIRKVLAQRNAEISGAK
FT                   EKSASVDKEVQEKHALYENRMREIKARATDERSGLRKEAQVEEAAIIDKARKDAADTLS
FT                   AIKSKVAKESADARQLLKEQALSLSSEICEKVLGRSI"
FT   gene            complement(529728..530564)
FT                   /locus_tag="Geob_0453"
FT   CDS_pept        complement(529728..530564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0453"
FT                   /product="ParB-like nuclease domain protein, putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18822"
FT                   /db_xref="GOA:B9LZK8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZK8"
FT                   /protein_id="ACM18822.1"
FT                   /translation="MVKKTGLGKGMAALLPVVEEEGRRFFSCPIEEIRPNKDQPRKSFA
FT                   HDKLEELAASIREKGIIQPLVVVAKGSHYELIAGERRWRAAQKAGLHEVPVVIQDVSED
FT                   TALEMALIENIQREDLNAVEEAEAYHSLLERFNLSQEELAKRVGKDRSTVANAIRLLKL
FT                   PAEIKLDVIEDRLSMGHARALLTLDTAEQMKEARETVVRKKLTVRATESLVKDMKANKQ
FT                   AKPKKQADPHLVDLTERMQRHFKTKINLRPSGKGGKIEISYHDQKELIRLIELLNL"
FT   gene            complement(530557..531330)
FT                   /locus_tag="Geob_0454"
FT   CDS_pept        complement(530557..531330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0454"
FT                   /product="chromosome partitioning ATPase Soj"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18823"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZK9"
FT                   /protein_id="ACM18823.1"
FT                   /translation="MGKIICIANQKGGVGKTTTSVNLAASLAVAEKRTLLVDMDPQGNA
FT                   GSGVGIDKSNLEATVYDVLIDDVEPDKAILKTSFPFLDILPANGELAGAELELVSIIGR
FT                   ELKLKHALAPLVQAYDYILIDCPPSLGLLTVNSMTAAESVLIPLQCEFYAMEGLSHILK
FT                   TITLVQKGLNPSLRIEGILLTMFDARNNLSHQVSEEIRNHFKKETFTTVVPRNVRLSEA
FT                   PSHGKPIILYDITSRGATSYMDLAKEIISREVQHG"
FT   gene            531533..532750
FT                   /locus_tag="Geob_0455"
FT   CDS_pept        531533..532750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0455"
FT                   /product="sensor protein, DUF3365, HAMP and PAS
FT                   domain-containing, heme-binding"
FT                   /note="domains: DUF3365, HAMP, PAS"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18824"
FT                   /db_xref="GOA:B9LZL0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZL0"
FT                   /protein_id="ACM18824.1"
FT                   /translation="MSRFGSLSINTKFNLIMSCLLIVLFLSASLLIYQRQRSLILKVAV
FT                   DNARSIAKQIIETRDYISSVEHGEPEQNYALVPQVVATQIAARMTRDTKFYVRQVSLRY
FT                   RNPGNRPDDYETEQLQKFSGKVVRENYRVVRAGGEESFRYMQSMIAEKSCLTCHGSYET
FT                   APQFIRERFPRGHYSYNYKLGEVIGAVSVTIPMSELYRDIGTNLKLDLIYRAIVFFIII
FT                   VIMAALLKRIIIRPIRMLSESITTVTRTDTFTPLPKTSNDEIGDLIGAFNDMMDELGRK
FT                   TAQSRESEQRYREFIEVARSAVITFMTDGKIIITNQKAEELLGSSRLELLGENLFNFFL
FT                   EGERLKQEVNLYLEEIRKGKRSAATIFHVVRSVAGGEHRVEVALSATQTDSQPMITAIL
FT                   RDGEGR"
FT   gene            complement(532766..533476)
FT                   /locus_tag="Geob_0456"
FT   CDS_pept        complement(532766..533476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0456"
FT                   /product="zinc-dependent hydrolase YcdX"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18825"
FT                   /db_xref="GOA:B9LZL1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZL1"
FT                   /protein_id="ACM18825.1"
FT                   /translation="MELIADMHTHTIASGHAYSTVNELAEAAARKGLKAIALTDHGPAM
FT                   PGGPHLYHFGAIRFIPREIAGVRILCGTEANILNEHGDIDLPDRYQERLDFVMAGLHEG
FT                   CGFDGQGIEHNTEAVINAMANPRIHAISHPGNPLFPLDYEKIVKAALDTGTALEINNAS
FT                   LGISREGSRPNCERLVELIARYGASLVVGSDAHIAQGVGIFDDALLLLAKAGITETQVV
FT                   NSSMARLLSFLHLL"
FT   gene            complement(533634..533909)
FT                   /gene="atpE"
FT                   /locus_tag="Geob_0457"
FT   CDS_pept        complement(533634..533909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="Geob_0457"
FT                   /product="ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18826"
FT                   /db_xref="GOA:B9LZL2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZL2"
FT                   /protein_id="ACM18826.1"
FT                   /translation="MSFFTMCVLAAGIGMALGTLGTGIGQGLAVKSAVEGVSRNPGASG
FT                   KILTTMMIGLAMIESLAIYALVVCLIILFANPYKDIALELAKTVAK"
FT   gene            complement(533983..534672)
FT                   /gene="atpB"
FT                   /locus_tag="Geob_0458"
FT   CDS_pept        complement(533983..534672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="Geob_0458"
FT                   /product="ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18827"
FT                   /db_xref="GOA:B9LZL3"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZL3"
FT                   /protein_id="ACM18827.1"
FT                   /translation="MVHPFLFLQFFRHLLTPLGISEGGADAIAYTWLIIALLLIVSILA
FT                   TKGLKSVPGKMQNFMEVIIGGIENMVVETMGEHGKPFFPLIATLALFILVSNLIGLIPG
FT                   FFPPTANINTTAACAVIVFVTTHIVGIKEHGVKYIKHFLGPILWLAPMMFFIEVIGHFS
FT                   RVISLTLRLFGNMNGHELVLMIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQ
FT                   GSLEEGH"
FT   gene            complement(534678..535061)
FT                   /gene="atpI"
FT                   /locus_tag="Geob_0459"
FT   CDS_pept        complement(534678..535061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="Geob_0459"
FT                   /product="ATP synthase-associated magnesium import membrane
FT                   protein AtpI"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18828"
FT                   /db_xref="GOA:B9LZL4"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZL4"
FT                   /protein_id="ACM18828.1"
FT                   /translation="MTRVKISENNFFTLLSRASIALTILLALIASSFTSPRFSAGILAG
FT                   GLLAVANFYWLRNILQRALLLQVEDAPRFAILRYVVRLALLAVALLLLVIYAKVDIFGL
FT                   LIGLSVLVVNIIALSIYLSLKGG"
FT   gene            complement(535033..535293)
FT                   /gene="atpZ"
FT                   /locus_tag="Geob_0460"
FT   CDS_pept        complement(535033..535293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpZ"
FT                   /locus_tag="Geob_0460"
FT                   /product="ATP synthase-associated magnesium import membrane
FT                   protein AtpZ"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18829"
FT                   /db_xref="GOA:B9LZL5"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZL5"
FT                   /protein_id="ACM18829.1"
FT                   /translation="MASAYMDEEKKRLIKTLGMISTMGISMAVAIALGVYIGWTLDKWL
FT                   ETRPWFFFIFLFFGIVAGFRNIFIIAGREIKKDDEGEDKRK"
FT   gene            complement(535395..536678)
FT                   /gene="hemL"
FT                   /locus_tag="Geob_0461"
FT   CDS_pept        complement(535395..536678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="Geob_0461"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18830"
FT                   /db_xref="GOA:B9LZL6"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZL6"
FT                   /protein_id="ACM18830.1"
FT                   /translation="MNFSRSADLFKQAQNSIPGGVNSPVRAFKSVGRDPLFIKKASGCK
FT                   IEDVDGNQFIDFVGSWGPMILGHCHPQVASAVKAAVDSGCSFGAPTELEITLAEMVINA
FT                   VPSIEMVRMVSSGTEATMSAIRLARGYTGRDKILKFSGCYHGHSDSLLVKAGSGAATFG
FT                   VPDSPGVPQDFARHTLTADYNSLESVRTLIAENKGQVACIIVEPVAGNMGTVPPREGFL
FT                   EGLRTLCTQEGIVLIFDEVMSGFRVAYGGAQEVYGVTPDMTTLGKIIGGGLPVGAFGGK
FT                   KEIMTLLSPSGGVYQAGTLSGNPLAMTAGIETLKLLQAEGFYRNLEEKSSYVAAGIARA
FT                   AEKAGFPIYSARVGSMFCAFFSKDPVYDWTTAAKCDTEAFAKYFRLMLGEGIYLAPSQY
FT                   ETAFVSIAHATEDLDRTIAAAEKSFRAL"
FT   gene            536972..537328
FT                   /gene="nuoA-1"
FT                   /locus_tag="Geob_0462"
FT   CDS_pept        536972..537328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA-1"
FT                   /locus_tag="Geob_0462"
FT                   /product="NADH dehydrogenase I, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18831"
FT                   /db_xref="GOA:B9LZL7"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZL7"
FT                   /protein_id="ACM18831.1"
FT                   /translation="MLGAYLPIILLVAVAVAFGLGSIIFSSLIGPKKPSEVKLSPYECG
FT                   VEPVGSARERFSIKFYIIAMLFILFDIEAVFLYPWAVLFKRLGMFGLMEMGVFIVILFV
FT                   GYIYVWKKGALEWE"
FT   gene            537319..537831
FT                   /gene="nuoB"
FT                   /locus_tag="Geob_0463"
FT   CDS_pept        537319..537831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="Geob_0463"
FT                   /product="NADH dehydrogenase I, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18832"
FT                   /db_xref="GOA:B9LZL8"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZL8"
FT                   /protein_id="ACM18832.1"
FT                   /translation="MGVEQPLGDNIVTASLDGLVNWARKTSIWPMTFGLACCAIEMMAT
FT                   GAAKHDLDRFGIIFRASPRQADCIIIAGTVTKKMLPVIKTVYEQMPEPKWVIAMGACAC
FT                   SGGVFDTYSVVQGIDEALPVDVYVPGCPPRPEALLYGIMKLQDKIGKERNSFGSAIGLG
FT                   DRLEPAA"
FT   gene            537862..538356
FT                   /gene="nuoC"
FT                   /locus_tag="Geob_0464"
FT   CDS_pept        537862..538356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="Geob_0464"
FT                   /product="NADH dehydrogenase I, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18833"
FT                   /db_xref="GOA:B9LZL9"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZL9"
FT                   /protein_id="ACM18833.1"
FT                   /translation="MADMAENNRAVIKLKEKFASSIIDIKEFRGEVTVTVKKEDIVSIC
FT                   SFLKEQQRYNLLTDITAVDYLGSDPRFMVVYNLYSIPNKDRIRIKAPVSDSDCTIDTVY
FT                   GVWKTANWLEREVYDLMGILFNNHPDLRRILMTDDWVGHPLRKDYPLQGPDREPYKGRL
FT                   S"
FT   gene            538398..539570
FT                   /gene="nuoD"
FT                   /locus_tag="Geob_0465"
FT   CDS_pept        538398..539570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="Geob_0465"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18834"
FT                   /db_xref="GOA:B9LZM0"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZM0"
FT                   /protein_id="ACM18834.1"
FT                   /translation="MASKEIMTVNMGPQHPSTHGVLQLVIELDGEIVEKVTPHIGYLHR
FT                   GVEKLSEHRTYHQTIPLTDRLDYLAPLSNNLGYVLAVEKLLGIEVPERAQTIRVILAEL
FT                   TRLKSHLVWIATHALDIGAMTVFIYAFREREKVMDLYEKISGARMTASYFRVGGLSREV
FT                   YEGFEKDVQEIVDTFPGHFDTYEGLLTKNTIWLQRTVGNGVISAEDAIDYGITGPALRG
FT                   SGVDWDLRRDNPYSGYEKYKFEVPVGQNCDTFDRYKVRLVEMREAVKIVKQALDSLKPG
FT                   PILADAPQVCYPPKEDVYNTIEGLIHHFKIASEGFPVPEGEVYQSVEAPKGELGYYIVS
FT                   DGGTKPYRMRIRPPSFVNLQAIEKMAKGAMIADLVAVIGTLDIVLGEIDR"
FT   gene            539598..540104
FT                   /gene="nuoE-1"
FT                   /locus_tag="Geob_0466"
FT   CDS_pept        539598..540104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE-1"
FT                   /locus_tag="Geob_0466"
FT                   /product="NADH dehydrogenase I, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18835"
FT                   /db_xref="GOA:B9LZM1"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZM1"
FT                   /protein_id="ACM18835.1"
FT                   /translation="MSNAPAEELQAEEIDLSAANQVIDKFLTLPGNLMPVLQGIQEEYG
FT                   YVPKPTIDLVAERLNVYPSQIYGVLTFYAQFHLKPRGKFIIRVCVGTACHVQGAERIVD
FT                   TFFDKLHIGHAETTPDLRFTFEKVACLGACGMAPLAMVNDDTFGKMTVQKVEEIIADYS
FT                   QRPMK"
FT   gene            540139..541920
FT                   /gene="nuoF-1"
FT                   /locus_tag="Geob_0467"
FT   CDS_pept        540139..541920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF-1"
FT                   /locus_tag="Geob_0467"
FT                   /product="NADH dehydrogenase I, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18836"
FT                   /db_xref="GOA:B9LZM2"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZM2"
FT                   /protein_id="ACM18836.1"
FT                   /translation="MSENEAIKILICQGTGGISAGAKKVEQEFTKLIEEKGINAVIGKR
FT                   CDVIKTGCRGLCANDVLVDIITPELGRVTYDFVVPEDVAAILDEHIVKSTPIEKKKAKP
FT                   YYNTFVDQQMRVVMSGCGQIDPDSLQAYLEEDGFKAIEKCIKTMKPAEVIDEVKKSGLR
FT                   GRGGGGFPTGMKWSFCAASPGDKKYLICNADEGDPGAFMDRSVLEGDPFCIIEGMMVAA
FT                   YAIGCYYGYVYVRAEYPLAIQRLQHAIDICYEKGWLGKNIQGWGFDFDMRIKMGAGAFV
FT                   CGEETALMASIEGERGMPRPRPPFPAVKGLWGKPTNINNVETFANVRHIINKGADWYAS
FT                   LGTDTTKGTKIFAVTGKVKHTGLVEVPAGMSVRQVIYDVCGGIANNRKFKAVQAGGPSG
FT                   GCIPAEVLDTPVDYDSLIKAGAMMGSGGLVVMDETTCMVDVARFFLSFTRMESCGKCVP
FT                   CRIGLKAMLDVLERITEGRGQASDIDTLLEMGATIKKASLCGLGQTAPNPILSTIKYFR
FT                   HEYEAHINDKRCPSNCCKELLLWQVVEEKCVKCGACLKACPSNAIIWEKGQIAYLDKEK
FT                   CTKCKSCYDACRFMAIE"
FT   misc_feature    541921..541962
FT                   /note="conserved nucleotide sequence; Geob_R0067"
FT   gene            541963..544449
FT                   /gene="nuoG-1"
FT                   /locus_tag="Geob_0468"
FT   CDS_pept        541963..544449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG-1"
FT                   /locus_tag="Geob_0468"
FT                   /product="NADH dehydrogenase I, G subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18837"
FT                   /db_xref="GOA:B9LZM3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZM3"
FT                   /protein_id="ACM18837.1"
FT                   /translation="MVNLTIDDKKVTVPKDATIYDAAKAAGIRIPILCHDKKLHPFGGC
FT                   RMCLVEVEQMKGRLIPACTTPVTEGMTVRTTNPEIVNARKLVLELLLLKHPVDCPVCDA
FT                   AGDCDLQNLTYEYQVNTNQFTDEKFNHKIDYENPLIERDMNRCIHCGKCARICDEIVSF
FT                   GAYTFINRGIEAKMGTEFDGPLNCEFCGSCVSVCPVGALVSRPFKFKARWWSLNKVKSV
FT                   CSYCGTGCQLTLGVKDDKVLTTVYDENQGFHNGQLCTRGRFGYQFVNSEKRLATPLIRR
FT                   NGKLEPASWGEALTAVAEGLKSAEASGSDAVAGLITPRLTNEELYLVRKLYKDVLGSDN
FT                   LDHSAGYAHSALSAGAFESLGFAASPSTVTDIQKSDLILVVKTDAYETHPVLGFEINLG
FT                   VKRNGVDLRIISDKKGKLSRLPKAKTYVYKPGNEVFLVNALAKAIVDNNLIDAAASGIA
FT                   GLEDFKKSLESYTPLQAAEVCGIPAEEIVALATDYAKADKALIILPLGLGYPGHDKTLA
FT                   QALINLALVAGKIGKEGSGVLIMGEKNNSQGAVDMGIYPAGKGKGASAIIDACSAGTIK
FT                   ALYVIGENPVVSYPNRKKITDALDKVGFLVVQDLFLTETAEKANVVLPACSFAEKQGTF
FT                   TSVGRIVQHVQKAIKPVGQSRSDFDILNGLSGLLGGATFSDPGKVFAEIAREVNGYAGL
FT                   SYEKLGQEGALIPVTTRPKFVPAPARQSIAEAGKYALVTGSALYHCGTMSRFGEGPMHV
FT                   CPEGYAELSREDAAALKIEENDLVKVASAGAEIQLKAKISMRMPKGVVFAPYHFNEQSI
FT                   NTITDGNPVTWVAIRK"
FT   gene            544498..545544
FT                   /gene="nuoH-1"
FT                   /locus_tag="Geob_0469"
FT   CDS_pept        544498..545544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH-1"
FT                   /locus_tag="Geob_0469"
FT                   /product="NADH dehydrogenase I, H subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18838"
FT                   /db_xref="GOA:B9LZM4"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZM4"
FT                   /protein_id="ACM18838.1"
FT                   /translation="MDTLILGLPVAYYIAMIAKVLVAFVFVLLTVAYATYAERKIIGHM
FT                   QVRLGPMRTGWHGLLQPIADGLKLFFKEEVIPAQSSKFAFLLAPLVALIPAFIAFAVIP
FT                   FGETIEVAGYKVPLQIAAVYDPAGDRILDVNVGVLYILGMASLGVYGVVLAGWSSNSKY
FT                   SLLGGLRASAQMVSYELAAGLAIVAVFMLSESLSLQKIVADQAGFAWYAFKQPLAFVIF
FT                   FICSLAEINRTPFDLPEAETELVSGFITEYSSMKYAMFFMAEYANMVTVCAVTTTLFLG
FT                   GWHGPAFLPGWVWFIAKVYFLIFVCMWIRATYPRYRYDQLMRLGWKVFLPLTLLNVVVT
FT                   GIVVTLLK"
FT   gene            545573..545971
FT                   /gene="nuoI-1"
FT                   /locus_tag="Geob_0470"
FT   CDS_pept        545573..545971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI-1"
FT                   /locus_tag="Geob_0470"
FT                   /product="NADH dehydrogenase I, I subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18839"
FT                   /db_xref="GOA:B9LZM5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZM5"
FT                   /protein_id="ACM18839.1"
FT                   /translation="MIMPLLKGLGITLSHLFKKPVTLQYPDERPEVAPTFRGLHALNIS
FT                   HDKAKCVACYLCPTVCPAKCIKVEAGEDENHNKYAAEYEIDMLRCIFCGFCVEACPVDA
FT                   VRMTEAFELANYTRADFVFSKERLLEKK"
FT   gene            545983..546489
FT                   /gene="nuoJ-1"
FT                   /locus_tag="Geob_0471"
FT   CDS_pept        545983..546489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ-1"
FT                   /locus_tag="Geob_0471"
FT                   /product="NADH dehydrogenase I, J subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18840"
FT                   /db_xref="GOA:B9LZM6"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZM6"
FT                   /protein_id="ACM18840.1"
FT                   /translation="MLESLFFLIVAAVAVISSILVITCRNPINSALSLVMTFFCLATFY
FT                   VMLDAPFMAAIQVIVYAGAIMVLIVFVIMLLNIRTETGRKTTHAVLAGSIVGLLILFQT
FT                   CYFLTKGSMTGLTGAMDTALIEKVGHVELIGKALYTDFLLPFEITSLLLLVAIIGAVIL
FT                   SKRKI"
FT   gene            546509..546811
FT                   /gene="nuoK-1"
FT                   /locus_tag="Geob_0472"
FT   CDS_pept        546509..546811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK-1"
FT                   /locus_tag="Geob_0472"
FT                   /product="NADH dehydrogenase I, K subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18841"
FT                   /db_xref="GOA:B9LZM7"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZM7"
FT                   /protein_id="ACM18841.1"
FT                   /translation="MLALNNYLIISAILFSIGTIGVLVRRNAIVIFMCVEMMLNAVNLT
FT                   FIAFSKYLGNIDGQIFVFFVMTVAAAEAAVGLALMIAFFKNRESIDVEDVNIMKW"
FT   gene            546857..548863
FT                   /gene="nuoL-1"
FT                   /locus_tag="Geob_0473"
FT   CDS_pept        546857..548863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL-1"
FT                   /locus_tag="Geob_0473"
FT                   /product="NADH dehydrogenase I, L subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18842"
FT                   /db_xref="GOA:B9LZM8"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZM8"
FT                   /protein_id="ACM18842.1"
FT                   /translation="MFEYVWLIPLFPLIGVVINGLFGKSIKNEKIIGGIGSAMVFGSFL
FT                   VSCSILFKLLSLPSEERLYELNVFTWMQSGNFKADIGFLIDPLSALMIMVVTGVGFLIH
FT                   LYSIGYMHGEEGFYRYFTYLNLFTFSMLLLVLGNNLLLMFVGWEGVGLCSYLLIGYYFH
FT                   KKSAGDAGKKAFVMNRVGDFGFLLGVFTLFWFLGQNHNIWTINFVELGKASHLLPVGGI
FT                   VTIITLCFFLGATGKSAQIPLYTWLPDAMEGPTPVSALIHAATMVTAGVYMIGRMNFIF
FT                   IKAPETMLVIACIGAATAIFAATIGTAQNDIKRVLAYSTVSQLGFMFLAMGVGAFAAGV
FT                   FHLMTHAFFKACLFLGSGSVIHSMHHALHHAHSHDDAQDMRNMGGLKSKMPITFITFLV
FT                   STIAIAGIPGFSGFFSKDEILWQAFANPFHGSLNYVLWGTGAIAAGFTAFYMFRLVFMT
FT                   FFGECRITAKAKDHLHESPFVITLPLMVLGTLAVIGGYVGIPKLIGDVLGGIPNYFEHY
FT                   LEPVFKISEEFAKEHVHAAAHHSHALEWGLMGTSVLIAVIGISIAYALYIISPSIPAKF
FT                   TAAFPGLHKAVYNKWYIDELYDFLFVNPCKALGHFLWKGFDVLVVDGIVNGVAKVTMGF
FT                   SGVLRHVQSGFVHNYALTMALGMVVIVGFYLFR"
FT   gene            548909..550495
FT                   /gene="nuoM-1"
FT                   /locus_tag="Geob_0474"
FT   CDS_pept        548909..550495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM-1"
FT                   /locus_tag="Geob_0474"
FT                   /product="NADH dehydrogenase I, M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18843"
FT                   /db_xref="GOA:B9LZM9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZM9"
FT                   /protein_id="ACM18843.1"
FT                   /translation="MNQMPALLSIITFLPLLGVLLLLFVNKNSHAVARGIALGVSLIVF
FT                   LVSIPLITGFQNTAEFQFVEKVPWISAGPFQMSYHIGIDGISLWLVILTTFIMPIAILS
FT                   TWTAVEEKVKEYMICLLLLEVGMLGAFIAIDLFLFYIFWEVMLIPMYFIIGIWGGKNKI
FT                   YAAVKFFIYTMVGSLLMLVALIALYFKAGGGDFNLLKFYQLSLDPVTQTWMFLAFALAF
FT                   AIKVPMFPLHTWLPDAHTEAPTAGSVILAAVLLKMGTYGFVRFAIPLFPLATDQFTPLI
FT                   ATLSVIGIIYAALVAMVQEDVKKLVAYSSVAHLGFVMLGVFALNEQGIAGGMLQMLNHG
FT                   VSTGALFLIVGFIYERRHTRLITDFGGLSKQMPVFATIFMIVTLSSIGLPGTNGFVGEF
FT                   LVLIGSFESSIRWYSVIATSGVILSAVYMLWMFQRVMFGELNNPKNQVLKDLNAREIAI
FT                   MLPLLVLIFFMGVYPRPFLDKMSPSIVNLVQHVKTKQAAANPQLTVSQPVQAIPAVPIA
FT                   DPHAATPAEVK"
FT   gene            550529..551992
FT                   /gene="nuoN-1"
FT                   /locus_tag="Geob_0475"
FT   CDS_pept        550529..551992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN-1"
FT                   /locus_tag="Geob_0475"
FT                   /product="NADH dehydrogenase I, N subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18844"
FT                   /db_xref="GOA:B9LZN0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZN0"
FT                   /protein_id="ACM18844.1"
FT                   /translation="METIPMPAINFAAVMPETILSVFAMVLLLVNVFVPGKQKAYLAYL
FT                   SLIGIIVAGVSVFNAWDAPLSLQEGFNGSVLQDNFSLFFKAIFLVSAALTLLISDQYLE
FT                   RENCNHGEIYPLILLATAGMMLMASGTDLMTIFLGLEVLSVALYVLAGFNRENLKSNEA
FT                   GLKYFLLGAFSTGFLLYGMALTYGATGSTKIANIASYVSQNGAVTANPLFLVGMLLIAV
FT                   GFSFKIAAAPFHMWTPDVYEGAPTPITAFMSAGPKAAGFAAFIRVMVFAFPTLKADWSD
FT                   LLWILAVLTMTIGNIIALKQDNIKRVLAYSSIAHAGYALVGFAAGSAEGAAGILFYMLS
FT                   YAFMNIGAFAIIILIGKKGEANSNVTDFAGLGFRRPVLAVLMAIFLFSLAGIPPMVGFV
FT                   GKFYLFSAAIKSGYIWLAIIGVLNSAASVYYYLRVMVYMYMKDPVEEFDWVKVTPAIAL
FT                   CLVISVAGVMIPGVVPGYLLQLAQKAVLF"
FT   misc_feature    complement(552073..552115)
FT                   /note="conserved nucleotide sequence; Geob_R8003"
FT   gene            552267..553604
FT                   /locus_tag="Geob_0476"
FT   CDS_pept        552267..553604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0476"
FT                   /product="efflux pump, RND family, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18845"
FT                   /db_xref="GOA:B9LZN1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZN1"
FT                   /protein_id="ACM18845.1"
FT                   /translation="MQIIYFALCLLLSFPMMCFAEPKISPRQAILIALEKNHQLQATAH
FT                   EVTAAEEDVNINRSRYLPRVSFEESAAVSNSPTRVFMMKLDQGKFASSDFDTANLNKPD
FT                   SYHDFKTALTLEQPLFDLSLLKSTSIAKTAVESQKFAADQKRQDVAVQVYSAWLAVRRA
FT                   KAYVSIAEQAMAEAKEHLRLAGARVGVGTGLKSEGLRAKTFLFDVEQQLVTASNDLKLA
FT                   KMQLAMVIGGTPGEEVDIVDDLSVVEMTSTMKELQLLAVENRKDLQAVNKETQKAATAI
FT                   ELARAAYLPTLYASASYQLNDYSVPFGRDNDSWQAGVTLRWEFFSGLKTRNEVNKFKSL
FT                   ERAAQEYQKDYANSIAYQVSENVLRHGEAGKRLELARQAVIDAEESVRLISKRFQNSLS
FT                   PMVELLDAQTSLNRARAVQVEMENGQALALARIWQSAGIFLKEVLK"
FT   gene            553601..554731
FT                   /locus_tag="Geob_0477"
FT   CDS_pept        553601..554731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0477"
FT                   /product="efflux pump, RND family, membrane fusion
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18846"
FT                   /db_xref="GOA:B9LZN2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZN2"
FT                   /protein_id="ACM18846.1"
FT                   /translation="MRLWKTGRLAVYVVLVLLVNSACSKSKEGTKEGPGPIVSGIIVEK
FT                   MVTEMVPEQVEAVGSIRSINSAQIAARIAGTVTSMKVREGDSVGKGALLMTLASAETTA
FT                   GAAGARAAVEQASHGVEEARSRKQFADVTFERYQKLLQEEAVTRQEYDGRLSEKEVAAR
FT                   SLAKAEAALAAAREGARGASSLAGYGKIYAPISGIIVTRLVDVGMTVFPGTQLFTLEEQ
FT                   GAYRLEVAAPESLLGKVKVGGRVPVSLDGVPAAKTGVVEEVVPAVDRATRTFIVKIALT
FT                   DKGLRSGSYGSANFQMGTRQGLLLVKKAVVTQGALTSVWVVGQDGIVRMRIVKTGKTVG
FT                   DKVEILAGLAIGEAVVTAGMEKVVEGARVEEKSRQQ"
FT   gene            554786..557995
FT                   /locus_tag="Geob_0478"
FT   CDS_pept        554786..557995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0478"
FT                   /product="efflux pump, RND family, inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18847"
FT                   /db_xref="GOA:B9LZN3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZN3"
FT                   /protein_id="ACM18847.1"
FT                   /translation="MSGLGFAGRIARAFIDSKLTPLIVGASLLLGLYAVLVTPREEEPQ
FT                   IVVPMIDIYLPMPGATPREVEERVVKPMEAKMWEIKGVEYIYSASRPGLGIVTVRYKVG
FT                   EDMENSLVKLYNKVMSSKAALPPGAGEPQVAPKSIDDVPILTLTLWSERYDHYTLRRVA
FT                   RELCDELKKSENVAESDIKGGQARQIKVRLDPGKLAGLGLSPLQVMGALQKENSAVRSG
FT                   SFSGMSKDYLVETGTFLAGADTVRRIVVAAKAGRPVYVEDVATVEDGPEEAKDYVFHGL
FT                   GRSAEGVEKASRAASYPAVTLSFAKRKGANATWVAEDLVKKTELLKGKLIPSDVHVTVT
FT                   RNYGETAREKNNELLFHMFLAAFSVTILIAVFMGWRAGAVAAIAIPVTLALTMLIFNQI
FT                   GYTLNRITLFALIFSIGILVDDAIVVVENIHRYFTTTRFAPLEASIKAVDEIGNPTILA
FT                   TFAVIASILPMGFVGGLMGPYMRPIPVGASMAMLFSLLIAFIVTPYFAYRFMKGESHFG
FT                   REEVVKESRLTLFYRRFMGNLLHKKRVRYVFLTGVVVLLLASCSLIYFKLVTVKMLPFD
FT                   NKNELQVIVDAPDGTALEETARMLAEMGDALRNVPEVVDFQTYVGVSSPFNFNGLVRHY
FT                   YLRKGSNVGDIQVNLVHKSKRSEQSHDIAKKIRPVLKTIADRYSARLKVAEIPPGPPVL
FT                   STLVAEVYGPDQETRLTIAAQVKEIFRKTAGVVDTDWYVEDDQAKISFQVDKEKAALSG
FT                   IATEDVAKTLQIALDGMNAGIAHLPNEKEPVGINLRLPVERRSSIADLSFIHIAGTHGN
FT                   VPLTELIRVKNGAEDKSLYRKNLKNVVYVTGDVAGVVEAPVYAILKMQKEIDKIALPGG
FT                   YKIEQRAASQPWSEIRPGLKWDGEWHITYEVFRDLGLAFAAVMVLIYVLVVAWFKDFTT
FT                   PLVIMAPIPLTLIGILPGHAIMGAFFTATSMIGFIALAGIIVRNSIILIDFAELRRREG
FT                   MALDEAIIDAGAVRFRPMLLTAAAVVIGSFVIVFDPIFQGLALAMMCGEIASTALSRVT
FT                   IPVLYFLVQSWKEKRQQKIAA"
FT   gene            558025..558462
FT                   /locus_tag="Geob_0479"
FT   CDS_pept        558025..558462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0479"
FT                   /product="redox-active protein, C_GCAxxG_C_C family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18848"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZN4"
FT                   /protein_id="ACM18848.1"
FT                   /translation="MFWSKQKKDEIEVEGVVGNVAAEAEGLFRSGKMHCAEAVLAAIRS
FT                   NFAPQIPEAVVRMASGFGGGSGSGCVCGAVAGGTIALALVLQEDKKQIGSLTKELHKWF
FT                   KEQYGATCCKVITQKDKGGCPLLTGNVAGKVAEMLKVTQEK"
FT   gene            558499..558711
FT                   /locus_tag="Geob_0480"
FT   CDS_pept        558499..558711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0480"
FT                   /product="protein of unknown function DUF2892"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18849"
FT                   /db_xref="GOA:B9LZN5"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZN5"
FT                   /protein_id="ACM18849.1"
FT                   /translation="MHIDRMLRLIAGFFVMLSVALAHLHSINWLWFTAFIGLNLFQSAF
FT                   TNWCPMMTILAKAGVPKLPPNCGCK"
FT   gene            558708..559538
FT                   /locus_tag="Geob_0481"
FT   CDS_pept        558708..559538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0481"
FT                   /product="metal-dependent hydrolase, beta-lactamase
FT                   superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18850"
FT                   /db_xref="GOA:B9LZN6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZN6"
FT                   /protein_id="ACM18850.1"
FT                   /translation="MKGRITVLCDNGVGPLAGTLGEHGFAALIETASGSLLFDTGQGAT
FT                   LLHNAQRMQRDLRRVDKVAISHGHYDHTGGLWPLLQWCGPKRVYGHEGIFAGRYTLRDG
FT                   EKGRSIGMPYSREFLEGQGASFDLDASFREIAPDIFLSGEVPRKQAFEQGDTGLFCDAA
FT                   GCIPDQVPDDQSLVLKTGKGLVLVLGCCHSGMINTLELVRERTGETRIYAVIGGNHLGF
FT                   SSQAQLNGTVKMLGTYGIEKICGSHCAGFAASARLMKEFPGKFHPAQVGYTLEM"
FT   gene            559561..559938
FT                   /locus_tag="Geob_0482"
FT   CDS_pept        559561..559938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0482"
FT                   /product="rhodanese homology domain superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18851"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZN7"
FT                   /protein_id="ACM18851.1"
FT                   /translation="MRLTAVACATVIVWATLAFAAGEKNISSREAKGLLSKGKNVFLLD
FT                   VRTPDEYRQAHLRGAVLIPVNEIERRLREVPKNRPVVVYCAVGSRSGMVAGYLAGKGYS
FT                   EVYNMSDGIVGWYRSGFSIER"
FT   gene            559967..560272
FT                   /locus_tag="Geob_0483"
FT   CDS_pept        559967..560272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0483"
FT                   /product="helix-turn-helix transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18852"
FT                   /db_xref="GOA:B9LZN8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZN8"
FT                   /protein_id="ACM18852.1"
FT                   /translation="MTVEEQALLIRILGHPVRLRIVTELGDRCVCVKEMWQHLCLPQAV
FT                   VSQHLKVLKESGIVTARREGTRVCYSLQAELMAELVTVLSPRKVPAPCASDPSGRQ"
FT   gene            complement(560208..561905)
FT                   /gene="mcp64H-3"
FT                   /locus_tag="Geob_0484"
FT   CDS_pept        complement(560208..561905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp64H-3"
FT                   /locus_tag="Geob_0484"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18853"
FT                   /db_xref="GOA:B9LZN9"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZN9"
FT                   /protein_id="ACM18853.1"
FT                   /translation="MFFKKYLSSMKSTCIFMLCFGLFMGIVFPFYSWLFFGKGAFTPMY
FT                   VIGCMLAGIAVGTFCYYIIKQVMKIHVENQWRTLSAIAGQEEMERIGKGGDELKLLLEC
FT                   HDLLLGKVLKMVENVAALSLDINSYHLGIGDQSKEIVQSGEKQVAKEKETLQAVRDMNG
FT                   FFNDLLLEIEDISRRTDDRASITAEMSATTDMIAGNIKDFTASVLETSASIEEMASSIN
FT                   ETATNVEALALSTEQTSSSISEISAVNNNVRDNAQRTSECAEDMRKKATEGMQSMTATL
FT                   KAMREIEKTNADSFAAINRLSVHSARVGEFLNVIKEVVDQTNLLSLNASIIAAQAGEQG
FT                   KSFSVVAEEVRSLAKRTSLSAKEIQELVASIQKETAEVQRTISQEKDRIRDGVKISAIA
FT                   NTALEKIAQGTAEASQMVQKIATSTVEQAAASKMITEEAEKNLDRVKQFTGAIHEQKRG
FT                   IGLIVKALDKMRSFSALISNSTQEQSRGNRLYLKSVMEDNDRVKQLKETAVQQIMMGDV
FT                   LLNYVTEAGLLNEANSMLAEDMMKKIKVIAALTDRMHRELAPFVVKGQ"
FT   gene            562085..563137
FT                   /locus_tag="Geob_0485"
FT   CDS_pept        562085..563137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0485"
FT                   /product="sensor histidine kinase, PAS domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18854"
FT                   /db_xref="GOA:B9LZP0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZP0"
FT                   /protein_id="ACM18854.1"
FT                   /translation="MKKTAAHQKTAPDMASVAESIIASQSTGIIYLDGDGRIALINARA
FT                   ESMLHTSAGDVTGKRVDMLPLRTPVYRVLSENCREMPVEVSVNGAVLTARSAEVRIPSG
FT                   ESSGEIYELLDVTEEKKEKRHREEIVAMMTHDLKSPLTVLMGYVQALRNEDGTKVHVSL
FT                   LPCLDEMDRSALKLLAMIEDVLDAYRLEVGLLQTTCSWCDLSAILEACCHDMAREASSR
FT                   GVRLNHNIESGIPAMNVDGNQLSRVFANIIGNAVKFTPRKGQVTVNAWLGDEKLHVAVT
FT                   DTGIGIPQKDLPRIFNKYFRSKGANGFRGTGLGLTISKAIVEAHGGAIAVESAVGEGSC
FT                   FTIVIPCSAA"
FT   gene            563195..563602
FT                   /locus_tag="Geob_0486"
FT   CDS_pept        563195..563602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0486"
FT                   /product="hemerythrin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18855"
FT                   /db_xref="GOA:B9LZP1"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZP1"
FT                   /protein_id="ACM18855.1"
FT                   /translation="MSLITWNQSLSVNVKQFDEQHKKLIDLINKLHDAMKAGKGKDVLG
FT                   EILQSLVDYTKQHFAAEEALLQKHGYGDYEKHKKEHNLLVMQVADIQKKLKEGSPVLTQ
FT                   TVMTFLKDWLSNHIQREDQKYGPFLNDKGLS"
FT   gene            563681..564043
FT                   /gene="cheY64H-1"
FT                   /locus_tag="Geob_0487"
FT   CDS_pept        563681..564043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY64H-1"
FT                   /locus_tag="Geob_0487"
FT                   /product="response receiver CheY associated with MCPs of
FT                   classes 40H and 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18856"
FT                   /db_xref="GOA:B9LZP2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZP2"
FT                   /protein_id="ACM18856.1"
FT                   /translation="MANVLIVDDSSTMRKIISRSLRQAGLVVDDIFEAGDGIEGLSVLG
FT                   EKKVDLILSDINMPNMDGLEFIKQVRASGKQIPIVMITTEGGEDVLKDAMSSGASDSIK
FT                   KPFTPEQLNEKLGGLL"
FT   gene            564043..564549
FT                   /gene="cheX64H"
FT                   /locus_tag="Geob_0488"
FT   CDS_pept        564043..564549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheX64H"
FT                   /locus_tag="Geob_0488"
FT                   /product="protein phosphoaspartate phosphatase CheX
FT                   associated with MCPs of classes 40H and 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18857"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZP3"
FT                   /protein_id="ACM18857.1"
FT                   /translation="MTLNSAVSKAVNMQEEDLAGYVIHATKEVFNTMVMLDLEDSYPLR
FT                   EPVTTFHCSVTGMVGLAGTYTGILSIHCPKTFALRITSNMLGMDVADVGEDVNDALGEI
FT                   ANMLGGYVKQILSKGGLDINLSIPTVISGEEYTVNSMSDDNCVIIPFTNEGERFLVALK
FT                   LRKEG"
FT   gene            564566..565597
FT                   /locus_tag="Geob_0489"
FT   CDS_pept        564566..565597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0489"
FT                   /product="response regulator"
FT                   /note="domains: REC"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18858"
FT                   /db_xref="GOA:B9LZP4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZP4"
FT                   /protein_id="ACM18858.1"
FT                   /translation="MAGFEKLQEMLDAALKQAGEESSMLLGVTLSSGDSDIINTNRKSY
FT                   FADMDDAVFVVAVESKEEYQGYFYLLFSLGDAIVMSSILLGIPAPRIAEKRRLRIMEAD
FT                   DIDAFGEIANQIIGSFNSVFQPKLPQKVHLKLLPPPKKYIPEIDQLTDAEPLPEGDYLM
FT                   YRAPLEIEGQEMHYLDIMVPPELANLFDPQQEEKAAAASPEAATKAEAGDADTESAPRT
FT                   QSILILCEDVDERQTVREYLAATGFDLVDAPLGADLHELLKETEVRVAVIEVNETGERD
FT                   LAVCNRVCAQSSKASLPIIMCAGQWTRTAVLKALTYGASDILMKPFDADELMAKVQKYL
FT                   HAA"
FT   gene            565762..567891
FT                   /locus_tag="Geob_0490"
FT   CDS_pept        565762..567891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18859"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZP5"
FT                   /protein_id="ACM18859.1"
FT                   /translation="MKFAGPFKHTGLPLALFFCRCLAGAGLLILCLLDAAEATAQELAR
FT                   LQRVEVGQQASSTRLDLKLDQATTYTVAESANRIRLTLKDTDGPLFRKLNTYTDSHISG
FT                   IRFSQRGKDLQITIGTRDAVPCLRIMDLAEGILTVNVGKENGQPAVPAIVPGRELILQG
FT                   TARLVTDFDPPLKAEIPFVPTDPDQLQKVAVDAEVKLFQRGESFLYKEMGAEAAEIFAW
FT                   FTGRDTPLRPLACYRLGESLYLLGKYDAALNAFREGEQRWPAYMAFNPATTFYFADSIA
FT                   RMGNLADGRKMLARLIAQLAEKTYAPLLLDRLADILARNGRDKEAVAIFGTIAEGFPET
FT                   EAAYHALLKLADRRLFSVSADTYQPLAEQYRSIHRAAGAVSLRDDANFKAALMESLYGQ
FT                   ADKALAAVIQYEKQYPQGTFVTIAHSMRQELLLQVYLEMYRAKNYPGLIDLAQQNRDYL
FT                   ARCFSDEMFIHRLAEAFSHLQRPAGKVELFNHLAERDWTERAAPFIYGQIVDTSMAMGN
FT                   LAMADLTAANFLRRFPNHPDYRHMLEHRGEIAFLKKNLPGVVAELFWLAKPKEKAAQLN
FT                   SYYYLGKALTAQKDYKRGEKVLGQFVDGLSQSKASSTFAGDAYFTLGTARRGRGDHRGA
FT                   MAAYVAGLEVAGGGMKEQFLFAMGEMELQMKNYGEAKGHWNRILKEGTDPVWRRMAEQG
FT                   LGDLQWKEKMETLTR"
FT   gene            568032..568454
FT                   /gene="flgB"
FT                   /locus_tag="Geob_0491"
FT   CDS_pept        568032..568454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="Geob_0491"
FT                   /product="flagellar basal body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18860"
FT                   /db_xref="GOA:B9LZP6"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZP6"
FT                   /protein_id="ACM18860.1"
FT                   /translation="MPVDGIFGSTVDILGKSLDLRAKNHNHISANVANAETPGYMPTRL
FT                   SFESELKDAVKGKGIGKGAVTHPRHIPLKGKGGSVEEVAGTVVETPAKSVGMDNNAVEL
FT                   ENEMGKMAENQIMYNASVQLLGKKFEGLKYAIKGGN"
FT   gene            568454..568894
FT                   /gene="flgC"
FT                   /locus_tag="Geob_0492"
FT   CDS_pept        568454..568894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="Geob_0492"
FT                   /product="flagellar basal body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18861"
FT                   /db_xref="GOA:B9LZP7"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZP7"
FT                   /protein_id="ACM18861.1"
FT                   /translation="MDFFTSMDISASALTAERTRMNLISSNLANAGSTRTAEGGPYKRK
FT                   DAVFAAEPVVEPFSSILKKAGGSMEPKQVGVVQITEDQTPPRLQYDPTHPDADAKGYVA
FT                   LPNVNVVEEMADMIAATRTYEANVTAAQAAKSMALKTLELGR"
FT   misc_feature    568916..568979
FT                   /note="conserved nucleotide sequence; Geob_R6104"
FT   gene            569006..569314
FT                   /gene="fliE"
FT                   /locus_tag="Geob_0493"
FT   CDS_pept        569006..569314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="Geob_0493"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18862"
FT                   /db_xref="GOA:B9LZP8"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZP8"
FT                   /protein_id="ACM18862.1"
FT                   /translation="MVIKAIESGTGIEHAFPSPVAKETAGAAPAESFSKYLGEMVGKVN
FT                   DMQLSADKSIQSLATGEATGLHEVMLAVEKASISFQFLNQVRNKAVEAYQEIMRMPV"
FT   gene            569363..570931
FT                   /gene="fliF"
FT                   /locus_tag="Geob_0494"
FT   CDS_pept        569363..570931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="Geob_0494"
FT                   /product="flagellar M-ring mounting plate protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18863"
FT                   /db_xref="GOA:B9LZP9"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZP9"
FT                   /protein_id="ACM18863.1"
FT                   /translation="MPEGLKKLLDPFLSLPTSKRLIVAGVAACSLLAFAALIFVANRTD
FT                   YRPLFANLTTEDAGEIVKKLKDQKVAYQISADGKAILVPSDKVYELRLSLAGEGLPQGG
FT                   GIGFEIFDRKNFGMTEFVQKLNYQRALQGELSRTIAQLAGVEQARVHLVIPEKSLFKDS
FT                   EKPPTASVVLKMKSNRTLRENEVQGVVHLVSSAIEGMDTENVTVLDSRGKVLSRTGPSD
FT                   ATGKLTSTMQETQRNYEKNLEERLQSLLDKVVGSGRSVARVSATFDFKQVEKYEEKYDP
FT                   ETAAVRSEQRSEEKAGATNIAAGVPGVQTNMGRTAPGAGTTGGGSKSDETLNYEVSRTT
FT                   ARIIEPVGSLTKVSVAILVDGKYEAPAAAKAGAAKAKYQPRTPDELQKIESLVKSSVGF
FT                   NAERGDQVTVANIPFQETGDMGSAEDAWWNAPIVMTLLKNLLIAGGFFAIIFFVIKPLM
FT                   RMLPHRPPSFQPVQEDLEMIQLNEAHKQELALQTLNQLELIEKVKQDPYQVAQILQNWL
FT                   VHKEQ"
FT   gene            570945..571937
FT                   /gene="fliG"
FT                   /locus_tag="Geob_0495"
FT   CDS_pept        570945..571937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="Geob_0495"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18864"
FT                   /db_xref="GOA:B9LZQ0"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZQ0"
FT                   /protein_id="ACM18864.1"
FT                   /translation="MTGSDKAAILLLYLGPDATSKVFEHMDDVDIKKISQSMARLGHVP
FT                   RDVIQGVVTEFTDITNPETGFFSQGEEFVKKILEKALGVQKAESLLQELRTSSIGDMVD
FT                   ILATMDSKTIANFFSQEHPQTIAVILAKLKPKQTSEIVGLLPQELQAEVVIRIAEVDQV
FT                   SPEILAEIDEVIRKELTALGGVQRFKVGGVEKVVDMFSYLDRSKEKKILDRLDALNPPL
FT                   AEVIRKHLFTFEDIFKLDDRAIQSIMREVSNDTLTLAMKTSPDDVKDKIFRNISSRAAE
FT                   MIKEDLEVMGPVRLSDVEKAQSEIIKVVRKMEEDGKVVIAGRGGDDVLV"
FT   gene            571924..572718
FT                   /gene="fliH"
FT                   /locus_tag="Geob_0496"
FT   CDS_pept        571924..572718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="Geob_0496"
FT                   /product="flagellar assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18865"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZQ1"
FT                   /protein_id="ACM18865.1"
FT                   /translation="MSSSRIIKSIDDAGFMGFHFRELKGSADELPAADSHNAPFTPVIP
FT                   GAWTAADKEEVAGNAEEDTAGAVEEKIVVGISEEEADRREQAAYNEGLREGKRQAEESL
FT                   AKVSEALAKALLSTGGLRQKVMQESEEDLLKLAIVIARKIILQEISVDRRILVNIVKAA
FT                   VSNVSDGDEVVVRLSPADYEIVADHREFLPPANEKRRITLKADETIPGGGCLVETSMGA
FT                   IDARIEAQLDEIFRRFMEDRSVTALEADTMETEEKTDAGEED"
FT   gene            572699..574030
FT                   /gene="fliI"
FT                   /locus_tag="Geob_0497"
FT   CDS_pept        572699..574030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="Geob_0497"
FT                   /product="flagellum-specific ATPase FliI"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18866"
FT                   /db_xref="GOA:B9LZQ2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022425"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZQ2"
FT                   /protein_id="ACM18866.1"
FT                   /translation="MLAKKIDLSRFLPAVESARPIKLHGKVTQVVGLVIEGFCPETAVG
FT                   TLCEINSQGSESIPAEVVGFRENKTLLMPLGELRGVGLGSLISVRREKASLGVGPALLG
FT                   RVIDGLGAPIDDRGPIITGEEYPIYATPVNPMKRRPIRQPLDLGIRAINGLLTCGEGQR
FT                   VGIMAGSGVGKSTLLGMIARYTEADVNVIALIGERGRELREFIEKDLQAEGLKKSVVVV
FT                   ATSDQPPLVRMRGAYIATTIAEYFQAQGKKVLLMMDSATRFAMAMREVGLAIGEPPTTK
FT                   GYTPSVFAALPKLLERTGNFQNGSITGLYTVLVEGDDFNEPISDAMRSILDGHIVLSRE
FT                   LAARNIYPPIDVLNSASRVMMDVTAKNHQKLAGNFKGVLATYRQAEDLINIGAYKPGSN
FT                   PGIDYALAKIEHMNAYLKQDIKDGVGVENAVMELEAIFDDTMAL"
FT   gene            574071..574517
FT                   /gene="fliJ"
FT                   /locus_tag="Geob_0498"
FT   CDS_pept        574071..574517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /locus_tag="Geob_0498"
FT                   /product="flagellar export protein FliJ"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18867"
FT                   /db_xref="GOA:B9LZQ3"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZQ3"
FT                   /protein_id="ACM18867.1"
FT                   /translation="MTKKGFQLDQVLNFRKEMEKMRKIDFAAAKYELDGANEQLARAES
FT                   AMRRLSEELREKQIDGISANDLQLYANFSRKKREQIIDQRQEVVALERKVVEKRETLLT
FT                   AAKDKKVLEAFKERKVQAMKRDAAERELHFLDEISIQKKGHGKR"
FT   gene            574514..575029
FT                   /locus_tag="Geob_0499"
FT   CDS_pept        574514..575029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18868"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZQ4"
FT                   /protein_id="ACM18868.1"
FT                   /translation="MKKILLIIPLVAFVMLWHTEMEPSALQRVALAQSPVAATVSPKTD
FT                   RDEAAALEKQRQQLLEKEAALKAKEEELKKLSASLDSRINELNAARKSMEGSLQTRKKE
FT                   ENERYRKMIKIYKALKPEEAGRLMDKLEEPLVIEMLNQMDQKTAVKLIPYLNQPRVIKW
FT                   TRDNLVGR"
FT   gene            575081..576802
FT                   /gene="fliK"
FT                   /locus_tag="Geob_0500"
FT   CDS_pept        575081..576802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /locus_tag="Geob_0500"
FT                   /product="flagellar hook-length control protein FliK"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18869"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZQ5"
FT                   /protein_id="ACM18869.1"
FT                   /translation="MDNMQVVLPSQGAALIPLVTPVSIGKAAAVNSAFLNAGPTFAELL
FT                   GNIAMEPAADVLKGEEPRAAVPESASAGNAEPVKKGDEAEVSPVALEGDQLLLTVQQTT
FT                   IAVGAIPIQPQEQNQNRAQTETPQLQVQTGKQLPSEVQVPVAKLPDPQVQVPPQPLIQA
FT                   QKEPIPEVKTEPFHGEAMMKTAETAAVMPQQKQGETEPPSENRQKAETESIPQTRISKT
FT                   TATAEVEPVLAEAAPEAGAAKKVELPERVVVPSGNGIPASATVSVASPLFESGIELSVE
FT                   GTKATEVVAKADPGLGKSAPVTISGQTETQETTPAITVETTPAEAPGIKEKTVRQVQDR
FT                   MTVRAGDGHVETAESKPATAGKDAAASGQKEMPEIKTTGKPFSPDLGDSGGNSATGERG
FT                   MNSQLQFAATGEVVKTSAISETPYKGEAPATATAESIVSQVKESLTLHNPKEGRQITLT
FT                   LNPAELGELKINVSMEGQRLKVEVVAENAMVRDVLMANIDTLKESLSKQNVTMERFNVS
FT                   TGGNYGFSQQSGGEKWVPQNRSYNSYAAMGGTFADGEEKRVSYLTGTGQGLVDVRF"
FT   gene            576820..577485
FT                   /gene="flgD"
FT                   /locus_tag="Geob_0501"
FT   CDS_pept        576820..577485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="Geob_0501"
FT                   /product="flagellar hook capping protein FlgD"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18870"
FT                   /db_xref="GOA:B9LZQ6"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZQ6"
FT                   /protein_id="ACM18870.1"
FT                   /translation="MVSTVTSTSDTTAAAAAMKKATGLNKDDFLRLFVTQLQNQDPLNP
FT                   QDSSQFITQLAQITEVEQSYNTNTNLQSILTQSNNMASLSAVSFIGKSILAPGSQISHQ
FT                   SGSASTIDYNLSSTAQTVTITITDESGATVKTLTQGLTAAGYASLAWDGTNNQGQSVTT
FT                   GIYNVTVKGTDADGAAFSGTPLIRGKVDGVEMGSSGPVLTVGALQVPLSGVISVKGGA"
FT   gene            577486..577872
FT                   /locus_tag="Geob_0502"
FT   CDS_pept        577486..577872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0502"
FT                   /product="flagellar operon protein of unknown function
FT                   DUF3766"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18871"
FT                   /db_xref="InterPro:IPR013367"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZQ7"
FT                   /protein_id="ACM18871.1"
FT                   /translation="MIDEIFFPQPIQPSSRQPSIKQVQEKSIGGESPFAKILENKLPSQ
FT                   GVKFSQHAQERLKARGINLTETDMKKLEGAVDSVAQKGGKDSLVMLGDAAFVVSVKNRT
FT                   VVTAMDKTQMAGNVFTNIDSAVIF"
FT   gene            577983..578864
FT                   /gene="flgE"
FT                   /locus_tag="Geob_0503"
FT   CDS_pept        577983..578864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="Geob_0503"
FT                   /product="flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18872"
FT                   /db_xref="GOA:B9LZQ8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZQ8"
FT                   /protein_id="ACM18872.1"
FT                   /translation="MSITSAMFTGVSGLLNNGEAMNVIGNNISNVNTVGFKGARMLFSD
FT                   MLSQNIGNNSQIGRGMQIQKVENLFGQGSFESTENVTDLGIQGNSFFALKPPTTVAPVA
FT                   AQNAAFLSRAGAFHVDKDLYLVNPDGYQVLDTAGQPIRFYTGGTADQNFSKVVKVEPNG
FT                   LITYLAQDGITNLYYSTTGVAGLPTTTANAAAVQRLAVVSATDLSGLEKAGGSLYKATA
FT                   TSGVSAAGFTLAGNQPNGTSEKVLSNSLEQSNVDLASQFVKMIITQRAYSANSKTITTA
FT                   DEMTQEVLNLKR"
FT   gene            579144..579644
FT                   /gene="fliL"
FT                   /locus_tag="Geob_0504"
FT   CDS_pept        579144..579644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="Geob_0504"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18873"
FT                   /db_xref="GOA:B9LZQ9"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZQ9"
FT                   /protein_id="ACM18873.1"
FT                   /translation="MAEQKEEAVPAKDNKKLFIIIGAAVLALIVIAVIVAMMMGGGKGE
FT                   KPAKAQEAKAEKKGEGGEKASAATVYPLEPFIVNIYDGQELRYLKIKVEFEMAAAEIKT
FT                   EIDAQQSALRDAVLVLLTTKTMREVQDLQGKNQLRDEILSTTVKILGPGKVIKVYFTDF
FT                   VVQ"
FT   gene            579656..580642
FT                   /gene="fliM"
FT                   /locus_tag="Geob_0505"
FT   CDS_pept        579656..580642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="Geob_0505"
FT                   /product="flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18874"
FT                   /db_xref="GOA:B9LZR0"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZR0"
FT                   /protein_id="ACM18874.1"
FT                   /translation="MEKILTKEEIEALLSAVFEGSIEPAKELARTQGQVSTYDLFNSDA
FT                   HRGFVPNMDIIYDGFIRYNRVNMSNRLGKMVEIKKVGARPYKFDDFLQSLPSPVCMAIY
FT                   KIEPLKGAALIAVDSTFVYTVVDSILGGVGVPNIPANNRLFTPIELRLVEKIIRDVLAD
FT                   MEKAWAPLLAVKMNLLRMEMNPRLVNIVPPEYQVVTMSLKIQIEETVGSMILAVPYMTV
FT                   DPIRDKLKSGLQVDMMAVDPQWSIRLSEELKEAPLEISVEMGNSSITLAELLNLSPGDT
FT                   VMLEESGRNELLVKVGGVKKFMGLPGVRGGNKAVQISRIFQGGTRGD"
FT   gene            580635..580937
FT                   /gene="fliN"
FT                   /locus_tag="Geob_0506"
FT   CDS_pept        580635..580937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="Geob_0506"
FT                   /product="flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18875"
FT                   /db_xref="GOA:B9LZR1"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZR1"
FT                   /protein_id="ACM18875.1"
FT                   /translation="MTETGELEEQKNAEMKNLDFILDIPLQLTVELGRTKLLVKDILQL
FT                   NQGAVVELSKLAGEPLDVFVNSKLVARGEAVVINDKFGIRLVDIVSPNERVEKAL"
FT   gene            580934..581413
FT                   /gene="fliO"
FT                   /locus_tag="Geob_0507"
FT   CDS_pept        580934..581413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliO"
FT                   /locus_tag="Geob_0507"
FT                   /product="flagellar biogenesis protein FliO"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18876"
FT                   /db_xref="GOA:B9LZR2"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZR2"
FT                   /protein_id="ACM18876.1"
FT                   /translation="MRALVLSALFLFPASAVAADSGSGEFSLVAGFFQMLGSLALVLGL
FT                   IFLFYHLSSKWLKIAPAGKGVARYIRVVESRFLAPKKSLMLVEVGGEYLLLSNCGDRLQ
FT                   LVKQIDMVEEIEVVEERQNVAQFSAQMRERLAAIKEGVPGLMRLAALPKKRSEAL"
FT   gene            581410..582165
FT                   /gene="fliP"
FT                   /locus_tag="Geob_0508"
FT   CDS_pept        581410..582165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="Geob_0508"
FT                   /product="flagellar biogenesis protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18877"
FT                   /db_xref="GOA:B9LZR3"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZR3"
FT                   /protein_id="ACM18877.1"
FT                   /translation="MNGGKILKPLLVIAFLLTAASAFAEPVALPTVSVGMGKVSKPGDV
FT                   AVVLQIFFLMTVLSLAPGLLMMTTSFTRIVVVLSFLRNALGTQQAPSNQIIIGLSLFLT
FT                   FFIMAPVWQQINVQALQPYRAQTITQDEALKRAVAPVRKFMLSQVREKDLALFINLSKL
FT                   PRPKNADDIPTMTIIPAYMISELKTAFQIGFLVYIPFLVLDMVVASVLMSMGMMMLPPV
FT                   MISLPFKILLFVLVDGWGLIIGSLVKSFG"
FT   misc_feature    582169..582295
FT                   /note="heptanucleotide repeats; Geob_R7001"
FT   misc_feature    complement(582296..582337)
FT                   /note="heptanucleotide repeats; Geob_R7101"
FT   gene            582378..582647
FT                   /gene="fliQ"
FT                   /locus_tag="Geob_0509"
FT   CDS_pept        582378..582647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="Geob_0509"
FT                   /product="flagellar biogenesis protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18878"
FT                   /db_xref="GOA:B9LZR4"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZR4"
FT                   /protein_id="ACM18878.1"
FT                   /translation="MTSDLVVQLARRSFETTLLLSAPLLTFSLVVGLLISIFQAITSIN
FT                   EATLAFAPKIAAVMVALIIFFPWMMSYMSDFTREIYNMIPNMRH"
FT   gene            582649..583431
FT                   /gene="fliR"
FT                   /locus_tag="Geob_0510"
FT   CDS_pept        582649..583431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="Geob_0510"
FT                   /product="flagellar biogenesis protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18879"
FT                   /db_xref="GOA:B9LZR5"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZR5"
FT                   /protein_id="ACM18879.1"
FT                   /translation="MFAIPFATISDFTLFSLVVGRMAGLFSAIPLFGGKSVPMRIKMAV
FT                   IMSMALLLFPIIKMQVPPLPGDSISIGLLVIRETLIGLTLGIISQAIFAAVEMCGQIVG
FT                   MQMGISIAALFDPNTQSNVPTMSLFQGILAMLLFVALGVHHIFIRAIVESYQVIPVGAW
FT                   HMSGELMQFFITSIGAVFILGVKLAAPVMVALLATSVALGIMARAFPQMNIFMVSMPLN
FT                   IGIGFLALGLSLLAFLRTLQNSFGGIDRQIKILFKLLA"
FT   gene            583436..584500
FT                   /gene="flhB"
FT                   /locus_tag="Geob_0511"
FT   CDS_pept        583436..584500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="Geob_0511"
FT                   /product="flagellar biogenesis protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18880"
FT                   /db_xref="GOA:B9LZR6"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZR6"
FT                   /protein_id="ACM18880.1"
FT                   /translation="MSEEDKHSKTEQPTNKKVSEAKEKGNIPRSRDLTSTLSLTSGIIA
FT                   LYVTGGFMASKLKSSSAEIFASLSTKEFTEAGIYMLMLKLFLTMTLVLAPFLLIVIVAS
FT                   LAAEVSQGGISTSFEKIGFDLDKLNPVHGIKRLFNKDAVVEMLKSFLKIIIVGYMAYKV
FT                   MRDEVDSVIYLVDMDIPAIAEFVSHISFKLVIHTCGVLFILAVLDLAFVKWRFIENLKM
FT                   TKQEVKDENKDAEGDPHIKGKIKQKQYDQARRRMRLIIPTADVVVTNPTHFAVALKYDR
FT                   QKMAAPVVLAKGADFLAQKIKEIARESNITLVENRPLARELFAQVKEGEEIPEALYAAV
FT                   AEILAYVYKLKGKV"
FT   gene            complement(584593..585201)
FT                   /locus_tag="Geob_0512"
FT   CDS_pept        complement(584593..585201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0512"
FT                   /product="acetate transporter AcpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18881"
FT                   /db_xref="GOA:B9LZR7"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZR7"
FT                   /protein_id="ACM18881.1"
FT                   /translation="MTHTHNAATAFAINDTTANPAPLGLLGFGMTTVLLNLHNAGMFPL
FT                   DAMILSMGIFYGGLGQIIVGIMEWKKNNTFGATAFTSYGLFWLSLVALIMLPKTGYIQA
FT                   PGESAMTAYLVMWGIFTGALFIGTFKMNKALQVVFGSLLVLFFLLAGGDFTGNQAIKTI
FT                   AGYEGIFCGFSAIYAGLAQVLNEVYGRTVAPLGLVRDPG"
FT   gene            complement(585255..586850)
FT                   /gene="ato-3"
FT                   /locus_tag="Geob_0513"
FT   CDS_pept        complement(585255..586850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ato-3"
FT                   /locus_tag="Geob_0513"
FT                   /product="succinyl:acetate coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18882"
FT                   /db_xref="GOA:B9LZR8"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZR8"
FT                   /protein_id="ACM18882.1"
FT                   /translation="MSEYGTLEERVRCKALLKKVMRPEETIPFFKNGMNLGWSGFTPAG
FT                   YPKAVPIALADHVERNNLQGKLRFNIFTGASVGAETEDRWAELDMIDRRWPYQTGKNIA
FT                   AGINEGRIRMGDKHLSLFAQDLGYGFYTKDTESGKLDLAIIEVSAITEDGGLVPTSSGG
FT                   VIPEILMICDRVIVEVNVGQPSFEGMHDTIICDNPPHRQVLNITRADSRIGTGAVPCDP
FT                   AKIIAVVESRHRDNGRAFSEQDETSEAIASHIIDFFSHEVKAGRLPKNLLPLQSGVGSI
FT                   ANAVIGGLAKGPFSDLSVYTEVLQDTMLDLIDSGKLDCASSCSLSLSKDEGFPRFFANM
FT                   DKYAGKILIRPLSISNAPEPIRRLGVIAMNTPVEIDIYAHANSTLVGGTRMINGIGGSG
FT                   DFLRNGYLKIMHTPSSRPSKIDPNGITCVVPHCSHIDHTEHDLDVVVTEQGLADLRGLA
FT                   PKERARRIIEKCAHPDYKPILAAYLEIATRDCIARKVGHEPQLWDRAFKMQLNLAQHGT
FT                   MKIKNWDIKIDLCN"
FT   gene            complement(586928..588241)
FT                   /locus_tag="Geob_0514"
FT   CDS_pept        complement(586928..588241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0514"
FT                   /product="citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18883"
FT                   /db_xref="GOA:B9LZR9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZR9"
FT                   /protein_id="ACM18883.1"
FT                   /translation="MALKETLRQKIEAFRPRTTKLVKEYGKVKIDEVTIEQCIGGARDI
FT                   RSLVTDISYLDPQEGIRFRGKTIPETFACLPKAAGSDYPTVEAFWYFLLTGDIPTQAEM
FT                   EEVLTEWKRRQNVPSYVFDTIRTLPRDSHPMAMLSIGITAMQRDSKFASLYNAGKFSKL
FT                   TAWETVYEDACDIVARIPVIAAFIYNLKYREDRQIAIDPNLDMGANFAHMIGQGKAYQD
FT                   VARMYFILHSDHESGNVSAHTTHLVHSALSDPYYAYAAGLNGLAGPLHGRANQEVLDWT
FT                   IKFQEKYCKDQEPTKELITKALWDTLNSGQVIPGYGHAVLRKTDPRYTSQREFCQKHLP
FT                   NDPLFKLVSMIFEVAPGVLTEHGKTKNPWPNVDAQSGVIQWHYGVKEWDFYTVLFGVGR
FT                   ALGCMANITWDRGLGYAIERPKSVTTAMLEEWAAKGRR"
FT   gene            complement(588348..589052)
FT                   /locus_tag="Geob_0515"
FT   CDS_pept        complement(588348..589052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0515"
FT                   /product="winged helix-turn-helix transcriptional
FT                   regulator, FCD domain-containing, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18884"
FT                   /db_xref="GOA:B9LZS0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZS0"
FT                   /protein_id="ACM18884.1"
FT                   /translation="MSSLPNDTTQGTAPLTDRIFELLQDAIIKGDIPAGSKISEPELAR
FT                   NYGISRGTLREVLSRLEERHLIIRAPNHGARVISLSYEELIETYQVREALGGLGCALAA
FT                   QNMTDEEIAGLRNLLREHEKSIAEDEGLSYYQQEGELDFHYRILQGSRNKKLLAILDGG
FT                   LYQLIRMYRYQFSAASPRPYLALKEHHRIVDALEERDGELADLLMRRHIRTARLSVEER
FT                   HRNATEQVGRND"
FT   misc_feature    complement(589183..589232)
FT                   /note="conserved nucleotide sequence; Geob_R8102"
FT   gene            589335..589877
FT                   /locus_tag="Geob_0516"
FT   CDS_pept        589335..589877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0516"
FT                   /product="AfsA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18885"
FT                   /db_xref="InterPro:IPR005509"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZS1"
FT                   /protein_id="ACM18885.1"
FT                   /translation="MAVNKAELQKEFADDFIRKIDRRFVHKAKDENVVISDICRREDLG
FT                   PDIYQCFLTYDDQLPFFFEHYLDHVPGLLVIEAARQMGTATVHKFYDVDFDTIFILDVV
FT                   NCSFTNFLECQEPVVIQIAIIAPNGPDRVRKAFSSVVTIFQHSESKGTIEFNCTCIPKK
FT                   LFARMRRTAAACTGGGQ"
FT   gene            589874..591658
FT                   /locus_tag="Geob_0517"
FT   CDS_pept        589874..591658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0517"
FT                   /product="cytochrome c, 8 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18886"
FT                   /db_xref="GOA:B9LZS2"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR024673"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZS2"
FT                   /protein_id="ACM18886.1"
FT                   /translation="MRLKALIACFGILWSCSLSHAFDHGSLYGDFVAVDAQDGKIDGSA
FT                   DLLTTALCGKCHNDKISEVMATVHYTFRSENKMIDFPGGGMHGHYDRSSGLTGGNTVVN
FT                   YYFDSERGCGKCHVGKYLPGTMGEIDLLTGLPTANMEKVRNGIDCLICHAATYSGRDKL
FT                   VEEIDADGTKAKYWHQDRTWSAVSSIGRSTTAACLRCHSEAASPNERGTPFATWNDVHI
FT                   ASAAFSGNACTRCHNVGKHKMVRGNHIAEIFASDYQVGSAENELKCEKCHSAKPHDKET
FT                   LNGHVSRVACQTCHIPWTSGATYSRWELDGTQTEFARGGIFSAEDSKPYTTAGMSEREV
FT                   WETYKMRPRYLWFNGKASYLAQPIGSKGENGSKIWPFKPLSSGLPVDTSGLRMADLLDD
FT                   ATLQTAMVRTGSMVPGDAPGATALAGVGTLANRTVDSSLSLELQREMLEVPLLLNLDLE
FT                   VLKSGGSMTPAIDSAMSKTYNSLNFLGKLFGAPADAAVLSIFNGNYRSDSYLVTTLPTG
FT                   QNMQKYNANYPSGSFLTLTHGVRPSSEALKCYDCHSSRGVMAGNRLRVYDRLDGNMNPV
FT                   YREVDNFDVLGIKPQGGI"
FT   gene            591655..592632
FT                   /locus_tag="Geob_0518"
FT   CDS_pept        591655..592632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0518"
FT                   /product="NAD-dependent nucleoside-5'-diphosphate-sugar
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18887"
FT                   /db_xref="GOA:B9LZS3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZS3"
FT                   /protein_id="ACM18887.1"
FT                   /translation="MKIFVTGATGLVGKRLVDKLSEGKDEIVCLVRDASRVTFDRNRVR
FT                   IVNGDLLDKGSYRRHLDGVDLVYNCAAVTGFWGIKWEEYYRNNVEATMSLLQGCSEADV
FT                   PNFVHVSTTLLHGACDDPAPRKESDPPGTCLSGYEKSKLAAESAVVECGKQTGMSTKIV
FT                   RLTSVYCAGGRLIPSLVEGLLQNKLKQIGSGKNMKHITHVDDCVDGMMLAARKGLPGAV
FT                   YNIGAREVPTMGQIMEQVSSALGRERPRMIPQGVARLAATGMEAVACITGKPPLLTRYT
FT                   VDYLTKNHIYDTSLAAKELGFVAKMDYRQGIANSVLKYLQLRQA"
FT   gene            592629..593390
FT                   /locus_tag="Geob_0519"
FT   CDS_pept        592629..593390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0519"
FT                   /product="metal-dependent hydrolase, beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18888"
FT                   /db_xref="GOA:B9LZS4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZS4"
FT                   /protein_id="ACM18888.1"
FT                   /translation="MTGKELSITFVGHSTVLLQSREVAIVTDPNYETSFGPFVPRLEAP
FT                   GMGIEDLPRLTLVLISHDHFDHLSRSTLRALPGGYRLLIPKGTGHLFRGLNHRTQHELD
FT                   HGKTYQDWQVKVTALPALHVSKRLLLGRSRPANNYLIELHGKTIFFAGDTGYGPQFREI
FT                   GAAWDIDAALLPVGLATPDFLFGKTHLNPERALRAFRDLQARIMIPIHYGTFRTVLEKP
FT                   DYPLQELRRQIARYDMGEKVKILRPGESIHL"
FT   gene            593387..594106
FT                   /locus_tag="Geob_0520"
FT   CDS_pept        593387..594106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0520"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18889"
FT                   /db_xref="GOA:B9LZS5"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZS5"
FT                   /protein_id="ACM18889.1"
FT                   /translation="MTKESKHQIGAFFDVDKTIVDYNTMSGYYWYFHRNLYKGAPPLKR
FT                   TVAGLAHMVRVTGTYLNLLRCAMKKDDRMTVNRHYYAALSGIDAGLYGSLIDEWYREAG
FT                   ILEKIYGQVGTVIRNHQRQGHRVVLVSGSHLPLIEPLGKALQVDEILATEVEVKGTVFT
FT                   GKIRNELPMVGEGKARAIRRYAQRNGIDLSSSYAYSDHISDLKMLETVGNPCAVIGDMK
FT                   LDEYARKRSWQIITTGC"
FT   misc_feature    594093..594239
FT                   /note="conserved nucleotide sequence; Geob_R6003"
FT   gene            complement(594253..595227)
FT                   /locus_tag="Geob_0521"
FT   CDS_pept        complement(594253..595227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0521"
FT                   /product="helix-turn-helix transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18890"
FT                   /db_xref="GOA:B9LZS6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZS6"
FT                   /protein_id="ACM18890.1"
FT                   /translation="MQQFVHVGIVKLIVNGVSHLAPRTMGKRAALIEQIKRGDVQVIPA
FT                   EKKVALLDDLLSECGAEPILNIGEHCNSSCDFPLFYFLLNSDSPKTLINKLENYYRYIH
FT                   SAKRIRLDAAEPCSVTVSHVTALAQPISAAEDFFACGVLKTLLGLIGCRQLSYGWQKVG
FT                   NPEIFQYLDDASLKGAVQARASQWKFQWESFSPPEKISGLDDFLLQKSKIVQRECLSDS
FT                   VEAIVKQDLNHKWTLKSVAQSLNMSERSMQRKLQDEGQTFRKLLNNARIRTAESYLLNS
FT                   QLSLTEIGYLTGFSDYSHFSKEFKRYSGTNPSQYRKGTEIACL"
FT   gene            595700..596425
FT                   /locus_tag="Geob_0522"
FT   CDS_pept        595700..596425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18891"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZS7"
FT                   /protein_id="ACM18891.1"
FT                   /translation="MSLIVTVNVEEGIVMASDSRLTMNLPRDVNGQTVLECGVSQSDTI
FT                   YKTFLAKNGIGISMYGDATINAIPISGYIESFINEKMVEGQTSVDEVPELLVEYFQAMS
FT                   NIPNTGFHVAGYKTEGEKRVKKVYKVIISNGNISNIVPNQLLHGSIWDGESDVLIRVIN
FT                   PHLHFSEDMVAYSPLTSHSIPFEMFTLQDAIDFAVYAIKTTADTMRFQMRTKTVGGPID
FT                   VLVIKQHEAFWIQKKSLHI"
FT   gene            596483..596893
FT                   /locus_tag="Geob_3846"
FT   CDS_pept        596483..596893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_3846"
FT                   /product="protein of unknown function DUF2846"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_3846"
FT                   /db_xref="EnsemblGenomes-Tr:AID57970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A068EZ59"
FT                   /protein_id="AID57970.1"
FT                   /translation="MRFLTIIFLLVTISGCATTEIINQIPMPQIQASQQAQVKVCRKYI
FT                   FLGDAAATIISLDRRPILRSSAGKCFSAKVTPGSHVLGVMTQGFAGLEMRELEFLLQEG
FT                   QTKFLKVNLDRLYEASEDEFSGFLNYEQIIVQ"
FT   misc_feature    596903..596988
FT                   /note="conserved nucleotide sequence; Geob_R9067"
FT   gene            597011..597772
FT                   /locus_tag="Geob_0523"
FT   CDS_pept        597011..597772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18892"
FT                   /db_xref="GOA:B9LZS8"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZS8"
FT                   /protein_id="ACM18892.1"
FT                   /translation="MIPSSIEWLNNNQGVLSVILFIITIGLGWASGIFRTLRQKPKMKI
FT                   SLLPGPTFCCTYLIGEKHGKYDVHRTGIALYLHIANIGSAPSSIERVSIGYHWNITPFS
FT                   IQWLKYRIGWFWLHDQTAALMDFQAKIGENLKIYPFLTQKSILSGESAETFLEVGRSTN
FT                   GAVYFEQSDSWGACFPVVTDNKVKLQVRVTDVFSNKHQATFEVPAVSFEEARKYNPSFG
FT                   KTLADLHGKPLPVDILPAAESYCHEAANPRI"
FT   gene            597824..598057
FT                   /pseudo
FT                   /locus_tag="Geob_0524"
FT                   /note="hypothetical protein; N-terminal fragment"
FT   misc_feature    complement(598033..598172)
FT                   /note="conserved nucleotide sequence; Geob_R9015"
FT   gene            598538..599410
FT                   /locus_tag="Geob_0525"
FT   CDS_pept        598538..599410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18894"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZT0"
FT                   /protein_id="ACM18894.1"
FT                   /translation="MSHLLSQAALLALGINSFEPYIYRLEKDYAEGKFLDWPTIVLSHT
FT                   VQATAISLFKLLPSGSQFDENARKFSTSSIFRIVLRLLPFRHESKEILDKRSIATMIRN
FT                   IVDTHDVIDMMVNCTTEEFNLHRDILSYYIANRVNVIQEHIDKPKAEQFYKTAQATYWN
FT                   RIKKSPLYTQSLDRIKKGETVLYKSRKDRVTSVCGDSSNFVMGILADISTFVHSIPPSI
FT                   WMKDMDSLYSDSENNRNMVSVWLKVGNFYFARVMSIVLEQTNYETSPEAKRFFDYNRTV
FT                   FAASEEADK"
FT   misc_feature    599494..599686
FT                   /note="conserved nucleotide sequence; Geob_R7401"
FT   misc_feature    complement(599684..599786)
FT                   /note="conserved nucleotide sequence; Geob_R9016"
FT   misc_feature    complement(599787..599962)
FT                   /note="conserved nucleotide sequence; Geob_R9039"
FT   gene            complement(599916..600167)
FT                   /pseudo
FT                   /locus_tag="Geob_0526"
FT                   /note="iron-sulfur cluster-binding flavoprotein; C-terminal
FT                   fragment"
FT   misc_feature    complement(600368..600508)
FT                   /note="conserved nucleotide sequence; Geob_R9017"
FT   misc_feature    complement(600509..600684)
FT                   /note="conserved nucleotide sequence; Geob_R9040"
FT   gene            complement(600638..601291)
FT                   /locus_tag="Geob_0527"
FT   CDS_pept        complement(600638..601291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0527"
FT                   /product="iron-sulfur cluster-binding flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18895"
FT                   /db_xref="GOA:B9LZT1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZT1"
FT                   /protein_id="ACM18895.1"
FT                   /translation="MRVIAINGSPRKNWNTATLLEHAVAGAAKDGAETEVVHLYDHDFK
FT                   GCISCFACKKIGGKSYGRCAVNDGLTPILKKAAEADVLILGTPVYFSAETGEMRSFIER
FT                   LLFPFLTYTPGYAPIFPGKLQVGLIYTMNIPEKDLTTYNYDKIFAASQGALSLVFGNCD
FT                   LLLSTDTYQFSDYSEYLSTSFDPEAKKKRREEVFPQDCKRAFELGARLAASVPG"
FT   gene            601434..601838
FT                   /locus_tag="Geob_0528"
FT   CDS_pept        601434..601838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0528"
FT                   /product="helix-turn-helix transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18896"
FT                   /db_xref="GOA:B9LZT2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZT2"
FT                   /protein_id="ACM18896.1"
FT                   /translation="MVAKSIEQEQPSSNEITLPKILHALSDPVRLEIVLKLASAGEIAC
FT                   GCFGLAMPKSSLSHHFKVLRTSGVLATRREGKEWVNSLRKEDLEALFPGVLDSIIAAAR
FT                   AGQGDGGGGARRLCCRGLKKGTGHFIDWGL"
FT   gene            601872..602063
FT                   /pseudo
FT                   /locus_tag="Geob_0529"
FT                   /note="transposase; C-terminal fragment"
FT   gene            602119..602475
FT                   /locus_tag="Geob_0530"
FT   CDS_pept        602119..602475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0530"
FT                   /product="toxin, RelE family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18897"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZT3"
FT                   /protein_id="ACM18897.1"
FT                   /translation="MTDIAFVLKVVFYHSEAGNEPVREWLKDLHRDDKRQIGEDIKTAQ
FT                   LGWPLGMPLIRKIDKDLWEVRTRLADGIARVFFTVDDEYMILLHGFIKKSQKTPQNELK
FT                   TALSRLGTYKRGSK"
FT   gene            602472..602753
FT                   /locus_tag="Geob_0531"
FT   CDS_pept        602472..602753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0531"
FT                   /product="antitoxin, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18898"
FT                   /db_xref="GOA:B9LZT4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZT4"
FT                   /protein_id="ACM18898.1"
FT                   /translation="MKNEHLGSNFDDFLEEEGLRAEAEAAAIKRVIAFQIEQEMKQANL
FT                   SKTAMAEKMHTSRTALDRLLDPANVSVTLQTLERAALALGKSLKIELA"
FT   gene            complement(602967..605531)
FT                   /locus_tag="Geob_0532"
FT   CDS_pept        complement(602967..605531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0532"
FT                   /product="alpha-glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18899"
FT                   /db_xref="GOA:B9LZT5"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR024517"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZT5"
FT                   /protein_id="ACM18899.1"
FT                   /translation="MNFSKILHRFTVTPSLPKELAGLQRIAYNLWWCWEPDAIELFTRL
FT                   DPELWRETRHNPVEMLGILQQTTLEMLKADEGFISHLAMVEDKLKEYLAAKTWYSKLHR
FT                   EDDGLRVAYFSMEFGLHESLPIYSGGLGILAGDHLKSASDLGLPLVGVGLLYRQGYFRQ
FT                   YLNIEGWQQEFYPENDFYNLPLHLERKADGTPLLLELDLAGNRVKIQIWRAQVGRIPLY
FT                   LLDTNLEENSPDDRNITTRLYGGDQEMRIRQEILLSIGGVRALHLLGIEPHVCHMNEGH
FT                   AAFLSLERTRLLMEERRLKFSEACEAVKAGTVFTTHTPVEAGIDHFPADLIDKYLGRYY
FT                   RGLGLSREEFLSLGRQNARNPHEMFCMAVLALKLTGHANGVSQLHGEVSRKMWKNVWPD
FT                   LPEEHLPLTSITNGVHNKTWLSREMARLLIRYLGTRWLEDPTDASVWRRVSRIPDGELW
FT                   RTHKHGREHLVDYARKRLKEQLCQVGATAKEIAVADEVLDPDILTIGFARRFATYKRGT
FT                   LLLHDVERLARIVNNSTRPVQIVFAGKAHPADHQGKELIRQIVQLSHQERFRHRIVFLE
FT                   DYDMSVARHLVQGVDVWLNTPLRPLEASGTSGMKVAFNGGLNMSVLDGWWCEGYRGNNG
FT                   WAIGKGEVYDDLEYQNEVESRAIYDLLEKEIVPLFYDRGSDGIPRGWIACMKASLQSLC
FT                   PTFSTDRMVQQYSETFYFTAFEQWQMLNENNSTLAVDLARWKEKMHRLWHHVRIEQVEA
FT                   EMSQDILAGSSIPLRAKIFVDEIPLDQLAVDAYYGVLDSRGAIIGGELVPLTPSAPDGA
FT                   GAHYFSGQLDCRFCGRHGFMLRVMPKHPVLGPIYEPSLLLWG"
FT   gene            complement(605591..606955)
FT                   /locus_tag="Geob_0533"
FT   CDS_pept        complement(605591..606955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0533"
FT                   /product="sigma-54-dependent transcriptional response
FT                   regulator"
FT                   /note="domains: REC, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18900"
FT                   /db_xref="GOA:B9LZT6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZT6"
FT                   /protein_id="ACM18900.1"
FT                   /translation="MSGSILIVDDEKGQRDILTAILQKQGYATAAVPGAREALAELADK
FT                   EFDLILTDLKMQGMSGMELMETLLTDNNRQCVVMMTAHGTIDSAVEAMKKGAFDYLEKP
FT                   LEREDLLLTVKRAFEHIGLLHENAVLHRKLKETMAISNMIGEHPKIKEVARIIGKIAPT
FT                   SSTVLIYGESGTGKELVAKAIHDGSPRRDKPFFAINCAAIPDTLIESELFGHEKGSFTG
FT                   AASREIGLLEASQGGTIFLDEIGEMNVAMQAKLLRAIQEKEIRRVGGKVNIPIDVRIIS
FT                   ATNRDLEAEIKKGNFREDLFYRLNVIRVTLPPLRERGNDIATLADFFLEKYSAASGIAL
FT                   NGISKPALKILMNYSWPGNVRQLESVIERGVLMAESDQILPEDLPAEVHEEMANITKLP
FT                   FEFPPQGISIEELERDLIIKAMERADGIISKAAPLLGMSYKTLQYRLEKFGIERS"
FT   gene            complement(606982..608430)
FT                   /locus_tag="Geob_0534"
FT   CDS_pept        complement(606982..608430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0534"
FT                   /product="sensor histidine kinase, HAMP domain-containing"
FT                   /note="domains: HAMP, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18901"
FT                   /db_xref="GOA:B9LZT7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZT7"
FT                   /protein_id="ACM18901.1"
FT                   /translation="MMKLNTKLVAMMLTLLVIATLILFIMNQFSQNDLVQEMQESSTEV
FT                   SKAIQISVEDLTSEEESESSRLEDYFQQARNKGINEINIISNEGEIINSSDPEKVGKKR
FT                   EIKKLEKGLKASHKGKITGVSPSLRPYDLVVPVIVGDEQLGYVQINLLLDNIRDIQHAN
FT                   FIRRLVATCMVFSFGILLTFFLARRYTTPINRLAAGVKKVSAGDLSVTFPVESKDEIGE
FT                   LAKSFNEMVEKLRERENLEKRLYEAEHLSKVGQLASGIAHEIRNPLNYISLAIDHLKSE
FT                   LLPTCPERSKELEAITDNIKEEVRKANYMVLNFMNYGRPLKLRTSEVRYADLIGKALPL
FT                   LQDKLDEQRIRVAMDIPADLPAMQVDAELMRNCLFNFITNAAQAMPEGGTITLGAAFAP
FT                   EEKRFILTFADQGAGIAAGDIGKIFQPYFTTKEAGIGLGLAITERIVREHGGELRVNST
FT                   VGSGTTFTMVLPVKKPQNAGYEQI"
FT   gene            608617..608823
FT                   /locus_tag="Geob_0535"
FT   CDS_pept        608617..608823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18902"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZT8"
FT                   /protein_id="ACM18902.1"
FT                   /translation="MEYSVGKIPAAYSIDADKHGPGRERKKGHLVQKVEAHDSISISDE
FT                   ARQRSADEEGAEEASGESDQVTK"
FT   gene            complement(608808..609659)
FT                   /locus_tag="Geob_0536"
FT   CDS_pept        complement(608808..609659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0536"
FT                   /product="metal-dependent phosphohydrolase"
FT                   /note="domains: HDOD"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18903"
FT                   /db_xref="GOA:B9LZT9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZT9"
FT                   /protein_id="ACM18903.1"
FT                   /translation="MNKELETAIMTAGDLPTIPVVATKVMQLMESETTTAEELARVVAS
FT                   DPAVAARVIKISNSSFYGCQRQIQTLSTAIVILGFNTLKSLVVAASVKQVYKPFGLTEK
FT                   MLWEHSFAAGLAARIIASSTRAANEEEAFLGGLFHDIGKIIMNSLDKDKFQQVMQRCYN
FT                   EGLTFEDAEASIFPFCHDEVGAYVVKKWNFPLAMTNAILQHHKLQFDDPNDIYQINLTA
FT                   VIALADMFCLKLGIGEREPQESLDLAASTPASMLNLDETRIDMLLNLFTEAFEKDKSYF
FT                   VT"
FT   gene            609832..610455
FT                   /gene="engB"
FT                   /locus_tag="Geob_0537"
FT   CDS_pept        609832..610455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="Geob_0537"
FT                   /product="GTPase EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18904"
FT                   /db_xref="GOA:B9LZU0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZU0"
FT                   /protein_id="ACM18904.1"
FT                   /translation="MLIKYVEFIKSATRAAHYPPGDLPEIAFAGRSNVGKSSLINVLVN
FT                   RKSLVRTSSTPGRTQLINFFDVNGQFTLVDLPGYGFAKVPLAVKKQWGPMMENYLAKRA
FT                   NLRGVILILDIRRTPVAEDIQMLHWLQAYSIKPILVITKCDKVSKNERGKQSRIIAQTL
FT                   GVETEELNFFSALNREGKDLIWRRIEEVLPAETAGSAGEAPKAT"
FT   misc_binding    610499..610775
FT                   /bound_moiety="adenosylcobamide"
FT                   /note="adenosylcobamide-responsive riboswitch; Geob_R0063"
FT   gene            610769..611290
FT                   /gene="cobU"
FT                   /locus_tag="Geob_0538"
FT   CDS_pept        610769..611290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobU"
FT                   /locus_tag="Geob_0538"
FT                   /product="adenosylcobinamide kinase and
FT                   adenosylcobinamide-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18905"
FT                   /db_xref="GOA:B9LZU1"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZU1"
FT                   /protein_id="ACM18905.1"
FT                   /translation="MSRIVLVTGGARSGKSRLAEGMALAYGDPLGYVATGRAGDGEMAE
FT                   RIARHRQRRGSMWQTMEEPLLLKEVIVGHDGYFKAILVDCVTLWLSNLLFAHNDRGRVL
FT                   DEVRELADVLPNLATPLVLVTNEVGAGIVPENALARTFRDLAGEANQILASAADEVHVA
FT                   MCGLPLKLKG"
FT   gene            611344..612408
FT                   /gene="cobT"
FT                   /locus_tag="Geob_0539"
FT   CDS_pept        611344..612408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="Geob_0539"
FT                   /product="nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18906"
FT                   /db_xref="GOA:B9LZU2"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZU2"
FT                   /protein_id="ACM18906.1"
FT                   /translation="MSLIDDTLEQIKAVDPALLAEAQVVLDNKTKPPGSLGRLEEFARR
FT                   YVAIIADPENSDLELLGTKVVYTFAADHGVVEEGISLYPKEVTQQMVLNFLNGGAGVNV
FT                   LARHVGAEVRVVDIGVDYYFGMVPGLVVRKVARGTANLAQGPAMTREQAVAALEVGIGL
FT                   AAQAKKTGVTMLGTGEMGIGNTTPSSAIIAAISGKTVKEVTHRGTGINDAALENKIRVI
FT                   EQGLAVNKPDPKDPIDVLAKVGGLEIAGIAGLILGAAANRIPVVVDGFISTAGALIASE
FT                   LNPHVKDYMFAAHESVEIGHSFMLQHIGLKPILDLQLRLGEGTGAALAMGLIEAGVKIY
FT                   KEMATFAEAGVASE"
FT   gene            612408..613151
FT                   /gene="cobS"
FT                   /locus_tag="Geob_0540"
FT   CDS_pept        612408..613151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="Geob_0540"
FT                   /product="adenosylcobamide-5'-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18907"
FT                   /db_xref="GOA:B9LZU3"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZU3"
FT                   /protein_id="ACM18907.1"
FT                   /translation="MLRLYFVALQFLAIIPIPFSFRCREEDLGRSMSFFPLVGLTLGLL
FT                   LAGCDYLLALALPRPVADLLLVAILALVTGALHLDGLADVCDGLAARGGRERFLAVMKD
FT                   SRVGAVGVVGLVLALLLKYQALFAVTTDKWETLLFFPMVARFSQVQLTVGSKRARQDGL
FT                   GSLFIGGAGSMQVAVAAFFTVVTGWLLLGLPGIGCAAVCSLFTCLAKAWFHRKLGGITG
FT                   DAIGCVSELNEILCLMTLVAIGGRF"
FT   gene            613148..613750
FT                   /gene="cobC"
FT                   /locus_tag="Geob_0541"
FT   CDS_pept        613148..613750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobC"
FT                   /locus_tag="Geob_0541"
FT                   /product="adenosylcobamide-5'-phosphate phosphatase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18908"
FT                   /db_xref="GOA:B9LZU4"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR017578"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZU4"
FT                   /protein_id="ACM18908.1"
FT                   /translation="MTGRTRVYLIRHGEVEGADTRRYNGHADVGLSEFGIAQYQSLKGR
FT                   FDDVRISACYCSDLTRCVIGAEMLGTHLGVTPVKNSNLRELNIGIWERMTWTELMEKYP
FT                   VEWQARLDDIVNYRVPQGESLQDMNDRVMPVIKDIVQRHQGEDVLVVAHGGVNRVILLN
FT                   AIGAPLSSLFNIEQSYCGFNIIDYYADGKAVVKLVNG"
FT   gene            613752..615146
FT                   /gene="cbiA"
FT                   /locus_tag="Geob_0542"
FT   CDS_pept        613752..615146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiA"
FT                   /locus_tag="Geob_0542"
FT                   /product="cob(II)yrinate a,c-diamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18909"
FT                   /db_xref="GOA:B9LZU5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZU5"
FT                   /protein_id="ACM18909.1"
FT                   /translation="MKSIIIAAPQSGSGKTTITLGIMACLRRRGLQIAPFKVGPDFIDP
FT                   GYHRLVAGRPSINLDGWMCGADFVRETFTSHGSGADMAVIEGVMGLFDGIGENGDEGST
FT                   AQVARLTGSPIVLVVDAGRMAGSAAALVKGFAEFDPQVNLAAVIFNNVAGDNHGLLLRK
FT                   SMAAALPRVKVLGCIGRDERLHIPSRHLGLLTAEENPLSPGFLQHLVETVERCLDVDFL
FT                   CHLSCTHSHDIGKPGDVMEDQGAGNLVPIAVARDEAFCFVYEDNLRLLREAGCEIVEFS
FT                   PLRDRALPVGIGGIYLPGGYPEIFAESLAANAPMKEAIRAAVEKDMPVYAECGGFIYLT
FT                   RGVMDTNTEAGSIHDFVGIYPVTTRMLPRRKALGYREIITQQDSILGKRGLSTRGHEFH
FT                   YSEMAELPESIDRLYRVRKLETELGAEGYRYKNCLASYIHLHFGSCPELAAAFADNCRK
FT                   FNGSCS"
FT   gene            615165..616472
FT                   /gene="thiC-2"
FT                   /locus_tag="Geob_0543"
FT   CDS_pept        615165..616472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC-2"
FT                   /locus_tag="Geob_0543"
FT                   /product="4-amino-5-hydroxymethyl-2-methylpyrimidine-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18910"
FT                   /db_xref="GOA:B9LZU6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZU6"
FT                   /protein_id="ACM18910.1"
FT                   /translation="MRTQIELAREGIISTQMATVAKDEGFLPEYVRQMVAEGKIVIPWN
FT                   HGRKPKAVGIGKGLRTKVNASIGTSSDIVDYAAEVRKAKAAQESGADTLMELSVGGDLD
FT                   RVRREVIAAVDLPVGNVPLYQAFCEAARKYGDPNKLDEEMLFDLIEKQCADGMAFMAVH
FT                   CGINLYTIERLRKQGYRYGGLVSKGGVSMVAWMLANNRENPLYEKFDRVTAILKKYDTV
FT                   LSLGNGLRAGAIHDSSDRAQIQELLINCELAEIGRDMGCQMLVEGPGHVPLDEVEGNIQ
FT                   LQKRMSGGAPYYMLGPISTDVAPGFDHITAAIGAAQSSRFGADLICYITPAEHLALPNE
FT                   EDVRQGVKAAKIAAYIGDMNKYPEKGRQRDMEMSKARRDLNWEKQFELALYPEDARAIR
FT                   ASRTPEDEATCTMCGDFCASRGAGKLFAGDLRGDKI"
FT   misc_feature    complement(616561..616593)
FT                   /note="conserved nucleotide sequence; Geob_R7305"
FT   gene            616611..617369
FT                   /gene="cbiM"
FT                   /locus_tag="Geob_0544"
FT   CDS_pept        616611..617369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiM"
FT                   /locus_tag="Geob_0544"
FT                   /product="cobalt ABC transporter, membrane protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18911"
FT                   /db_xref="GOA:B9LZU7"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZU7"
FT                   /protein_id="ACM18911.1"
FT                   /translation="MKKILLFTILMQLIAAPAHAMHISEGLLPLNWALFWFMAAAPFVA
FT                   LGVRQLNNLAKTDLAMKPLVGLMAAVVFIVSCMPIPVPTAGTCSHPCGTGIAAILVGPL
FT                   VSVVISAVALLLQALFLAHGGLSTLGADIISMGVAGSFAGWLIFRGLRKISVNLAVAAF
FT                   FGGLFTDWATYLTTSMELAAGIRGTAPFWPLAAKIVLAFIPTQLPLGILEGAMTAGMVT
FT                   LLQRKRPDLLVKMRVLKESEVVHAWKKAQI"
FT   gene            617344..617643
FT                   /gene="cbiN"
FT                   /locus_tag="Geob_0545"
FT   CDS_pept        617344..617643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiN"
FT                   /locus_tag="Geob_0545"
FT                   /product="cobalt ABC transporter, membrane protein CbiN"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18912"
FT                   /db_xref="GOA:B9LZU8"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZU8"
FT                   /protein_id="ACM18912.1"
FT                   /translation="MPGKKRRYRIILLHIILLPTLLFAFYFLTLAPHPYVGVDETVVEK
FT                   IAVEHGRKVHEPLIDPGEGDLLLFLFLGAGAAGGFVAGYYWRRLGEKSDRHGEG"
FT   gene            617643..618398
FT                   /gene="cbiQ"
FT                   /locus_tag="Geob_0546"
FT   CDS_pept        617643..618398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="Geob_0546"
FT                   /product="cobalt ABC transporter, membrane protein CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18913"
FT                   /db_xref="GOA:B9LZU9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZU9"
FT                   /protein_id="ACM18913.1"
FT                   /translation="MRHTLQQIQVADHPLSRYDARVKLLAVLALLTMVLSYRGAAFPLL
FT                   LSALSIALCLSLKVRPRLLMLRFAQPLFFAAVIVLLKLFTTGAVPLFTLSVWGINLIGY
FT                   SDGLGEGLLIAGRIVGAVSLVALLGFSTSFTDLISALAWFRVPQGVIEVALFAWRYLFV
FT                   LFEDAMVIYNAQKNRLGYAGYPQGLRSFGTLAGAMVIKAFDNSQTITTAMVQRGYDGTL
FT                   PPIRQQPFRGREVAATLLVVAVLGVIWNV"
FT   gene            618391..619239
FT                   /gene="cbiO"
FT                   /locus_tag="Geob_0547"
FT   CDS_pept        618391..619239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="Geob_0547"
FT                   /product="cobalt ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18914"
FT                   /db_xref="GOA:B9LZV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZV0"
FT                   /protein_id="ACM18914.1"
FT                   /translation="MFSTDVRISVSLESFKYPDGTVALSDIHLEIGRGEFCGILGANGS
FT                   GKTTLLKIMDGLIKDYQGRVLLDGEEVHRLHPRDIYRKMGLVFQNPDDQLFAHTVSEDV
FT                   AFGPRNMGCGENEVRGRVADALLAVEMSEFGGKGIHHLSYGQKKRVCIAGLLAMGHEIL
FT                   LLDEPTAGLDPMGEYRMMELLTRLNRENGVTIVMATHSVDLVPIFLHRLHILSRGKLVR
FT                   GGVPEEVFTAPEEMANVKLRLPHIAELIHRLKHEDLLPFGRIPLTIGEARREIVETLRE
FT                   R"
FT   gene            complement(619240..620691)
FT                   /locus_tag="Geob_0548"
FT   CDS_pept        complement(619240..620691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0548"
FT                   /product="transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18915"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZV1"
FT                   /protein_id="ACM18915.1"
FT                   /translation="MTIRRIIHVLLLIFSMMPSSVCLSAPIPRLQGPPLGERWFSISMN
FT                   GERVGFAHTNVLETADGFELFSEGSVKLKVMAVSRESSSRENYRVGKDLALKSFQVEQT
FT                   IDGSPMKVKGVVEGKAIKVVIESAGNMKNKSLKVKKKILPPPALNFYPPMQGAVPGKTY
FT                   NVQMLDVEGIKVKGVEIKVIGQETLPGGVKALHVQNDLYPFVDNDIWLDLSGNTLKESV
FT                   RDEMILTRAEDALTVQNFIADAAMARKDLILDFSLIKVEPPLSDPEKLQRMAATFSGFP
FT                   PEFPLYRDARQQATREEDGTIAFKTTKALTVKNANGTQDQSALGTFLEATARIPVDNGE
FT                   IAAKAKEIAAGEQDRLKIVEKLTRWMATEVKGLAMDSRPPLETMKIGEGNSQSHALLYV
FT                   TMARAMGIPSRFVSGLAYIKGKGFLYHCWAESYLGEWLAVDPTFGQLPVNASHIKLVEG
FT                   ESPEQMALVGSIVGKLKARVIEQQY"
FT   misc_feature    620841..620936
FT                   /note="conserved nucleotide sequence; Geob_R0068"
FT   gene            621038..623302
FT                   /locus_tag="Geob_0549"
FT   CDS_pept        621038..623302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0549"
FT                   /product="iron-sulfur cluster-binding sigma-54-dependent
FT                   transcriptional regulator, FehydlgC and FeS
FT                   domain-containing"
FT                   /note="domains: FehydlgC, FeS, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18916"
FT                   /db_xref="GOA:B9LZV2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZV2"
FT                   /protein_id="ACM18916.1"
FT                   /translation="MEPIITLTEKCRKCYSCVRSCPVKAIKVEKTFTEIIFERCIGCGN
FT                   CLSNCPQHAKVVTDKVGVVENLLAGEEPVIAVLGCSFPAFFHTFSAGQLAAGLKKLGFA
FT                   EVHEGAAGVELIAAGYAEAMEKSSEVLISSHCPAIVDLIERHYPTLIKNLVRVISPMVA
FT                   IGRFLKTAYGPEVKVVYLSSCIAAKFEIQAEETQGAIDMVLTYREMEEIFLKRGILPAL
FT                   LAEDAFDGLEPHLGRLFPIAEGTFKAFSIATDPLDTEIVTAAGEVNAMGIIKDLAAGRI
FT                   NPRIVDIRFCYDGCIGGPGKKSELTEFYKRNLIIAHFKNDAPYRTASHYQGEQKQISLT
FT                   RSFTGKYVRLKVPKGSDVKKILHATNKFTQKDELNCRACGYRTCREYAVAVYQGLADLE
FT                   MCLPHTLQQLVEDRGRLIEKYELARRELDREYGDEFIVGDDGGTIEVLDLIKQVGPTPT
FT                   TVLIRGESGTGKELTARAIHRYSKRNDKPLVTVNCTTITDSLLESELFGHKKGAFTGAI
FT                   IDKKGLFEAADGGTIFLDEIGDITPKLQAELLRVLDSGEVRPVGGTTSRKVDVRLIAAT
FT                   NKELETGVRDGWFREDLYYRLNVFAITMPPLRSRVESIPLLAHHFLEKARNKLNKSIIG
FT                   LEDRAVKAMMQYSWPGNIREMQNVIERAAVLTHDEIIKLGNLPLVFAENYAEEADDVPD
FT                   LRSFKLEREPHVMRVEKKLIQRYLADAGGNVSKAAQLANIPRRSFYRLLDKHGLKGRGA
FT                   D"
FT   gene            623604..623789
FT                   /gene="hgtR"
FT                   /locus_tag="Geob_0550"
FT   CDS_pept        623604..623789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hgtR"
FT                   /locus_tag="Geob_0550"
FT                   /product="hydrogen-dependent growth transcriptional
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18917"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZV3"
FT                   /protein_id="ACM18917.2"
FT                   /translation="MGRMRENPRYNVISMRISDEERETLEQIVSTTNRSVSDIMREAMD
FT                   LVKERLGSLEMARKAA"
FT   gene            complement(623872..625356)
FT                   /gene="cysS"
FT                   /locus_tag="Geob_0551"
FT   CDS_pept        complement(623872..625356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="Geob_0551"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18918"
FT                   /db_xref="GOA:B9LZV4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZV4"
FT                   /protein_id="ACM18918.1"
FT                   /translation="MGLRVYNTLSGNKEEFVPVEPGKVKMYVCGVTVYDHCHIGHARAN
FT                   VVFDVIYRYFCHLGLDVTYVRNYTDIDDKIINRANREGVTYDLISERFIKEFDRDMERL
FT                   GLKLPTCQPKATEHIDEIISLVQTLIDKDFAYQAGGDVNFCVEKFDSYLKLSGRTLEDM
FT                   QAGARIEVDERKRHPMDFALWKEAKPGEPFWESPWGKGRPGWHIECSAMSMKYLGTTFD
FT                   IHGGGKDLIFPHHENEIAQSEAATGKPFVNYWLHNGFVNINSEKMSKSLGNFFTIKEVL
FT                   DRYDNEVLRFFLLSAHYRSPIDFSDQNLTEAEAGLERIYKALAAVEETLAAGNGCTGAP
FT                   VDASSLNEAEGELFDKTTSISARFGEAMDDDFNTALAMAHVFDLVRCVNRVLSETAGAS
FT                   DNICSLCTLIKAEVAKIAGVLGIFSSKPASFLERLKSRKAGNLDIAVDEIERLIAERTA
FT                   ARKAKDFKRSDEIRDQLAAKNIVLLDSQQGTTWSVK"
FT   gene            complement(625444..625815)
FT                   /gene="cheY40H-5"
FT                   /locus_tag="Geob_0552"
FT   CDS_pept        complement(625444..625815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY40H-5"
FT                   /locus_tag="Geob_0552"
FT                   /product="response receiver CheY associated with MCPs of
FT                   class 40H"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18919"
FT                   /db_xref="GOA:B9LZV5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZV5"
FT                   /protein_id="ACM18919.1"
FT                   /translation="MAKNKILIVDDSELVLMMARDALEEAGYKVFCAHNGLEANGYIFS
FT                   ADRPDLIIMDVMLPMLEGNKKVKLLKEKDFISQIPILLLSSKSEDELRRLTDESGADGY
FT                   ISKPFSPAGIVTTVRNFLP"
FT   gene            complement(625821..626855)
FT                   /gene="cheB40H-3"
FT                   /locus_tag="Geob_0553"
FT   CDS_pept        complement(625821..626855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB40H-3"
FT                   /locus_tag="Geob_0553"
FT                   /product="protein glutamate methylesterase CheB associated
FT                   with MCPs of class 40H, response receiver
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18920"
FT                   /db_xref="GOA:B9LZV6"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZV6"
FT                   /protein_id="ACM18920.1"
FT                   /translation="MIKVLITDDSALTREVIKDIFRLTSDIIVVGEAADGTAAVELTQK
FT                   LKPDLVLMDLMMPIMDGLTAIEEIMAHSPTPILVLSASLGDRDVNNAFAAIKRGALDVM
FT                   AKPEGFTTDTISPCFTSDIIEKVRMLARIKVIRRRPPTRRRAMVASESKPGETHRILAI
FT                   GASTGGPQAVMKIVRSLPAGFDASIFIVQHIASGFAYGFAQWLNRESNIPVRLAKDGDV
FT                   FLPGTALVAPSNYHMTVSDGKIKLIKDQPVNSCRPSIDVLFKSLALEHGGAVVGVLLSG
FT                   MGKDGAEGLTQIRKQGGMTIAQDEKSCAVFGMPKAAIAMDAVDMIVPLGDIPQTISRLF
FT                   DARS"
FT   gene            complement(626895..628952)
FT                   /gene="cheAY40H-1"
FT                   /locus_tag="Geob_0554"
FT   CDS_pept        complement(626895..628952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheAY40H-1"
FT                   /locus_tag="Geob_0554"
FT                   /product="sensor histidine kinase CheA and response
FT                   receiver CheY associated with MCPs of class 40H"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18921"
FT                   /db_xref="GOA:B9LZV7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZV7"
FT                   /protein_id="ACM18921.1"
FT                   /translation="MPNRNKYLSIFFKEGREHLDSLQKGLLALEKTPDDKVLLRELMRN
FT                   AHTLKGSAKLVGLEEISAIGHRMEDLFEEIEKGQKRVDDQIIDILLKGADAISRLIKAF
FT                   SSNEEIPFDVPQFLLAFDQGEIHPQVVEKKLQHEIASEETVRTNVKILDSLINRLGELI
FT                   INKKRFESSLLRLNELCNTNAKSPLLPGLRQFRNDLEEDVLYLAYLVQELHDDALALRM
FT                   LPLHTITDGFERMIRDLSREHGKMIEFSVTGAQIEMDRVLLEAVKPMILHILRNCIDHG
FT                   IETLEERLVEGKKPKGSIEIAARLEEGGVNIVIRDDGRGINPALVRKTAVSKGLLGQEE
FT                   AAAMEDKAVIELIMEEGFSTRDFITDTSGRGIGMSVVKKNLERLKGNLTIRSEVGRFTE
FT                   MSLQLPLTLSMMEALLILCSDECFAVPLSYVQETLKIRAEDIVTAAGKEVISLRGSSIP
FT                   LVSLASLLGLPEPSKFFPEEKLTVVVLGQGSQYLACAVDATLESSGIVVKSLSNQMKNV
FT                   HFVFGATILGSGDPALILNVPDLFTAAEVGITAGFASRLGRDEEKAVKTRILVVDDSIT
FT                   TRTMERSILMAHGYDVDIAISGEDALEKVAGTTYDLVISDVMMPGITGFELTRRLRAIE
FT                   KYREVPIIIVSSLATDADKREAMDAGAQAYIVKGSFDQGNLLATVEAFVG"
FT   gene            complement(628953..630689)
FT                   /gene="mcp40H-17"
FT                   /locus_tag="Geob_0555"
FT   CDS_pept        complement(628953..630689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-17"
FT                   /locus_tag="Geob_0555"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18922"
FT                   /db_xref="GOA:B9LZV8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZV8"
FT                   /protein_id="ACM18922.1"
FT                   /translation="MFNNLSLKIAGILILVMVVIMTFFTIYFVRSRSASMEGELLSKGR
FT                   IEALAGAKMTEQVLELAIKQGTLSETDIFDENYVPIPNTYPQKFHTRFDRYLDENIQEL
FT                   EDEYLKDDQVVFAAAVDRNSYLPTHNTKYSQPLTGDRAKDLINNRTKRIFNDEVGMLAA
FT                   KNQKELLQQVYFRDTGERMWDISAPVYVNGKHWGAFRVGFSMEKTDKRIAELRTQIIGS
FT                   MFLMLLVSSVTIFFVVRYYMRPLLNLTAAARRIADGNLDEQIPVETGDEIGTLAEAFNT
FT                   MTNVIVKNLKGEIEKSARLIASIKEAIILLSSSANEMMAISAQQSSGATQQASAVQEVT
FT                   TTSEEIAITAKQITDNAKSVESMAEETTRSCTVGTGDVTNAIDGMAVLKTQVQSIAESM
FT                   LQLGDNSQKIGGIVEIIDEISDQTNLLALNAAIEAAGAGEAGKRFAIVAQEVKRLAQRT
FT                   VDATKQIKGLIEEIQKATNSTIMVTEEGTKGVDDASALVDKVQLSFTNIINMVEETARA
FT                   AKEITLSTQQQTSACEQMAETMTEVRDVAQQVAASANETERAISDIMEQTEKLRDLSEK
FT                   EA"
FT   gene            complement(630734..631279)
FT                   /gene="cheW40H-3"
FT                   /locus_tag="Geob_0556"
FT   CDS_pept        complement(630734..631279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW40H-3"
FT                   /locus_tag="Geob_0556"
FT                   /product="scaffold protein CheW associated with MCPs of
FT                   class 40H"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18923"
FT                   /db_xref="GOA:B9LZV9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZV9"
FT                   /protein_id="ACM18923.1"
FT                   /translation="MVVKNGTDEIRSILNEMRDEYWHALSEVEEAREEEQEFITLTLGG
FT                   ETFAFETGYASEVIRIPRLVKLPRVQDFLTGVFNLRGEITAAIDIRPLLGLPQLPLSPF
FT                   SRIVVVKSEKFVTGIIAETVEGVRALPLNALEPAVKSLNEKQREYIRGQLNIDGMLIMM
FT                   LDMAKLLQSPDIVADNNQ"
FT   gene            complement(631293..633143)
FT                   /gene="cheR40H-3"
FT                   /locus_tag="Geob_0557"
FT   CDS_pept        complement(631293..633143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR40H-3"
FT                   /locus_tag="Geob_0557"
FT                   /product="protein glutamate methyltransferase CheR
FT                   associated with MCPs of class 40H, response receiver
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18924"
FT                   /db_xref="GOA:B9LZW0"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZW0"
FT                   /protein_id="ACM18924.1"
FT                   /translation="MPLQILVINENKAFCDYLVNLLATAGHEVSCVQLYADALQAAAAN
FT                   RPAAIILEISTSDMGAVEMISRLQRAVETRHVPIIVISDVPELEFELLNLFDFLPQPLD
FT                   TVRLAEDLEAIARGRKQSLPRQTETLGDDTYRLYSQYLLQESGLHFDRRNQKLLERGLL
FT                   NRMAALKISSFEEYYHYLVLHQESRQELKKLLPFLTIGETYFFRYHAHFEALGQILAEK
FT                   RSGLAQGERLKLRLWSAGCSTGEEPYSLAITVMEAISDWKKHDISILATDIDNRALKRA
FT                   QEGIYSPWAMRVMEKRNLDRYFEKSGKKFRIRDEVKSLVRFAHHNLTSSTPDQEEQDRE
FT                   RFDAVFCRNVTIYFTIDITRQIIEKISNCLKPGGYLFLGHAETMAQISSRFERQSHDGS
FT                   FYYRKKTAKNGIPTEPAPPRQPAPAKAKSRQEQTPAPVNTTAPAPASPQAVDWERLHLH
FT                   AQELFREENFSETARLLQDILQHRPDHTGALILYGFTLANDGRFTEALAACEAALKTDD
FT                   LLPEAYFLKGLVYEMTDRLPEAGEEYRKAILLQHDFVMAHYQLAQLYARLGRKKERLRE
FT                   LNNSLRIVAGLKAKAAIPYSGGLTRELFMDQLNKELAKAD"
FT   gene            complement(633187..634887)
FT                   /gene="glnS"
FT                   /locus_tag="Geob_0558"
FT   CDS_pept        complement(633187..634887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="Geob_0558"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18925"
FT                   /db_xref="GOA:B9LZW1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZW1"
FT                   /protein_id="ACM18925.1"
FT                   /translation="MESTVNSNISAPETTATTNFIRNIVEEDLKCGKHKTIVTRFPPEP
FT                   NGYLHIGHAKSICLNFGLARDFGGRCHLRFDDTNPAKEDVEYAEAIKENVRWLGFDWGK
FT                   HLYYASDYFEQLYQWAEQLIRQGDAYVEDLTADEIRAYRGTLTEPGKESPCRSRTPEEN
FT                   LQLFRRMRAGEFADGAKVLRAKIDMASPNLNLRDPVMYRILHTPHPHAGDKWCIYPMYD
FT                   FAHGQSDSIEGITHSVCTLEFADHRPLYEWFLERLGIYQPHQYEFARLNLTYTVMSKRK
FT                   LLQLVQDGDVSGWDDPRMPTLSGLRMRGYTPESIRSFCDQIGVGKSDSWIDMSILEECV
FT                   RNDLNFRAPRAMAVLRPLKLVIDNYPAAMTEEFEAANHPNDPAMGSRMVPFAKEIYIEQ
FT                   DDFLEEPPKGFFRLAPGREVRLRYAYIVKCESVVKDEAGKIVEVHCSYDPASRGGSAPD
FT                   GRKIKGTIHWVSALHAVKAEVRLYDRLFTVPNPDKGGQDFKTFINKDSLQVLDTACLEP
FT                   DLAKAAPGSSYQFERQGYFHVGSLADDGRPVFNRTATLRDSWGAGGKKE"
FT   gene            complement(634892..635407)
FT                   /gene="ispF"
FT                   /locus_tag="Geob_0559"
FT   CDS_pept        complement(634892..635407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="Geob_0559"
FT                   /product="2-C-methyl-D-erythritol-2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18926"
FT                   /db_xref="GOA:B9LZW2"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZW2"
FT                   /protein_id="ACM18926.1"
FT                   /translation="MRIGHGYDVHKLVSGRKLILGGVDIPYERGLLGHSDADVLLHAIS
FT                   DAILGAIGEGDIGKHFPDTDPAYKGADSIKLLMHVMGLARDRGYAIGNVDATIVAQRPK
FT                   LAAHIPLMGENIAKALETEASRINVKATTTEELGFCGRGEGIAAYAVALLQRRHELSPE
FT                   TREVLETR"
FT   gene            complement(635428..636114)
FT                   /gene="ispD"
FT                   /locus_tag="Geob_0560"
FT   CDS_pept        complement(635428..636114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="Geob_0560"
FT                   /product="2-C-methyl-D-erythritol-4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18927"
FT                   /db_xref="GOA:B9LZW3"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZW3"
FT                   /protein_id="ACM18927.1"
FT                   /translation="MRAVALIPAAGMGKRMGAGMNKQYLLLDGRPILAHTLAVFQEASF
FT                   VDDIYVVIPEAEIAFCREQVVGKYGFAKVRDVIAGGSERQHSVLNGIRALNGYREDDVV
FT                   IIHDGVRPFIPTKILKHSIEVASQWDGALVAVPAKDTIKTVEAGVVTGTPPRENIWLAQ
FT                   TPQSFRHGIISAAHEIAAAEGFLGTDDASLVERMGRQVHVVMGDYRNIKITTPEDMLLA
FT                   ETFLKK"
FT   gene            complement(636255..637643)
FT                   /gene="selA"
FT                   /locus_tag="Geob_0561"
FT   CDS_pept        complement(636255..637643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="Geob_0561"
FT                   /product="selenophosphate--L-seryl-tRNA(Sec)
FT                   selenotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18928"
FT                   /db_xref="GOA:B9LZW4"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9LZW4"
FT                   /protein_id="ACM18928.1"
FT                   /translation="MNLLKQIPKVDKVLSWEGVQTLLETHPRPVVMKAVRNVLEVLRAI
FT                   VLREEGDAGLFTDEAIMKRVNRELDEINSLNLKRLVNGTGVVIHTNLGRSPLPESVRQT
FT                   LNEIAFGYSNLEFDLATGERGSRYSHVEEILCELTGAEAALVVNNNAAAVLLALSSLAA
FT                   GREVIVSRGELVEIGGSFRIPDVMRQSGAILREVGATNRTHLQDYSAAVATETGLLLKV
FT                   HCSNFAVVGFTAEVSAEQLVELGRQHSLPVMADVGSGNLVELSRRLGCNEPTVQEFVSA
FT                   GVDVITFSGDKLLGGPQAGIIVGRRELLATMKKHPLLRAVRIDKLTLAALEGTLQLYRD
FT                   ERRALQEIPTLRMLALSKEELAETAKRLAARLQKVVPPVVTLALVEGFSQVGGGALPLL
FT                   QLPTTLISVSVGDKSAQEIEKVMRLSPVPVIGRIFKGAFLLDPRTINEEDISALTAALQ
FT                   GIVP"
FT   gene            complement(637778..638485)
FT                   /locus_tag="Geob_0562"
FT   CDS_pept        complement(637778..638485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0562"
FT                   /product="winged helix-turn-helix transcriptional
FT                   regulator, FCD domain-containing, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18929"
FT                   /db_xref="GOA:B9LZW5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZW5"
FT                   /protein_id="ACM18929.1"
FT                   /translation="MKRNIEKHLTLRERILETIRDAIMSGSLKPGEKVAEPELAERFGI
FT                   SRTPIREAFRQLESEGYLSVIPRKGAVVAAFSPRDVEEFYAIKSILEGYAARKACDNLT
FT                   AKELDKLAAINQKLHQLAEAGDIKNFFKVHNDFHDLFIKAANNDKLYEMVNGLVKKFQR
FT                   LRIASLSKKGRMQVSVEEHEKIIEAFRNKNANLAEKLVQKNAEYGGIVLIKSGPDGTPM
FT                   KKAEQTAAKHLDL"
FT   misc_feature    complement(638505..638548)
FT                   /note="conserved nucleotide sequence; Geob_R0069"
FT   gene            638647..639690
FT                   /locus_tag="Geob_0563"
FT   CDS_pept        638647..639690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0563"
FT                   /product="cation channel, TrkA domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18930"
FT                   /db_xref="GOA:B9LZW6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZW6"
FT                   /protein_id="ACM18930.1"
FT                   /translation="MDPVRHLKISVLVLALLVSIGTAGYSTIEGWRLLDALYMTVITLG
FT                   TVGFREIHELSDAGKIFTMVLIFFGVSVLGYIVGSLAQIMFEGQLQRIIGRKKVEKKID
FT                   ALSGHYIICGFGRIGALICKEFAAKPLPFVVVENDPLVVDKLAQDSYLFLRGNATDDET
FT                   LLKAGIKKAKGLISVVTSDTENVYITLTARGLNPDLYILARSGEEGSEIKLKRAGANKV
FT                   VSPYLIGGSRMAQAILRPNVMDFIEIATGREHLELQIEEIVIPATSGFIGENLASSGFR
FT                   RETGVIIVGIKKASGKMVFNPESHTHMEAHDTLIVLGQPTAIFKLEELVNCGKCADDIK
FT                   RHRKNHE"
FT   gene            639683..640453
FT                   /locus_tag="Geob_0564"
FT   CDS_pept        639683..640453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0564"
FT                   /product="TIM barrel protein, AP endonuclease family
FT                   2/xylose isomerase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18931"
FT                   /db_xref="GOA:B9LZW7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZW7"
FT                   /protein_id="ACM18931.1"
FT                   /translation="MNKKVFAHVPYPHLGRNLDYLIANRINPEIFFSADSLDEVIPERM
FT                   QAEAAALAGNGLVCTIHAPFMDLNPGSVVRQIREVTRCSFNDVLDSAEIFKPQIMVFHP
FT                   GYDRWRYGEKKEEWLRHSIDTWQGVLERAEGIGCTIAVENIFEEEPSTLVALLEAINSP
FT                   RLRHCFDVGHWNLFKTVGMEEWFAALGSYIAETHIHDNHGFRDDHAPLGEGGIDFKLFF
FT                   SLMERYAPEAALTIEAHSLEKLERALTNLQQFLP"
FT   gene            complement(640461..640772)
FT                   /locus_tag="Geob_0565"
FT   CDS_pept        complement(640461..640772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18932"
FT                   /db_xref="GOA:B9LZW8"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZW8"
FT                   /protein_id="ACM18932.1"
FT                   /translation="MAIDPYLPHIFAFNILLTIIDATIGYHAAPILVRTAAADEEALES
FT                   AAKTIRTMLALVVALYSFFSCLAYFRQKPLLLLIVTAVIVADIIAQIIVSRKMKNRGR"
FT   gene            complement(640827..641426)
FT                   /locus_tag="Geob_0566"
FT   CDS_pept        complement(640827..641426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0566"
FT                   /product="SGNH-hydrolase lipoprotein, lysophospholipase
FT                   L1-like subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18933"
FT                   /db_xref="GOA:B9LZW9"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZW9"
FT                   /protein_id="ACM18933.1"
FT                   /translation="MRFLPCILMIFLIAGCSGAEPLPKLPADGVILAFGDSITYGTGAA
FT                   SGESYPAMLEQLTGRKVVNGGVPGEVTAEGVQRLPGLLEQVKPAMVIICEGGNDMLRHA
FT                   SHGEIAANLRAMVRIVKGKGASAVLVSVPALDLSFAPPPFYAEIAEEVGIPCDEKTLTR
FT                   ILTKRSLKSDPIHPNAAGYRKLAEGLAKLLHKRGAI"
FT   gene            complement(641427..642434)
FT                   /locus_tag="Geob_0567"
FT   CDS_pept        complement(641427..642434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0567"
FT                   /product="helix-turn-helix SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18934"
FT                   /db_xref="GOA:B9LZX0"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZX0"
FT                   /protein_id="ACM18934.1"
FT                   /translation="MENKIWNPADLLQLSGGYWSACALHASVKLDVFTQLGEGSMAAEE
FT                   LAGRINSDARGLAMLLNSLVALELLEKEHDSYRATPFAREFLSKSSSQYLGHIILHHHH
FT                   LMESWAHLDQAVRSGGPVRQRVSHEAGEEERESFEMGMFNLAMQLAPKIVPAIDLSGRK
FT                   RLLDMGGGPGTYAIHFCLHNPELTAVIYDLPSTRPFAERTISQFGLSDRIAFESGDFIK
FT                   EGIKGTFDVAWLSHILHGEGPEGCAILLEKAISALEPGGMILIQEFILNDAKDGPIFPA
FT                   LFSMNMLLGTPHGQAYGENEIVTMLKAAGARDIRRLPVDLPNGSGIIAGIAGKN"
FT   misc_feature    complement(642462..642505)
FT                   /note="conserved nucleotide sequence; Geob_R4301"
FT   misc_feature    complement(642533..642565)
FT                   /note="conserved nucleotide sequence; Geob_R4501"
FT   gene            complement(642552..643109)
FT                   /locus_tag="Geob_0568"
FT   CDS_pept        complement(642552..643109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0568"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18935"
FT                   /db_xref="GOA:B9LZX1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZX1"
FT                   /protein_id="ACM18935.1"
FT                   /translation="MPHRPAEAEHIRHCPRCAATSLSWHSTKNFRCNACGFTLFLNVAA
FT                   AVGVIIECRGKILFGVRRNDPGKGMLDLPGGFVDPEETAEECAVREVLEETGIRIPGGS
FT                   YFMSLPNSYLFRQITYSTLDLVLTVRLDEFPAMQAADDLAELLWVDRDEVDPEKIAFPS
FT                   LREAVLRYMASMPPVLQAVPSP"
FT   gene            complement(643113..643469)
FT                   /locus_tag="Geob_0569"
FT   CDS_pept        complement(643113..643469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18936"
FT                   /db_xref="GOA:B9LZX2"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZX2"
FT                   /protein_id="ACM18936.1"
FT                   /translation="MGIASILTTAVRGVAWGQVANMALQYGPEILKKIKERRQPQQPGE
FT                   EETVPIIEQLQGRIGELEAALVKQQELIKEQARTIDVLEEAVKTLQARLKIAILLAAGF
FT                   GLLSLVLAAFLIRA"
FT   gene            complement(643629..644303)
FT                   /locus_tag="Geob_0570"
FT   CDS_pept        complement(643629..644303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0570"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18937"
FT                   /db_xref="GOA:B9LZX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZX3"
FT                   /protein_id="ACM18937.1"
FT                   /translation="MNETIITAEKATKSYVTGSVTTHALRGVDLSIEKGSFTCIIGPSG
FT                   HGKSTLMHLIGGLDRPNSGTITVAGRELSRLDNSSLARLRGEKIGFVFQFFNLLPGLTA
FT                   RENVETAMMLSGVPEKEQAPRALDMLSQVGLADKADARPNQLSGGQQQRVAIARALANN
FT                   PEILLMDEPTGNLDSAAEAEVLEILFKLHRQGKTIIIVTHNSDIAARAQHIIRVKDGRI
FT                   AP"
FT   gene            complement(644296..645459)
FT                   /locus_tag="Geob_0571"
FT   CDS_pept        complement(644296..645459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0571"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18938"
FT                   /db_xref="GOA:B9LZX4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZX4"
FT                   /protein_id="ACM18938.1"
FT                   /translation="MTLSKLVVKNITRRRGRFVFTLLGITIGISSFVTFLSMGGSLKSE
FT                   IYRETAALGANLIVIPKGSCGYEQLSVLVGDEMPTNITGDEVKKISAIKGLTAVPFLSQ
FT                   KTAINNKPVAVSGIEPSITLIFKGWQLARGSYFSSLDEPTAVVGAEAAKQFQLQPGSLV
FT                   RIRGEQLAVKGVLKETGGRDDFTLFLPMATAQRLYKSIERVSYVAVRVDDLAKTDAYME
FT                   KIKESVSLGVVSDKQMLKSVLSIVGTVNITLQLIAAVSVLAAAFGIINTMLTATYERKR
FT                   EIGILQALGATRGKIFAMFMLESGFYGLMGGVVGVGVGLLVSILATPYISQNAFTSLVK
FT                   GSGTGTMIDAGVIAVSILFSVAVAVVAGVYPAWRAARLTPVEAISYE"
FT   gene            complement(645460..645846)
FT                   /locus_tag="Geob_0572"
FT   CDS_pept        complement(645460..645846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18939"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZX5"
FT                   /protein_id="ACM18939.1"
FT                   /translation="MKKYMIIAAAVVFGAALSYVLLAAGGGKALNVNEISSDPGAYAGT
FT                   ITVTGVMGGTSPQDPTIFGIMDIKELQCKTANCNKVFVPIKYQGKPPVMGDEIRATGKF
FT                   VNMAGGYLFAAEKLKVVRNHKIGG"
FT   gene            complement(645956..646285)
FT                   /locus_tag="Geob_3847"
FT   CDS_pept        complement(645956..646285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_3847"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_3847"
FT                   /db_xref="EnsemblGenomes-Tr:AID57971"
FT                   /db_xref="UniProtKB/TrEMBL:A0A068F105"
FT                   /protein_id="AID57971.1"
FT                   /translation="MHAFFLRIVSSILLLVAIISFSGIAATAAVFAGSTAGNACCDHEK
FT                   GTDPAETVPCSVPDCPCPSCMAAALPHHAPSHLSQPLFPFSHLTPAQRMHLPGFGRSID
FT                   YPPEY"
FT   gene            complement(646403..646498)
FT                   /pseudo
FT                   /locus_tag="Geob_3848"
FT                   /note="transposase, Y1_Tnp domain-containing; fragment"
FT   gene            complement(646518..648920)
FT                   /locus_tag="Geob_0573"
FT   CDS_pept        complement(646518..648920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0573"
FT                   /product="DNA-binding ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18940"
FT                   /db_xref="GOA:B9LZX6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZX6"
FT                   /protein_id="ACM18940.1"
FT                   /translation="MTQSPEIPDQMNTPAEEGSSGLILASEVLPAGLPIVPLRPRPAFP
FT                   GLLIPMVVNEPHQLAAIKRAMDSPSRTIGLVMVKDLDKPDSAANLHRIGVAGKIVKIMH
FT                   SDEESSHFLINTLERFTIEELSEPPDVFFATVRYSYGTELSVNAELKAYSMAVLTTLKE
FT                   LIQINPLYSEEIKLFLGRSSLDDPGRLADFAANLTSADGQELQQVLESFDVRKRIDQIL
FT                   ILLKKELEVSRLQSKISKQIEEKISSQQREFFLREQLKAIKKELGLEKEGKTSEIEKFE
FT                   ARLKELKLNPEAERAVNEEIEKLRLLEPSSAEYHVTRNYLDWLTILPWGRFSKDSYNLD
FT                   KARRILDRDHYGLQDVKERILEFIAVGKMKGDISGSIICLVGPPGVGKTSVGKSIADAL
FT                   GRTFYRFSLGGMRDEAEIKGHRRTYIGAMPGKFIQAMKSAATSNPLLMLDEIDKVGASF
FT                   QGDPASALLEVLDPEQNASFRDHYLDVPFDLSNVLFIATANQLDTIPAALLDRMEVIRL
FT                   SGYIMEEKLEIARRYLIPKALKAHGLKPGQVTIRKDALAALIDGWAREAGVRTLENRIK
FT                   KIMRKAAMEFASGRSEAITVGKKELTEFLGQPIFTTEELFEAVPGVVTGLAWTSMGGAT
FT                   LPIEATAMPSKGKGFRQTGQLGNVMVESSEIAYSYVMAHLKDYGVQEDFFDTHFIHLHV
FT                   PAGATPKDGPSAGITMATALISMITGKPVRKKLGMTGEFTLTGRVLPIGGVREKTIAAR
FT                   RAGLKTLIFPEVNRKDFNELADYLKEGLEVHFAREYKDVYKVAFGKG"
FT   gene            complement(648969..650036)
FT                   /locus_tag="Geob_0574"
FT   CDS_pept        complement(648969..650036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0574"
FT                   /product="peptidase, M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18941"
FT                   /db_xref="GOA:B9LZX7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZX7"
FT                   /protein_id="ACM18941.1"
FT                   /translation="MTVIQGYYYDGKHSGRRSVTLTRDQADLRLQGDGVDVRYPLASIK
FT                   KSPPLGNVRRSLRFTDGTLCELLSDDNLHELLDGSDHPLQRFISRWERSMPLVLLALVL
FT                   TIGAIIGFIKYGVPLITRQVVQAIPPASEVRLGKESLGFLDKYLMQPSKLTADRRQQVK
FT                   AIFEGMKKDLPRSQAYRLEFRSSDRIGANAFALPGGLIVVTDGMVELAQTDEELEGVLA
FT                   HEAGHQYARHALRHVLQSTGSGLLIAAVTGDITSITTLSATLPTTLINAGYSRDFENEA
FT                   DDAAVSYLVRKGIEPKVYAGMLGRLQSEQDKKVGRDKKTQVWTPADLFATHPSTTERMR
FT                   RVLGWKSELKLPKGG"
FT   gene            complement(650033..651331)
FT                   /locus_tag="Geob_0575"
FT   CDS_pept        complement(650033..651331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0575"
FT                   /product="membrane protein of unknown function DUF898"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18942"
FT                   /db_xref="GOA:B9LZX8"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:B9LZX8"
FT                   /protein_id="ACM18942.1"
FT                   /translation="MPRISITCPHCGFRREMEDSAIPAGVTRATCPKCRQPFPLHDSID
FT                   KETSTAPRPPEVQPSPPPINPSAQAADQDKPGQPRPRMLRFSFTGNARDYFGIWIVNTL
FT                   LKIVTLGIYTAWAKVRKRRYFYGNTLLNDTVFEYLAEPMALFKGWLLAAVFFVLYSVGT
FT                   NVNPFLAGTLGTVFFLAMPWLIVRSRIFNMRYSSHRNIRFTFQPNYREAYLIFAGLPFL
FT                   IPFTLGAIIPYMVYRQKKFFVENSGYGRNRCSFDATVKDFYLIFIKAAGLATLIISVFV
FT                   ACSFLLSTVFRDLSPLFLDGSVGKKTTQKGFIAIFFAVMIGINLIYLFFTIYVQTALAN
FT                   LTWQGTRIRNSRFSSTLRVRDMAWLYLSSAAAIFLSLGLLIPWASIRITRYRFENLSLH
FT                   LKDDMESFLGWGNANVGAAGEEIGDMFGIDIGL"
FT   gene            complement(651354..651551)
FT                   /locus_tag="Geob_0576"
FT   CDS_pept        complement(651354..651551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18943"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0A6"
FT                   /protein_id="ACM18943.1"
FT                   /translation="MGNVKITALDRAMARLCETCPACRSAQRKQQGMAFWLVTRVEEKI
FT                   CPFCRAFEKVHGRKAHEQPD"
FT   misc_feature    651643..651866
FT                   /note="conserved nucleotide sequence; Geob_R5016"
FT   gene            651956..652249
FT                   /locus_tag="Geob_0577"
FT   CDS_pept        651956..652249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18944"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0A7"
FT                   /protein_id="ACM18944.1"
FT                   /translation="MVEDMRVDYQKKLEERLREWKGKIDSLNMSQHQMTAENRAVLNRE
FT                   VKDMLKKKEVMKEKWKALQNSDNHGWALRREELEKASEDLKEALDRVAAHFK"
FT   misc_feature    complement(652251..652359)
FT                   /note="conserved nucleotide sequence; Geob_R2008"
FT   gene            complement(652380..652628)
FT                   /pseudo
FT                   /locus_tag="Geob_0578"
FT                   /note="protein of unknown function DUF2466; C-terminal
FT                   fragment"
FT   gene            652815..654104
FT                   /locus_tag="Geob_0579"
FT   CDS_pept        652815..654104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0579"
FT                   /product="metal-dependent phosphohydrolase"
FT                   /note="domains: HDc"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18945"
FT                   /db_xref="GOA:B9M0A8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0A8"
FT                   /protein_id="ACM18945.1"
FT                   /translation="MPQFFEIRDPIHGFVKITEWERDIINQPAFQRLRRIKQLAWTDMT
FT                   YPGATHSRFEHSLGVMHVVTMLFDSICERQHDFLSSRELRYTVGSLERLRCLVRLAALL
FT                   HDIGHPPYSHAAEETFPIDPETNEPYPHEEYSAAIVKFELADVIENHPSNHFRFKVGDV
FT                   TAFFTNGACRECLLWKDLLSSQMDGDRMDYLLRDSHHAGVNYGKYDLNRIVATIRLIER
FT                   PDSDGYTMGIDEDGIHAAEGLILARYMMFTQLYFHKTRVIYDYHLVEALKEILTECGGH
FT                   FPLPTSADDIKEYLKWDDWRVGGAISEGKGGTHGQILKNRHHFRLLHQTSEIPSIPELE
FT                   DIDRLEGVLAPLGAIRKNAEKSWYKFKQLNDEILVLSNSGSARSSVLPLSVRSPVVQGL
FT                   KSVNQSRIYVPIDKRDEAIEILKRQQGEGT"
FT   gene            654106..654639
FT                   /locus_tag="Geob_0580"
FT   CDS_pept        654106..654639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18946"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0A9"
FT                   /protein_id="ACM18946.1"
FT                   /translation="MSGTPWKDYGLISYISQNVTDLGKTKLHKLVYLIKEVGKVPVGFN
FT                   FRFYNYGPYSDNLAETLDFVTSLQGVKMNYDSTANMYEISAGENAAKLVEKATAELEPN
FT                   KPTIDGILTAYGNKTAKELELITTILYANKNYEAKSVEALTHTTKNLKPKFSLTEIRAS
FT                   IGQLQASDLLSLTQ"
FT   gene            654645..655058
FT                   /gene="cdd"
FT                   /locus_tag="Geob_0581"
FT   CDS_pept        654645..655058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /locus_tag="Geob_0581"
FT                   /product="cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18947"
FT                   /db_xref="GOA:B9M0B0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0B0"
FT                   /protein_id="ACM18947.1"
FT                   /translation="MLNSSDTTYLSLLEKADSARENAYCAYSNFKVGAALLTKSGNIIF
FT                   GSNVENASYGLTNCAERSAIFAAISRGIKPQEIDAIAISATGENFSPCGACRQVIFEMG
FT                   SQIAVIFRFNGKVVIERISDLLPYSFTITINGQ"
FT   gene            655048..655329
FT                   /locus_tag="Geob_3849"
FT   CDS_pept        655048..655329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_3849"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_3849"
FT                   /db_xref="EnsemblGenomes-Tr:AID57972"
FT                   /db_xref="UniProtKB/TrEMBL:A0A068EZW7"
FT                   /protein_id="AID57972.1"
FT                   /translation="MANNLFISYDLMNPGQNYDTVIDAIKLLGAWAKIHQSFWYVSSNF
FT                   SAKDAAEQVWRTMDSNDKLLVVNSSTNDAYWYNLPGNVSEHIQQHWRG"
FT   gene            655422..655949
FT                   /locus_tag="Geob_0582"
FT   CDS_pept        655422..655949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0582"
FT                   /product="endonuclease Nuc"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18948"
FT                   /db_xref="GOA:B9M0B1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0B1"
FT                   /protein_id="ACM18948.1"
FT                   /translation="MRPIICVTWLVALCFMPVYAAPIPANGTVEAFFSPTGGCTESIIR
FT                   EINGAQSEVLIQAYSFTSAPIAKAIIAAKRRGVKIEAVLDKSQRSAKYTAATFLTNAGI
FT                   PLLIDDHHAIAHNKIIIIDRNTLITGSFNFTKAAEEKNAENLLVIKNNQPLILQYLQNF
FT                   ERHRTHSEPYKR"
FT   gene            656035..656937
FT                   /locus_tag="Geob_0583"
FT   CDS_pept        656035..656937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0583"
FT                   /product="DNA cytosine N4-methyltransferase/DNA adenine
FT                   N6-methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18949"
FT                   /db_xref="GOA:B9M0B2"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0B2"
FT                   /protein_id="ACM18949.1"
FT                   /translation="MHMIEAVETIQNQPAIDYNVPVNIVTGDVRQRLSELPEKMFRCCV
FT                   TSPPYWGLRDYGAEDQIGSEMTVEEYISDLTAVFREVRRVLADDGTFWLNIGDSYTSGN
FT                   RTWRDPDKKNPARGMTYRAPTPEGLKPKDLIGIPWKLAFALQLDGWYLRSDIIWNKPNC
FT                   QPESVKDRPTRSHEYVFLLTKSEKYFYNWEAVREPAKTTKHYRSKRTVWDINTEPFSEA
FT                   HFAVFPPGLVEPCLMAGSEPGDFILDPFFGSGTVGVVCLRLGRKCVGVELKPEYVEIAK
FT                   KRLQPEANLFLPQEVIRVA"
FT   gene            complement(656934..657683)
FT                   /locus_tag="Geob_0584"
FT   CDS_pept        complement(656934..657683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0584"
FT                   /product="type II restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18950"
FT                   /db_xref="GOA:B9M0B3"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0B3"
FT                   /protein_id="ACM18950.1"
FT                   /translation="MPICLNTLSSALPGLSQQQIECIQSIACRLTTPGTYWRNPVSDIV
FT                   SEDFLEAFGDILRIHHCLSKDAFSKDKFEYAMEQALSRCGVSAKLADKCNPGHDITIMG
FT                   IPVSLKTQADRSLKVDKVHISKFMELGKGVWGDKVEDLHGLRDSFFRHMAAYQRIFTLR
FT                   TLSRTPKDWHYELVEIPKSLLQKAANGSFEMCNDSTQFPKPGYCRVFEDGELVFELYFD
FT                   GGGERKLQIKNLRKGLCTVHGEWKFAC"
FT   gene            657873..658181
FT                   /locus_tag="Geob_0585"
FT   CDS_pept        657873..658181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0585"
FT                   /product="helix-turn-helix transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18951"
FT                   /db_xref="GOA:B9M0B4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0B4"
FT                   /protein_id="ACM18951.1"
FT                   /translation="MQSKNVSFGTYIAEVRKAKTMSQKEVAAKLDISPQYLNDIEHDKR
FT                   SPSSPQLIDLLATTLEISADYLSYLAGRIPEEVKERKLDPVTFEKAMVAFRKATEKK"
FT   gene            658184..658873
FT                   /locus_tag="Geob_0586"
FT   CDS_pept        658184..658873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18952"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0B5"
FT                   /protein_id="ACM18952.1"
FT                   /translation="MPKMVRDITGKFNQRPHYEPRELDMECEKIICDFLRTLYGQVSFP
FT                   VSTDDLTKLVEKFASSFDQYADLSEYGANVDGLTEFYAKGKPKVSVAARLSESSTYENR
FT                   FRTTMTHELFHAIFHDYLYKMELVSPASKNGALQICKRDDIMSKSKASGATDWMEWQAG
FT                   YACGAFLMPASFLKKTVEAYCTVANVTNPISQSNPRSDELIEAVMSAFQVSKDAARVRL
FT                   LVTNHLQ"
FT   gene            658981..659238
FT                   /locus_tag="Geob_0587"
FT   CDS_pept        658981..659238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18953"
FT                   /db_xref="InterPro:IPR027802"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0B6"
FT                   /protein_id="ACM18953.1"
FT                   /translation="MEREKDQQHDDHGKENVTITIDDNPWTVHRGHHTVAELKTLAGVP
FT                   LAYDLDRVIDGKFEPLPDDGGVTIKGGEIFISHVKDGSSS"
FT   gene            659251..659595
FT                   /locus_tag="Geob_0588"
FT   CDS_pept        659251..659595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18954"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0B7"
FT                   /protein_id="ACM18954.1"
FT                   /translation="MDFPQEQIDEMKATFPGISHSEEGGFDFFFIPGLKLPSSCSPESV
FT                   DVLFCPNQRGGYNSRLYFASMVQSGKALNWNGQNEFILGRRWFAFSWQLPPAERRLSQM
FT                   VALHLRGLIC"
FT   gene            659589..660110
FT                   /locus_tag="Geob_0589"
FT   CDS_pept        659589..660110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18955"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0B8"
FT                   /protein_id="ACM18955.1"
FT                   /translation="MLIHVKMTRHVYEKMRADLNRPHDFAYERVGFIFARKDTADKDAI
FT                   LLLATEYYPVPDVHYIDDPKVGAKINSSAIRSVMERAYSSKECILHVHQHDHSGAPRFS
FT                   RLDRLEYNKMIPSFHNIGGGAIHGALVFSLDNAVGLVWTSKHDSPEPVRKLTIVGYPIE
FT                   TLKPGAGLYV"
FT   gene            660103..660909
FT                   /locus_tag="Geob_0590"
FT   CDS_pept        660103..660909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0590"
FT                   /product="adenylyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18956"
FT                   /db_xref="GOA:B9M0B9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0B9"
FT                   /protein_id="ACM18956.1"
FT                   /translation="MCDDRYDRQSFLGENSQAKIAACTVGIIGLGGGGSHVAQQLAHVG
FT                   FQKYVLYDPDMPEDSNLNRLIGATVRDVKNKVPKVQIARRVIRGLQPRAKIQMIRERWQ
FT                   DNPLPLGNCDIIVGCVDGYKGRHELETFSRRHLMPYIDIGIDVVQVDPQPPVLSGQVIA
FT                   SLPGGPCMWCLGFLTEKKLAAEAKKYGDAGHNPQVVWANGVVASAAVGIAVDLVTGWTG
FT                   SAQDVVYLSYEGNSGLVLPHKRLTVVDRSCQHFPHDQVGEARFIPL"
FT   gene            complement(660896..661585)
FT                   /locus_tag="Geob_0591"
FT   CDS_pept        complement(660896..661585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18957"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0C0"
FT                   /protein_id="ACM18957.1"
FT                   /translation="MTIVMNHDNMTKEELSAAEPSLRRQWFYITFEIIKTNSDPMYWRP
FT                   LLALLCSRAYEYDINECRMLHYSMKLFNYINKLSPEFYLAKDELSQARNIFYQRLSYGS
FT                   DAQVKKRTGIDLTRYTNRQLETVNRRIKREDDFLKRLVALKRYVKKNYAVEKMLEALAK
FT                   SDLEISRTKLYEDIYYWAILQGGKIRKGMIIGIDKAIVQERIDSKKGKISYAYLLGNVE
FT                   YSMATVE"
FT   gene            complement(661582..662214)
FT                   /locus_tag="Geob_0592"
FT   CDS_pept        complement(661582..662214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0592"
FT                   /product="resolvase-like serine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18958"
FT                   /db_xref="GOA:B9M0C1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0C1"
FT                   /protein_id="ACM18958.1"
FT                   /translation="MGQTFAYLRVSTSHQDVKNQRFEILDYSQRNGLRVDHFIEVEMSS
FT                   RKGSGERMIDHLLQRLNPGDSVIVSELSRIGRSTVEVLNIVKQLTEMGVALIAIKQNMT
FT                   VSGNGNVQSKVMVTLFSLFAELERDLISERTKRALEAKKAAGVKIGRPKGRTSASKLDG
FT                   VEEQIRELLRKKVSMASISKIFEVSRGTVYNFIHSRKLRDHDIGRAS"
FT   gene            662526..663200
FT                   /locus_tag="Geob_0593"
FT   CDS_pept        662526..663200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18959"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0C2"
FT                   /protein_id="ACM18959.1"
FT                   /translation="MKKRNVSVSTSIPAEFFSFSDEIEAAVAGEEPKPEGNANTLDREQ
FT                   EQESTTPALAENAGSQLLTLNQLRERREHEGLRAHYSASIDGQYIVADNNIVSIWDQSG
FT                   GDEQLPDLTHSQTLYWAEIDSLPIIDVSAFSYDYYPKVLDYHYRISVIIALYDLYMDYS
FT                   WQVMGYSRSHMYYTDLLNGKEFEELSFYLASYIVDDFAEAYERYVDRQCEEYVAKENEF
FT                   DE"
FT   gene            663289..663984
FT                   /locus_tag="Geob_0594"
FT   CDS_pept        663289..663984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18960"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0C3"
FT                   /protein_id="ACM18960.1"
FT                   /translation="METIAEIVQGASTEHETDEFERWLEKLRADGIKREAEHENFLSDI
FT                   TLRKLQNSTEEERRDQSFFTAKVDNKFFVADKNIISIWQIIGEGQVEYETVKYWSEIDD
FT                   LPFADTSGIFAIRYALPDEVHDFHQKIEAISVLYTLASRTLFEFDKRMWSNQVRLRNRD
FT                   FERLAHELIEQLLAPIPPGYEKTREYRENEIQEATHEKEMDDFMDVYVNCRSLRRTGFR
FT                   IFDWEVLAD"
FT   gene            664263..664772
FT                   /locus_tag="Geob_0595"
FT   CDS_pept        664263..664772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18961"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0C4"
FT                   /protein_id="ACM18961.1"
FT                   /translation="MISLNNHPEKRAYTEFIRRNGPFAYFITLTFPRWQTVDACTQQIN
FT                   YLMHFLNKKIYGRNSGSEYLEGFCFFEKHKTSANNPLHSHILIKHDSRLDTESKISFID
FT                   HFWNMINKVRVVKTNRVTDKEAFNKKCCDIQRIYDEDKLIDYVTKSFESKYFDFNNFRP
FT                   IGQHGI"
FT   gene            664785..664949
FT                   /locus_tag="Geob_0596"
FT   CDS_pept        664785..664949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18962"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0C5"
FT                   /protein_id="ACM18962.1"
FT                   /translation="MKSIYISKKTGRKKYRVCLYLPEEIIKKLDRWTVQNRIAGTTGKS
FT                   ITQMLNLLL"
FT   gene            complement(664994..665314)
FT                   /locus_tag="Geob_0597"
FT   CDS_pept        complement(664994..665314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0597"
FT                   /product="helix-turn-helix transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18963"
FT                   /db_xref="GOA:B9M0C6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0C6"
FT                   /protein_id="ACM18963.1"
FT                   /translation="MKTTKELLGARIKELRKLRKMTQEKLAEQIGVDPKYVSFIEVGRS
FT                   SPSLEAMEKIAQALDVEMKDMFDFSHHEAREVSIEQIDEMLSGVTEDQLKIIHRIVKAF
FT                   KK"
FT   gene            665535..666269
FT                   /locus_tag="Geob_0598"
FT   CDS_pept        665535..666269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18964"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0C7"
FT                   /protein_id="ACM18964.1"
FT                   /translation="MGELKLTKIGWLFRMVLLTVILSLLCSCSKKQDAFKNYKLKYKSG
FT                   QPEKAVASGGSVADLLSKGGATSYSLLDQDKLRYYGMAVSTNDSKMYMAKADVQFDVTG
FT                   SADTKNLLESCNKEVILACDKGDKSCDVLKEIDSCKFNDSGMTAIKGQLEKVQGELNYQ
FT                   LPSVAEIAQSNAGAVKMAVDIAYVPDTSDEYAMSQKAPELASIKQAMPKVKFINHGKDV
FT                   SQDIANVIKFYDENKAKFQANN"
FT   gene            666280..666699
FT                   /locus_tag="Geob_0599"
FT   CDS_pept        666280..666699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18965"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0C8"
FT                   /protein_id="ACM18965.1"
FT                   /translation="MQTICNFRMLQKAIVSLVALAAMLMLISCSASPPDSMMQNYVTIQ
FT                   SQDGKALYKSGGSLKDLMDSYWSPVAQSKIKCSKSSGLYEFSFKSKSYDKVVLSIAENG
FT                   ALKKVVLGDMEIKDDKADAMHNVVMGLFQFESVQQ"
FT   gene            complement(666749..667168)
FT                   /locus_tag="Geob_0600"
FT   CDS_pept        complement(666749..667168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18966"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0C9"
FT                   /protein_id="ACM18966.1"
FT                   /translation="MDCDGTTTISIVNLETGKASEFKLFPNESSLTCFVKLMNIEVIEL
FT                   VDLPDDYCEVVATGTAMDSVGHIFKVQLLYSPETTAEKEQVLADIQAGRYYSASGQFSY
FT                   VAEEGMLMYDAKCRELSDEEAAGVIQVFNINEMAS"
FT   gene            complement(667235..669094)
FT                   /locus_tag="Geob_0601"
FT   CDS_pept        complement(667235..669094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0601"
FT                   /product="resolvase-like serine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18967"
FT                   /db_xref="GOA:B9M0D0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0D0"
FT                   /protein_id="ACM18967.1"
FT                   /translation="MGKPLCISYIRFSNVSQSDGSSVERQLELSQKYAEEHGLILDDKL
FT                   SYRDLGRSAYSGDHVRRGHFGEFLELVRQGSIPTGSVLLVESLDRLSRENVLDAFAQFQ
FT                   VIVGEDIKIVTLCDGMEYTRENLNSDFGKLIISLTIMARAYEESCRKSERIRAANRFKR
FT                   QNLDKVKYTANCPTWLRLIKSENRFEVIHDRAAIVNRIFSMSYEGMGIKTIARILNHEK
FT                   IQPPRSSLGWCQSSIRKILSSRSVIGEYQPHIYNRATKKHVPEGSPVPGYFPRIVEDEV
FT                   YFAVQARLCNGTHISGRTAKIQNLFGGITKCGYCGARMDIVSHKNRNEISRLLVCDQAR
FT                   RGVKCSYISFKCNELESAFLSYCKEIDFISVLKIEGTRDQQRLTELTQQVAAKNGELLD
FT                   INRQIELLGNELPQITDTLELGFFRTRLSKLLQAKAAIEDAIAVREKEINELNASMHDA
FT                   DNKAGNIAELMDYFDAAPSDEDRVLVRTRLRNEIRQIVKQVLVYPRGRVASDEQIIKVA
FT                   LQLNDEITDSDQATAEMLCHERDLVLAQMRKSQENTKDDRYFEVRFKNGNMRRFEYSKE
FT                   DGTYKVTFDRTGTRIDWLMGGKPMKPLIVDEDDQLPTEEAMQG"
FT   gene            complement(669160..669624)
FT                   /pseudo
FT                   /locus_tag="Geob_0602"
FT                   /note="protein of unknown function DUF2466; N-terminal
FT                   fragment"
FT   gene            complement(669633..670445)
FT                   /gene="uppP"
FT                   /locus_tag="Geob_0603"
FT   CDS_pept        complement(669633..670445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="Geob_0603"
FT                   /product="undecaprenyl-diphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18968"
FT                   /db_xref="GOA:B9M0D1"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M0D1"
FT                   /protein_id="ACM18968.1"
FT                   /translation="MDLFQATILGIVQGLTEVLPISSSAHLILIPTFLKWPESGITFDV
FT                   ALHLGTFIALCLYFWRDLIELASDFFTGMADWKHQPTSRRLPFYIIAGTFPAAIVGKLF
FT                   ETTIEELFRKSPSLIALFLIVFALLLAFADTSGSKKWKIEAITLKSAIIIGLAQCLALI
FT                   PGVSRSGITITAALLLGFNREAAARFSFLLSLPIVAGAALFELSGLLKTGIPPSDVAPL
FT                   LIGIATSAVFGYISVAFLLKMVQRSSLYPFVWYRIAIGCLALVFINFG"
FT   gene            670689..671306
FT                   /locus_tag="Geob_0604"
FT   CDS_pept        670689..671306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0604"
FT                   /product="low-affinity phosphate transport protein of
FT                   unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18969"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0D2"
FT                   /protein_id="ACM18969.1"
FT                   /translation="MFGLIPKDEKFFIMFKEMTSNIIEGAELLKDMLDSFSDPATSQRR
FT                   IKDVEHKGDSLTHDIIRKLNKSFVTPFDREDIYALSSALDDILDLIDASAQRVVMYNVE
FT                   KPTPEAKELAFLILKSCQTIDKTVALLGGKLEPISEYCVEVNALENEADRVCREAISRL
FT                   FDEEKDPIQLIKWKEIYETLERATDKCEDAANILESVVVKNA"
FT   gene            671299..672300
FT                   /gene="pit"
FT                   /locus_tag="Geob_0605"
FT   CDS_pept        671299..672300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pit"
FT                   /locus_tag="Geob_0605"
FT                   /product="low-affinity phosphate transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18970"
FT                   /db_xref="GOA:B9M0D3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0D3"
FT                   /protein_id="ACM18970.1"
FT                   /translation="MPDATLVMLFLVIAVALLFDYINGFHDTANAIATCVSTRALSVRS
FT                   AIIMAAGLNFAGAMISTKVAATIGKGIVDANNVTQMVVVAGVTGAIIWDLITWYYGLPS
FT                   SSSHAIIGGIMGSVIAHAGAAALHWAGLKKIILALLVSPVLGTIIGFLFMVIMMWAFRN
FT                   KAPYGLNRSFRRLQIVSAAFMAFSHGTADAQKSMGVITMALLSYGTIATFAVPMWVKVA
FT                   CAVAMAMGTAAGGWRIIKTVGRDFVKLQPVHGFCVETASAGVILGASALGMPTSTTHVI
FT                   TSSILGVGLSKRMSAVNWGIASRILVAWVLTIPASAAVAFVTYMVLSPFLGK"
FT   gene            complement(672363..672845)
FT                   /locus_tag="Geob_0606"
FT   CDS_pept        complement(672363..672845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0606"
FT                   /product="protein of unknown function DUF2062"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18971"
FT                   /db_xref="GOA:B9M0D4"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0D4"
FT                   /protein_id="ACM18971.1"
FT                   /translation="MLNKEKWKKKIKAILSLDSHPGHISAGFAVGVFISFTPFFGLHTP
FT                   MAIAAAFIFRLNKLTCITGAWVNTPITVIPILGISYKLGRMLRGLPPEKFQIEGLQWQH
FT                   LEKHGTSLLLGTSILGFIAAVAAYFICYYLVVRFRQKDETLAELTKEMEETGEDME"
FT   gene            672999..674120
FT                   /gene="proB"
FT                   /locus_tag="Geob_0607"
FT   CDS_pept        672999..674120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="Geob_0607"
FT                   /product="glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18972"
FT                   /db_xref="GOA:B9M0D5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M0D5"
FT                   /protein_id="ACM18972.1"
FT                   /translation="MRKEILKKVKRVVIKIGSGVITSVDNGLDGDRIKGLAAEMAHFRQ
FT                   QGVEVVLVSSGAVAAGRLELGLSDRPRTIPQKQAAAAIGQSKLMRAYEEEFACHGIKVA
FT                   QLLLTRDDLASRPRFLNARATIDTLLECGIIPIINENDTVVVEEIKFGDNDNLSALVTN
FT                   LVEAQLLVILTDIDGFYTADPRTNPEARLIHLVRSITKETERAAGGSGSSVGTGGMATK
FT                   IAAAKKVGKSGIPTIMVNGKKSGNLELVLAGTEVGTLFLPAGVSLNRRKHWIAYTQRPA
FT                   GRVVVDNGAFRVLSQHGRSLLPSGVVQVEGKFDRGACVRICTPDGTEFARGITDYSSRE
FT                   MELIAGHKSGDIEQILGYRYGDDVIHRDNLVVL"
FT   misc_feature    complement(674135..674231)
FT                   /note="conserved nucleotide sequence; Geob_R2009"
FT   gene            674263..675519
FT                   /gene="proA"
FT                   /locus_tag="Geob_0608"
FT   CDS_pept        674263..675519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="Geob_0608"
FT                   /product="glutamyl-5-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18973"
FT                   /db_xref="GOA:B9M0D6"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M0D6"
FT                   /protein_id="ACM18973.1"
FT                   /translation="MTVAEKIRKIAADARAASLAMARLSSAAKNELLLRMAEALENNAP
FT                   LITAENARDLEAGQQKGLSAAMLDRLMLDESRIKAMADGLREVAALPDPVGEVTHMWKR
FT                   PNEITVGKMRIPLGVIGIIYESRPNVTSDAAALCLKAGNAVVLRGGSEAIHSNLAIAGL
FT                   LQDQMRKLGIPVAALSLIPFPERAGVTEMLKQEEFIDVIIPRGGESLIRFVVEHSKIPV
FT                   IKHYKGVCHIFVDATADFGMAEKIIINSKTQRPGVCNALETLLIHKDVAETFVPRIHEA
FT                   LSTLKVELRGDEAFRQFAPGVKAATEEDWYAEYLELILAARVVDDLDEAIAHINKYGSL
FT                   HTEAIITSDYANSQRFLREVNSSVVLVNASTRFSDGNQLGLGAEIGISTTKLHSFGPMG
FT                   LEDLTTTKFIVYGEGQIRQ"
FT   misc_feature    675514..675629
FT                   /note="heptanucleotide repeats; Geob_R7002"
FT   gene            675652..676302
FT                   /gene="nadD"
FT                   /locus_tag="Geob_0609"
FT   CDS_pept        675652..676302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="Geob_0609"
FT                   /product="nicotinate/nicotinamide mononucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18974"
FT                   /db_xref="GOA:B9M0D7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M0D7"
FT                   /protein_id="ACM18974.1"
FT                   /translation="MRIGILGGTFNPIHNAHLRIAEEVRDRLDLERVMFVPAASPPHKL
FT                   LAGELSFEVRYEMVRLAIADNPFFTISDIEGKRGGTSYSIHTLQELHLAYPADEFFFII
FT                   GSDSFLDIGSWKEYAAIFNLCNIVVVSRPGAVADPLDKALPVAIADRFCYHAAEKRLTH
FT                   SSGHSVYSIAGTLLDISSSEIRTLTRQGRSIRYLLPATVEQYIKEQRIYNDGR"
FT   gene            676292..676678
FT                   /locus_tag="Geob_0610"
FT   CDS_pept        676292..676678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0610"
FT                   /product="protein of unknown function DUF143"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18975"
FT                   /db_xref="GOA:B9M0D8"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0D8"
FT                   /protein_id="ACM18975.1"
FT                   /translation="MVDKNVLNSRERAIQCAALALDKKALDVRIYEISRHSSIADYLVL
FT                   ANGRSDKQTQAIADSVRQGLKKFGKALDIEGMQEGRWVIIDYGDVIVHVFQEEVRRHYN
FT                   LDEMWNNCPLVEIPEQYLWEDKEK"
FT   gene            676675..677136
FT                   /gene="rlmH"
FT                   /locus_tag="Geob_0611"
FT   CDS_pept        676675..677136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmH"
FT                   /locus_tag="Geob_0611"
FT                   /product="23S rRNA
FT                   (pseudouridine1915-N3)-methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18976"
FT                   /db_xref="GOA:B9M0D9"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M0D9"
FT                   /protein_id="ACM18976.1"
FT                   /translation="MRLKVLWVGKTQEEWVRRGIDEYAGRIGRYMSIDLAEARDEKGAA
FT                   VEAMREREGERLLKLLPKNARLVLLDERGEQMSSPELARFLATNRDGGTQELVFVIGGA
FT                   YGFSDSLRAKAFKTISLSRMTFTHQMVRIFLLEQLYRGFTIINGEPYHH"
FT   gene            677245..678786
FT                   /gene="gpmI"
FT                   /locus_tag="Geob_0612"
FT   CDS_pept        677245..678786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="Geob_0612"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18977"
FT                   /db_xref="GOA:B9M0E0"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0E0"
FT                   /protein_id="ACM18977.1"
FT                   /translation="MPKQPLMLMILDGWGINPQRENNAIAQARTPNMDRLCAEYPCTEM
FT                   GTSGMSVGLPEGQMGNSEVGHLNIGAGRIVYQDLTRISKSIEDGDFFTNPVLLDCIAKT
FT                   KAAGGRLHLAGLLSDGGVHSQNTHLYALLRLAKQQGLDEVFIHCLLDGRDTPPQSGADY
FT                   LAQLEEEIARIGCGRIATVIGRFYAMDRDNRWERVEKAYRAIVCGDGEEFSSAAAAIDK
FT                   SYENGVTDEFVLPSVITAGGAAIGKINDGDGFIFFNYRSDRAREITRSLTDIAFAGFQR
FT                   PCWANLASYVCMTTYDETFGLPVAFGPEELKNILGEVLGRAGLRQLRIAETEKYAHVTF
FT                   FFNGGSEVPFPGEDRALIPSPKEVATYDQKPEMSVYHVTEELLRRLDQDIYDVIILNFA
FT                   NADMVGHTGIMSAAIKAIEAVDECVGTLVDKVRSLGGRVLITADHGNAEIMTDEAGGPH
FT                   TAHTCDVVPFILVDDTRKSVKLQPAILADIAPTMLEILGVEKPKEMTGKSLITNA"
FT   misc_feature    678826..678858
FT                   /note="conserved nucleotide sequence; Geob_R4502"
FT   misc_feature    678889..678932
FT                   /note="conserved nucleotide sequence; Geob_R4302"
FT   gene            679043..679711
FT                   /locus_tag="Geob_0613"
FT   CDS_pept        679043..679711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0613"
FT                   /product="iron-sulfur cluster-binding flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18978"
FT                   /db_xref="GOA:B9M0E1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0E1"
FT                   /protein_id="ACM18978.1"
FT                   /translation="MNFIAINGSPHAQRGNTGLLLDKVVEGVQSAGGTVEMVYLSKIKV
FT                   NPCVGCDVCHKTGSCPIPDDFEELKKKLLACDGFILASPNYIMSVSAQLKALFDRCCGI
FT                   IHCQAMDGKYGVVVETSGGGGDEQVIDYMQRVVGMLGAWSVGSVGSSIAGERLFPDQDR
FT                   LFAKATALGEELYRATLEKREYPDQAGAKLALSAYMRGLVDLMKDFWRYEYDYWTKLGK
FT                   "
FT   gene            679735..680388
FT                   /locus_tag="Geob_0614"
FT   CDS_pept        679735..680388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0614"
FT                   /product="protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18979"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0E2"
FT                   /protein_id="ACM18979.1"
FT                   /translation="MSQSKELMDWTFEQKCKKAVAALEKNGFTAIYCQSGKDVHDYIVK
FT                   EAADAANIGFGGSMSVAELEVADQLRAQGKEILNHGQPGLSLEEKMATMRRQLTCDLFL
FT                   TGTNALTLSGILVNIDASGNRVGSMFFGPKKVIVVAGRNKLVDGDIDAAVKRVKDWASP
FT                   PNARRLNYNTPCSKTGFCSDCNSPDRICRITTVIDRKPRLTDMRVLVVNEDLGL"
FT   gene            680395..681114
FT                   /locus_tag="Geob_0615"
FT   CDS_pept        680395..681114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0615"
FT                   /product="amidophosphoribosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18980"
FT                   /db_xref="GOA:B9M0E3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0E3"
FT                   /protein_id="ACM18980.1"
FT                   /translation="MFRSLLDIIFPPLCHLCRVYIPNAGDVHLCTSCLEQLHPVASPLC
FT                   PICGVPFATEDGIDHRCGACSVRRPAYVAARAAFVFDGPIQELIHRFKYAHKTHLSRPL
FT                   ALMTARHLADFAGQTAADIVIPVPLHKKRLRWRSYNQAILLAAVLSKEWRIPLSRNALQ
FT                   RTRWTEPQINLAADERQQNVKGAFAVAEPERVADRRIILIDDVFTTGSTVEECAKTLKK
FT                   AGAAEIFIITVARALSN"
FT   gene            681203..681472
FT                   /gene="ppcC"
FT                   /locus_tag="Geob_0616"
FT   CDS_pept        681203..681472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppcC"
FT                   /locus_tag="Geob_0616"
FT                   /product="cytochrome c, 3 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18981"
FT                   /db_xref="GOA:B9M0E4"
FT                   /db_xref="InterPro:IPR002322"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0E4"
FT                   /protein_id="ACM18981.1"
FT                   /translation="MKKVLAVVLMVAFSASAAFAADTVVMKAKNGNVTFDHKKHSASGD
FT                   CKSCHGEGTPAKLTLGKDAAHKLCKGCHETKKAGPTKCGECHKK"
FT   misc_feature    681553..681638
FT                   /note="conserved nucleotide sequence; Geob_R0070"
FT   gene            681639..682094
FT                   /locus_tag="Geob_0617"
FT   CDS_pept        681639..682094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18982"
FT                   /db_xref="GOA:B9M0E5"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0E5"
FT                   /protein_id="ACM18982.1"
FT                   /translation="MANGFDYTRLKRLITIYYVVQGFLLVLLAGIAFWLQAHVPQQIFI
FT                   NSLIRAVVAQVVLFYPVYKFAAYEATREVSSCSTSLSSQEVLGLRRKRVTGDIVKAGIF
FT                   VFFLVFILRAPQLPGAQFSILFVFILMTLCYFQCYNYVAKRQMKANP"
FT   gene            complement(682084..684591)
FT                   /gene="dinG"
FT                   /locus_tag="Geob_0618"
FT   CDS_pept        complement(682084..684591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinG"
FT                   /locus_tag="Geob_0618"
FT                   /product="ATP-dependent DNA helicase DinG"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18983"
FT                   /db_xref="GOA:B9M0E6"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0E6"
FT                   /protein_id="ACM18983.1"
FT                   /translation="MKRYFSENALLQMREAISDAGGNEVFFLGRTDEAKVVIDAEPLAR
FT                   GNVDAVAAIMIVTSFGDVVIHNHPSGILTPSQADIEIASLMGNQGVGFYIVDNAVERCY
FT                   QAVSPFARTVLERLSYPELERWYAPGGVLAEHLKGYEHRAEQTRMAFAVAEAFNEERIA
FT                   VIEAGTGIGKSLAYLLPAALWGLRNKERVVISTNTINLQEQLIKKDIPFLQKHGEIEFR
FT                   AVLVKGRNNYLCLRKLESVKAEPTLFKDDAANELQTIIDWSGKTGEGCRSDLSFIPRDE
FT                   TWDEISCEADQCGRVKCPHYARCFFYKARREAAGADLLVVNHALLMADVAVRQETGYGS
FT                   TAILPPFERIIFDEGHHLEDVATSFLSAQVSRNGLLRILGKLQHPRKTQRGLLPLLSTQ
FT                   LSREVPEAMDDIYMEVAAILEGRLIPRRLTLTDTMNRAMDAIGIALNSHLRKDAGSKEE
FT                   IKLRLTLTIYSTPLWVEVEDRVNELCREIGEYVIALKNFLKACEKLPDKVLEKLAGSLV
FT                   DLKGVRGRLETAQVNLRFFVAREEGFCRWFESKKTTKGLVVKLCSSPLEVAESLKKVVF
FT                   DKFKTVIVTSATLAVGERFDYLKKRTGLSMVPGPRVSELLLASPFDYQKQTFVGIPTDI
FT                   PEPVASGFEPVLNKYLLQALGISQGRAFVLFTSYSLLSRIYSRLAEPLKKAGLTPMRQG
FT                   EINRHLLLSQFKKGHNPVLFGTDSFWEGVDVKGKALEQVIITRLPFRVPTEPILEARAE
FT                   HIASLGGDPFMEYTVPQAVIKFKQGFGRLIRSKEDRGAVLILDSRVLSKNYGKSFLRSL
FT                   PDVRMVKGKGEEVFAAMSEFFRG"
FT   gene            complement(684696..684968)
FT                   /gene="ppcB"
FT                   /locus_tag="Geob_0619"
FT   CDS_pept        complement(684696..684968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppcB"
FT                   /locus_tag="Geob_0619"
FT                   /product="cytochrome c, 3 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18984"
FT                   /db_xref="GOA:B9M0E7"
FT                   /db_xref="InterPro:IPR002322"
FT                   /db_xref="InterPro:IPR020942"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0E7"
FT                   /protein_id="ACM18984.1"
FT                   /translation="MKKLIAAAALVMFAAGASMAADTITLEAKNGNVTFNHKKHQETLK
FT                   ECKVCHGDKTGKIENFNKDAAHKLCKGCHEEKKAGPTKCGECHKK"
FT   gene            685146..686075
FT                   /locus_tag="Geob_0620"
FT   CDS_pept        685146..686075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0620"
FT                   /product="helix-turn-helix XRE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18985"
FT                   /db_xref="GOA:B9M0E8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0E8"
FT                   /protein_id="ACM18985.1"
FT                   /translation="MENLSDKNEKATSGSVAIEGVTIKTVRETKKLTQLYVASVVGVTT
FT                   DTISRWENNRYPTIKRENAEKLAMALEVNLDEILRHETACPSEEVVENELPQPKKKNRR
FT                   GLLLAILIIALIIIAAFFILSNMSSPVAAVRWIPKYSAPGELMPVQITVNRMDNTSRGL
FT                   IIKEKLPPGWRLVNAMPPAASGKAPSEEIKWLIPGGSGAVRISYVVQLPQDAALDTRAE
FT                   LHGTIFVHTGSINRAEAIKGNDRVTIAPLHWADSNGDSRIDDSEIMPAYYITEEMKSLA
FT                   LDWSGIEAIWSGSGYSWDQTRKEFKVTK"
FT   gene            686089..687078
FT                   /gene="yhcC-1"
FT                   /locus_tag="Geob_0621"
FT   CDS_pept        686089..687078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhcC-1"
FT                   /locus_tag="Geob_0621"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18986"
FT                   /db_xref="GOA:B9M0E9"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0E9"
FT                   /protein_id="ACM18986.1"
FT                   /translation="MLNGKKRYNIFSEELKRVFGCRVHRISVDAGFSCPNRDGTVGNTG
FT                   CIYCGGSGSGSFGIIRGASIAEQLEHGKEVMTRKYKAKKFLAYFQPYSNTFATPGRLQA
FT                   LYDQALAVEDVVGLIVGTRPDCLPAETLDVLASYARKTYFWLELGLQSHLDRTLSLIRR
FT                   GHDFASFVRGIKECKARQIKVCAHIILGLPGETREEMLAGAQVLNDLGVDGVKLHLLHV
FT                   MRDTALADEYQQGRVRILDRDEYVGLVCDFLELLDPAISVQRLTGDGNRDHLLAPLWSL
FT                   QKFEVLNTIDSELVRRGTCQGSTFDVRCSMFKREDVLQPRTSNSERRT"
FT   gene            complement(687075..688319)
FT                   /locus_tag="Geob_0622"
FT   CDS_pept        complement(687075..688319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0622"
FT                   /product="outer membrane surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18987"
FT                   /db_xref="GOA:B9M0F0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0F0"
FT                   /protein_id="ACM18987.1"
FT                   /translation="MSLKNLLLLLITALFLAGCTTMAPKENLPFPLTNQEFADPVKVVS
FT                   IPLPIIASSPNEGITFGALTAFLLHNKKEEVSTLVAPQVNYNKNFGTTATLFATFYPVE
FT                   DRYWEVALSKSTKVNEDFEFKLRDSTLLDKKLELNAFLFSLTDGSARFFGFQQTSQKAN
FT                   ETNYADQETGFNLSAGYQIFRHVQLVVGERFKKVDIKHGAITKVPFIREKFDPAEVPGM
FT                   DGFTAHAQKLGIVYSTLDSPTLPTWGGYARVAVEASVKRLGSSADYRHYEAEMKAYYPL
FT                   MNAKFISVGRLAYNQTLGHDVPFLERSILGGETTLRGYGRNRFIDSSYFLLNLEERIRL
FT                   FRWEIFDVNADWEIAPFIDLGAVMERLDKASTRSFEFNPGIGFRAVVRPNIVGRVDLGI
FT                   GKEGPAVFVGLGYPF"
FT   gene            688652..690733
FT                   /gene="flhA"
FT                   /locus_tag="Geob_0623"
FT   CDS_pept        688652..690733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="Geob_0623"
FT                   /product="flagellar biogenesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18988"
FT                   /db_xref="GOA:B9M0F1"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0F1"
FT                   /protein_id="ACM18988.1"
FT                   /translation="MAPAAEAIDIQPYRKNSDIYMAVALIGILSLMIIPLPAFVLDVFL
FT                   AANITIALVILLVSLYTIQALDFSIFPSILLITTLFRLALNIASTRLILLHGSEGAEAA
FT                   GAVIKAFGLFVVGGNYVVGAVIFLILVVINFVVITKGAGRVAEVAARFTLDAMPGKQMA
FT                   IDADLSNGLITDKEAKARRSKISREADFYGSMDGASKFVRGDAVAGILIMLINIIGGFV
FT                   IGVWQQGMELAAALSNYTLLTVGEGLVAQIPALIISTAAGIIVTRSADEKNFGHEISGQ
FT                   LLNYPKAFYIASGVMFVFALIPGLPHFPFLLISGAAFMAGRLAVEKKEVQQEEMTAAGA
FT                   LEPEDADQISSIRPLDMLELEVGYGLVPMVDAAQNGELLDRIRSIRKQYAQRMGFIVPP
FT                   IHIHDNLQLKPYEYNIMINGAKVSGGELNGQYLAMDAGSASGNLEGTRTTEPVFGLPAI
FT                   WIKGRDREQAQVYGYTVVDNTTILATHISEIIKKHAHELVGRQELQQLLDSLSSTLPKV
FT                   VEELVPSLLSLGTVLRVVKNLLRENVSIRDLRSILETLADYGGVTKDPETLTEFVRQSL
FT                   GRYIVEQYKREDDTLWVLTLDREVEESIADAVQISEQGSYLAIEPATAQKILAAIRKAA
FT                   EKFDQTGTAPVVIASPSVRRHMKKLTDRYMPNLAVISHNEIPPSIKIQSIGMVSLDAS"
FT   gene            690723..692075
FT                   /gene="flhF"
FT                   /locus_tag="Geob_0624"
FT   CDS_pept        690723..692075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="Geob_0624"
FT                   /product="flagellar biogenesis protein FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18989"
FT                   /db_xref="GOA:B9M0F2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0F2"
FT                   /protein_id="ACM18989.1"
FT                   /translation="MLVKTFQAADMSEALKMVKAEMGLDAMILSSKQERRRGILGFFSK
FT                   PYFEVTAALEQKKVQRPVHYQEKPERELSTREEFQNSMLAPLARELRELRERVEVLAKK
FT                   DAEKKEALSSTAAEKSEDEIKPFQPQKEGTAPRIFAREDMEEIKKLLLNAVAAKEEKGS
FT                   KPVSFPVVSTEDKVCVKNLADDCELSDEALELLANELRSEEVGTDSIHALLELIRPAAE
FT                   LGEELEALRERLVDAFAGIIKCSGPLRLRKTGPRIMATVGPTGVGKTTTIAKLAAMYAL
FT                   NRGARVAMVTTDNFRVGAVEQLKTYSKIMDVPLEVAATAKELEAVLAKHADKDLILIDT
FT                   AGRSPKDREKLEELKVYLESCPGIETYLCISATTRDREMNEIVAQYSLLPITRLLFTKL
FT                   DESESYGCIVNAQVRNRFPLSYFTTGQKVPEDIEVATARKLANLVLRETEK"
FT   gene            692072..692992
FT                   /gene="flhG"
FT                   /locus_tag="Geob_0625"
FT   CDS_pept        692072..692992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhG"
FT                   /locus_tag="Geob_0625"
FT                   /product="flagellar biogenesis ATPase FlhG"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18990"
FT                   /db_xref="GOA:B9M0F3"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033875"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0F3"
FT                   /protein_id="ACM18990.1"
FT                   /translation="MSSDQADTLRQLAGTVNVTRRDVDLYAGRISSRQDIRVISVTSGK
FT                   GGVGKSNVVVNLAVSLANQGKKVLVIDADLGVGNIDILLGLRPVFTMNHVLSGEKSLNE
FT                   IIISAAGGIKVVPAGLGVQEYTSLGTPERLKLLDELDRLEEDFDVFIIDTEAGISENVT
FT                   YFNVAAREILVVVTPEPTSITDVYALIKLLSTRYGERHFKVLVNMARDQKDAVGVYDKL
FT                   YNVADRFLDVSMDFMGCILRDDLVGEAVRRQKPVCQLYPNGKASRCYTALARRIMASGC
FT                   DNRLKGNIQFLSRKNFPSTAGLECI"
FT   gene            692989..693744
FT                   /gene="fliA"
FT                   /locus_tag="Geob_0626"
FT   CDS_pept        692989..693744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /locus_tag="Geob_0626"
FT                   /product="RNA polymerase sigma-28 factor for flagellar
FT                   operon"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18991"
FT                   /db_xref="GOA:B9M0F4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0F4"
FT                   /protein_id="ACM18991.1"
FT                   /translation="MNCLLKAYEQEAQRTAIPDRDELVVSHLPLVKFLVDRIASALPPH
FT                   LDRDDLRSAAVIGLISAAERFDPTRGVMFKTFAEQRIRGTIMDELRSQDWLTRSLRDKF
FT                   KRLEREFSALEQRLGRNPSSDEVAAAMGLDLEAYFHLLEEIHFLSFVSLDDAWMDEDGS
FT                   PLGLLDVLEDKGIESPQNQLIARQTVENLAEAIDNLPEKERIVITLYYYEEMNLKEIGA
FT                   VLHLTESRISQLHSQALLRLRGRMKLHRP"
FT   gene            693799..694533
FT                   /gene="flgF"
FT                   /locus_tag="Geob_0627"
FT   CDS_pept        693799..694533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="Geob_0627"
FT                   /product="flagellar basal body rod protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18992"
FT                   /db_xref="GOA:B9M0F5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0F5"
FT                   /protein_id="ACM18992.1"
FT                   /translation="MNSGLYAALSGNLAAMRRLDVISNNLANANTAGFKGDRLQFESVL
FT                   ASSKSQSQAAASPNDSPVFSSEIFFTDYSPGPLKQTGNTLDVALDGDGFFVVNTPQGRA
FT                   YTRQGNFRMDSAGRLVTSEGYEVQGGGPITVNGGRVDIDAKGAILVDGTPAGTLDIVDF
FT                   QKPYALQKLGEGLFIPANPQETPVNVTTTTVQQGALEGSNVNVVAEMVRMIETTRYFES
FT                   CQKVVRSYDDITGKAANDLGRV"
FT   gene            694642..695430
FT                   /gene="flgG"
FT                   /locus_tag="Geob_0628"
FT   CDS_pept        694642..695430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="Geob_0628"
FT                   /product="flagellar basal body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18993"
FT                   /db_xref="GOA:B9M0F6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0F6"
FT                   /protein_id="ACM18993.1"
FT                   /translation="MIRALWTAASGMQAQQLNIDVVANNLANVNTTGFKKSRADFHDLM
FT                   YQSMKTSGAPSTNATQIPTGIQVGLGSKPAAVTKIFTTGNVTQTGNELDVAIEGDGFFQ
FT                   IQMPDGSTEYTRAGAFKKDSQGRVVTSEGYPLLPEVVIPNNTTSITIGNDGTVSVIQSG
FT                   QTSPTSVGTIQLATFSNPAGLSSQGHNLFKETESSGAATTGTSGQNGIGTLSQGYLEMS
FT                   NVSVAEEMVNMIVGQRAYEINSKAVQAADEMLQTANNLKR"
FT   gene            695656..696336
FT                   /gene="flgA"
FT                   /locus_tag="Geob_0629"
FT   CDS_pept        695656..696336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="Geob_0629"
FT                   /product="flagellar basal body P-ring formation protein
FT                   FlgA"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18994"
FT                   /db_xref="GOA:B9M0F7"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0F7"
FT                   /protein_id="ACM18994.1"
FT                   /translation="MLLVLSTSSALATNQTVKEAEVRRVVNDYLQQKCDNLGLEINIKK
FT                   IAYSGDLSLSAGDLSYEVVAPDRWEGWGSANLALIVRVDGRVERNVPVKVEVEAMAEMV
FT                   VAVRPLERGEVIDAADVAVQKRGLSRLQGRFVRDVDEVVGKRVRTAIRGNNPIRPDFLE
FT                   RVPLIKSGQLVTIVAENESLRITAAGKARNSGAEGDTVMVRNLASQKELPARVIDAETV
FT                   KVDF"
FT   gene            696339..697031
FT                   /gene="flgH"
FT                   /locus_tag="Geob_0630"
FT   CDS_pept        696339..697031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="Geob_0630"
FT                   /product="flagellar L-ring lipoprotein FlgH"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18995"
FT                   /db_xref="GOA:B9M0F8"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0F8"
FT                   /protein_id="ACM18995.1"
FT                   /translation="MNIQSTPAKYLMLAVLLLLPACSFQSSEIRTPTFDEQMQQAKPTY
FT                   TSGSIWQDSSTGITEDLKARRRGDTLTVVITEQASASKQATTGTSRGSTISAGIPNLMG
FT                   LETNITGISNWMDLSNLLNASYDSKYDGSGKTTREENLRATITAKVIDVIGNGNLLIEG
FT                   KRNVKVNNEDQIIVLTGTVRTRDISSDNVVNSIYIADARINYSGKGVISDRQRPGWLMG
FT                   ILDVIWPF"
FT   gene            697093..698187
FT                   /gene="flgI"
FT                   /locus_tag="Geob_0631"
FT   CDS_pept        697093..698187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="Geob_0631"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18996"
FT                   /db_xref="GOA:B9M0F9"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0F9"
FT                   /protein_id="ACM18996.1"
FT                   /translation="MTRRTCTILLLLLLLPQLALAVRIKDIAAFDGVRDNQLLGYGLVV
FT                   GLNGSGDSDQTKFPVQSLVNTLERMGITINRADITVKNVAAVMVTASLPPFAKQGNTLD
FT                   VLVSSVGDAKSLAGGTLLMTPLKGGDSQIYAVAQGAVLTNSFSYGGQAASVQKNHPTAG
FT                   RVPAGALVERELPNVLAGRNVLRLNLHQPDFTTASRIAAAVNGKFKAQVASLTDPGSVQ
FT                   LAMPDGFIGRPVEFVAELERLEVTPDVMAKVVLNERTGTIVIGENVRISAVAVSHGNLT
FT                   LYVKETPKVSQPAPLGTGETKVVPRTSVKVKEERGSLAIVPQGTNISDVVRALNALGVT
FT                   PRDLIGIMQAIKAAGALNAELSVI"
FT   gene            698226..698570
FT                   /gene="flgJ"
FT                   /locus_tag="Geob_0632"
FT   CDS_pept        698226..698570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgJ"
FT                   /locus_tag="Geob_0632"
FT                   /product="flagellar rod-binding protein FlgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18997"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0G0"
FT                   /protein_id="ACM18997.1"
FT                   /translation="MEIKATVLPVALVDSTGTQSLKLGQQSAEKNNMAIRKAAREFESL
FT                   FVGMMLKSMRETVGKDKLTGGGHGEEAYQSLLDQEYAKAAAENGSLGLARTIEKQLLAE
FT                   GAGKKKPDKD"
FT   gene            698607..698888
FT                   /gene="flgM"
FT                   /locus_tag="Geob_0633"
FT   CDS_pept        698607..698888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgM"
FT                   /locus_tag="Geob_0633"
FT                   /product="negative regulator of flagellin synthesis FlgM"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18998"
FT                   /db_xref="GOA:B9M0G1"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0G1"
FT                   /protein_id="ACM18998.1"
FT                   /translation="MKVDQQSQVHTIDFYHGRTAAADAVTGSGRQIDIIEISPATREID
FT                   ALKKSVATLPEMRLDRVALMKQQLGFGAYRIDAEFVAAKMIENHATGG"
FT   gene            698891..699388
FT                   /gene="flgN"
FT                   /locus_tag="Geob_0634"
FT   CDS_pept        698891..699388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgN"
FT                   /locus_tag="Geob_0634"
FT                   /product="flagellar biogenesis chaperone FlgN"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACM18999"
FT                   /db_xref="GOA:B9M0G2"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0G2"
FT                   /protein_id="ACM18999.1"
FT                   /translation="MTTGIDELIRALREKGALLDEMYQLLEEEQNCIIALDMARLETNQ
FT                   SEVDSAMGRLERLNGNCRNLLAKTGAALGLEDNGSLSPLIARTAGQERLALQGLQTDLT
FT                   TSTTAVDNLLAMNRNLLQDSLGLVDRSLNFFNSLFNNPTTYGQAGTMRTNNGGARLVCK
FT                   EI"
FT   gene            699389..700828
FT                   /gene="flgK"
FT                   /locus_tag="Geob_0635"
FT   CDS_pept        699389..700828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="Geob_0635"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19000"
FT                   /db_xref="GOA:B9M0G3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0G3"
FT                   /protein_id="ACM19000.1"
FT                   /translation="MGINDIFSIATRGIAAQRQAIEVTSENIANVNTPGYSRQRVIMES
FT                   GPANIASGFPIGGGVEVVAVQRSYDNLLQTQLVNGNSTYQQNLAKQTALQQVEPLFNEV
FT                   STDGLGKAMESFFGSWQDLSLNPQGAPERQALIARSQILVDTFHQMNTNLNAVITSADQ
FT                   DLVSITADVSDKLGNIALLNQQIMTTQGMGGNVNEMKDQRDLLVQELAGKVGITTSEQS
FT                   NGTLTVSLTLGGQTLVSGNQYSTVYTSPDGGTPQRNDIYVTPLGNPPPANTPATDTDVT
FT                   ATIGGLNNGYGEIGGTLQVRDQIVPGYLAKLDELASKIITSVNTQHTAGADLAGGAGVA
FT                   FFTGTSSADIAVSGTITSDPTRIAAAANPFVGPGDNRNALLIADIKNSSLAFSTGNSTV
FT                   ADFFNAFVSNVGIDVQKAKNTAAQGEAFLKQLNTLRESNAGVSLDEELTNLLKYQRAFE
FT                   GAARLVTTGSEMMDTILAMVR"
FT   gene            700858..701778
FT                   /gene="flgL"
FT                   /locus_tag="Geob_0636"
FT   CDS_pept        700858..701778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="Geob_0636"
FT                   /product="flagellar hook-filament junction protein FlgL"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19001"
FT                   /db_xref="GOA:B9M0G4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0G4"
FT                   /protein_id="ACM19001.1"
FT                   /translation="MRVTPGMTADNALYNLQQGRSKLDQLQEQIASGSVINRPSDDPIS
FT                   TRQILAMQNGVTEGDQYLSNIEKGNIWLNITNTALTGMSSIMAQVKTIASNMISTSTDA
FT                   NMIANATTNLTQLKNQLIDLGNTQIGNQYVFGGFDNSTAPFDASGVFSGTDDPMKVDIA
FT                   RNSSVAINITGGDLLRGGTPAVGAGSGATAGTRPADIIDSIDKLIAAITSSSAADIVDG
FT                   VKNMKASADQIAAAQSTVAGNMMRLDNAKTMIVNNQNTLKNIISSKQNVDYAKAATELS
FT                   QQQTAFEAALSATAKISRLSLLDYI"
FT   gene            701957..702214
FT                   /gene="flbD"
FT                   /locus_tag="Geob_0637"
FT   CDS_pept        701957..702214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbD"
FT                   /locus_tag="Geob_0637"
FT                   /product="flagellar protein FlbD"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19002"
FT                   /db_xref="InterPro:IPR009384"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0G5"
FT                   /protein_id="ACM19002.1"
FT                   /translation="MIRLTRMDGSEIYLNPDLMEIIEETPDTHIALTNGNRYLVLEPVA
FT                   VILDRIVTFKASIQRRSSGGMKKKYLLRQRKENYRPICPL"
FT   gene            702242..703012
FT                   /gene="motA"
FT                   /locus_tag="Geob_0638"
FT   CDS_pept        702242..703012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="Geob_0638"
FT                   /product="flagellar basal body stator protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19003"
FT                   /db_xref="GOA:B9M0G6"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0G6"
FT                   /protein_id="ACM19003.1"
FT                   /translation="MDIASIIGLILGFGAVIGGQILEGGHVSAIIQPTAALIVLGGTIG
FT                   ATFVSFPLANILNALKDARKVLFPPKDDPEAVIKNIINYAAKARRNGLISLEQEAQTVK
FT                   DSFTKKGISLVVDGIDPQKLRETMEIELNSFEEHAKASAEVFEAAGGFAPTIGIIGAVL
FT                   GLIHVMNNLSDSSKLGAGIAVAFVATIYGLMTANIICIPISTKLKLRLKEAILQKEMVI
FT                   EGLIAIQNGENPHFIEQKLRAYLPEGGAGAKKGK"
FT   gene            703013..703789
FT                   /gene="motB"
FT                   /locus_tag="Geob_0639"
FT   CDS_pept        703013..703789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="Geob_0639"
FT                   /product="flagellar basal body stator protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19004"
FT                   /db_xref="GOA:B9M0G7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0G7"
FT                   /protein_id="ACM19004.1"
FT                   /translation="MARKKKPEKEANMERWMVSYADFITLLFAVFVTLYAMSQTDKKKA
FT                   EEVVESLRESFGYSKSSSSPKPRVIDSGNINIIPNMRPQSLPQKAVKSGKTKSHAEEKD
FT                   FKAVKAAIEAYLLKTGAQDKVSVEINRRGLVVSLKEAGFFDSGSAIVQQSAYSLLAHVA
FT                   ESLVNYTNPVRVEGHTDNVPINSRTFPSNWELSTARATNLVQYLIKYYEFEPEKISATG
FT                   FGEYRPVADNTTVDGRSKNRRVDIVLLSVESERGEP"
FT   gene            complement(703890..704696)
FT                   /locus_tag="Geob_0640"
FT   CDS_pept        complement(703890..704696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0640"
FT                   /product="PilZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19005"
FT                   /db_xref="GOA:B9M0G8"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR040638"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0G8"
FT                   /protein_id="ACM19005.1"
FT                   /translation="MTATTVKYEDHFKPDQQINAAVRLLDKKLLESNAIVTAINSDLLS
FT                   IELIGDGLPDSSEVEIGTEFYVTYWTGWAHYRCNGRLEKVDSGNKLQAKLVGPIIEQQR
FT                   RDYFRLDLVMPVEYRVLKNQPLSIVEEEWNAERGRCLSLPELQLEPFGDGFKVVEWRDG
FT                   EDLLPMEMNLSGGGIRLKLPEAVAPGTLMGIDLFLPLVPSRIIRTVAEVVRCNEITLRW
FT                   EKGTQYRVATRFIHINERERETIISFIFSEQRRLLQLSQDRIVPIR"
FT   gene            704950..707685
FT                   /locus_tag="Geob_0641"
FT   CDS_pept        704950..707685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0641"
FT                   /product="glycosyltransferase, putative, TPR
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19006"
FT                   /db_xref="GOA:B9M0G9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0G9"
FT                   /protein_id="ACM19006.1"
FT                   /translation="MKVSMPSGSAHGWGIAGEYLAREIIKLPPVDGVTLHCIGGVDLKP
FT                   LDPQAWDRINIGYTFFEDDIEVLRHTRRAAAEWDHIVAGSSWCEQHLRIGGIRNTSTIL
FT                   QGIDPANFSPSPPRPDDGRFIVFSGGKFESRKSQDIVIAAMKILMARHSDLWLSCAWYN
FT                   HWPFSMATMQGSRYISYRHLEEDCMGLLRRTLQENGLPMDRIILHPLLDNARMRNVYVD
FT                   TDMGLFPNRCEGGNNMVMSEYMACGRTAVASDASGQGDIITTENAFPLTSYEPLLISRS
FT                   GVPSAIWFEPSLEEVVEKLGFALLNRGEIRARSIRAGEDLQRLRWDRAAEQFHGLACKL
FT                   AGKGRESLTVRVHQASLGEPLTADDYLREGRALLDSGNPALAEARLLKARALNPFSAEV
FT                   YNCLAGAMDAQERHQQALGYYQKALSLLPDSAVINFNMGNTMKKLERPIEATAYYREAL
FT                   KTDPDFAEAHYNLGLVLQGQRLFDQALDEYERALALRPAHAGTLHNMGDILQDRGQVEQ
FT                   AVACYDKVLALDPQLANTHNSLGNALLCQEKYPEAIAAYERAMAIDPDNPMIHNNLGAA
FT                   FKDKGDLDQAIACHRRALALEPGNADAHWNLSLACLMKGAFMEGWQGYEWRWEKSIPVP
FT                   RRELPLPLWDGEPLGGKKIILVSEQGAGDVFQFVRYAALVAGRGGTVLIECQSAALKPV
FT                   LERVPMVREAFVAGETLPQADCYFPLMSLPLLFGTTLESIPADVPYLILDPARLESFQR
FT                   RMGGDGGLKVGIVWAGRQNLVRNRKRTCGLEVFAPLAEIPGVFVYSLQIGPDADQATPW
FT                   VAQGKLVDLTPHIRDFADTAALISNLDLVVTIDTSVAHLAGALARPVWTLLHYAPDWRW
FT                   MLERSDSPWYPTMRLFRQKQPGDWQGVMVEVKKALQEMLP"
FT   gene            707682..710066
FT                   /locus_tag="Geob_0642"
FT   CDS_pept        707682..710066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0642"
FT                   /product="glycosyltransferase, exostosin-like, TPR
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19007"
FT                   /db_xref="GOA:B9M0H0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="InterPro:IPR040911"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0H0"
FT                   /protein_id="ACM19007.1"
FT                   /translation="MTSAEDFYRSGNANATRGDYDGAIAAYLQALQLAPRQPAVLNNLG
FT                   LAYVESGRLDEAKVIFERFIALDPENAEPWNNLAVVVQMAGDLETATELFRKALALNPQ
FT                   YAEAWYNLGFALEEQRNWSDAITCNRRAILVRTDYAEAHFNLALLHLLTGKFHEGWQEY
FT                   EWRWVTKGFSTPRRHFAQPQWDGSPFPGRTLLVHMEQGFGDIIQFIRYVPMVAGRGGGV
FT                   IVAGPPELRGLLASVDGVDRVLVDGDTWPEFHLHIPLMSLPLVLGTELETIPGQVPYLQ
FT                   PEQQKVKDWALRLESDRGFKVGLVWSGRLNTEKNRRRACPLEYFASLFGIAGISWYTLQ
FT                   MGEGREQLETVPFGGQIRDLTSLIKDFGDTAAFIANLDLIISIDTSVCHLAGALGKEVW
FT                   TLLCRSADWRWLLDRNDSPWYPAMRLFRQEQTGDWSSVMARVEDALQECAAPRLKLYFY
FT                   RSGIDYLLPPLLHAMKIPLLYDDPQGRQEVEGTRYDVLSIWQEDELGKPVSPCRDSYDE
FT                   VDSPADADFIVFPERIDELLENFGGEGTARFLHQLPHFATHEEKHVFLTVHDNSDPLGI
FT                   KSVIFRTSASAFNADPCTYVFPYRTEDFSRYLHYDLARMDYHTGFIGFTGSSPIRSLLM
FT                   DSIMREKRLVSYLDTSERFYGHFPENELPRRRARFLEYMARSLTVLCPRGTGENTFRFF
FT                   EAMSMGRIPVLVGDGCILPFASHIDYDAFIMRIPEQDVYRAGQLLYEWISRQSETELLG
FT                   RCRRARQVWEKYCRYSRISPMLLGMLQRHKQRLVKDERKKM"
FT   gene            710248..711063
FT                   /gene="fliC"
FT                   /locus_tag="Geob_0643"
FT   CDS_pept        710248..711063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliC"
FT                   /locus_tag="Geob_0643"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19008"
FT                   /db_xref="GOA:B9M0H1"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0H1"
FT                   /protein_id="ACM19008.1"
FT                   /translation="MAINDVSLTAGMRSNLLTMQKTSDLLNRTQDRLSSGKKVNSALDN
FT                   PTNYFAAQSYSQRAGDLDARKDGMSEAVQQVKAANAGITAITSLIESAKGLATSALSTS
FT                   NTTTRASLAGQYDTLRQQIDKLASDSSYGGKNLLQNQNITVNFNEDATSTLSVSGFSAN
FT                   STGLAMSANSNSWSADTDISSDSGKMDSAITTLRSKTQTLSANLNIITTRQDFTSSMIN
FT                   TLSTGADNLTLADMNQEGANMLMLQTRQSLGTTALSLSSQAAQSILRLF"
FT   gene            711130..711807
FT                   /locus_tag="Geob_0644"
FT   CDS_pept        711130..711807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19009"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0H2"
FT                   /protein_id="ACM19009.1"
FT                   /translation="MAIQPINNDPVLSNLTRTTATGQTVDAQNGMLKKNNAAGDSVAFV
FT                   ASGEAKSEFARINSTKEAIAVAARAIHAADEVMDAVGKNLSKMKESLETIVKNYPPFPH
FT                   GSDERIKLLMSYNSLRKQIDDLTMPPPPPDGTEYAKIVGDPAIAGTSGINVTNEKGDPV
FT                   KINAQEVHTGPTGLDLPILPDIPGDDATDDQIYEALGKLDTAVKTLYERQSGLAADAQK
FT                   LLA"
FT   gene            711832..712221
FT                   /gene="flbT"
FT                   /locus_tag="Geob_0645"
FT   CDS_pept        711832..712221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbT"
FT                   /locus_tag="Geob_0645"
FT                   /product="flagellar biogenesis repressor FlbT"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19010"
FT                   /db_xref="GOA:B9M0H3"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0H3"
FT                   /protein_id="ACM19010.1"
FT                   /translation="MALKISLKPNERMIIGGAVIRNGGKASEFHVENKVPILREKDILG
FT                   EQDATTPCRNLYLVIQLMYIDEVNLSTYNNTYWELVKALVDAAPSMTPTLDSISECIVG
FT                   GNYYQALKLTRDLIDYEEELIRHAG"
FT   gene            712211..712597
FT                   /gene="flaF"
FT                   /locus_tag="Geob_0646"
FT   CDS_pept        712211..712597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaF"
FT                   /locus_tag="Geob_0646"
FT                   /product="flagellar biogenesis regulator FlaF"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19011"
FT                   /db_xref="GOA:B9M0H4"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0H4"
FT                   /protein_id="ACM19011.1"
FT                   /translation="MLANQIKEYANIQKEALTGRELEASVLTRAAQMLKHCQDNWNAPD
FT                   REKKLQEALKFNQKIWSFFQAELSVPDNPLPKKLREDILSLSLFVDKRIFEIIAFPESE
FT                   KLTIVIDINMNIAAGLRTGPGDDI"
FT   gene            712672..713457
FT                   /locus_tag="Geob_0647"
FT   CDS_pept        712672..713457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19012"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0H5"
FT                   /protein_id="ACM19012.1"
FT                   /translation="MKKNLVMGAVSGYDFSLISPFVISLRKTGFTGDICFFASGISDRT
FT                   KHYLRLLDVQVVTLPQEEQFAGMAISITRFMLYQAFLARQDMDYEGVMLTDVRDVVFQV
FT                   DPFAFDFSGKVCCFLEAEEKRIIDCPMNCEWLRSKFGDPVLAEIGHNPISCVGTIIGGK
FT                   SQVQGYLKVMLEHLTPPFTIPGDDTAVHNYLIHTRQIPDIAIFANEDGPVMTVGYKSSD
FT                   SMSFDGAGFLSNTAGKIVNTIHQYDRHPQLLEKLSFLYA"
FT   gene            complement(713448..715313)
FT                   /locus_tag="Geob_0648"
FT   CDS_pept        complement(713448..715313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0648"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19013"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0H6"
FT                   /protein_id="ACM19013.1"
FT                   /translation="MTTAETTYKYIRILINKGMIAEAEELLEQVLAESPEHLDALLSLG
FT                   VILAHRGDTTRAETCFRQIVAHTPHAQGFFHLANLLCNQGKTADAETLYRQALTLEPGF
FT                   SQALNNLGSLCRNQGRLEEAAGYFRQALALDPDYLTAKVNLGIVLRLLLSFSDAAALFE
FT                   EIIEAHPECAAAYFNLGNTLLSMGDAEAAVTAYRKALSCEPDNMGAFDNLLIAMAFSPT
FT                   VDASQLYDEHRRFTTKFATPLKNQIKLHGNRADPNRRLKIGYVSADFRLHAVAYFIEPV
FT                   LAAHGRENFEIHCYANVGTPDRITDHTMSLADQWRNIYGMSDAMVAELIREDGIDILVD
FT                   LAGHTSGHRLLVFARKPAPIQVEFIGYPNTSGLDTIDYLITDEITSPEKLPQLFSEEPL
FT                   RLPETRYCFSPVIATPEVSILPMQQNGSITLGCFNNVAKINQRVITLWAKILHTLRDSR
FT                   LLLKNRLFDDPGCARTFQDRFTHAGIDPGRIMLRGHSSHMETLREYSLVDIALDTFPFP
FT                   GGTTTCEALWMGVPVVAMSGVTFAERQAISLLANAGHREWIATSEEEYMEIVLDLAADP
FT                   VRLAQVRSNLRHELQSSPLMDAPRFVALLEDAYRRMWLKWCRNQA"
FT   gene            complement(715310..717370)
FT                   /locus_tag="Geob_0649"
FT   CDS_pept        complement(715310..717370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0649"
FT                   /product="SAM-dependent methyltransferase, TPR
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19014"
FT                   /db_xref="GOA:B9M0H7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0H7"
FT                   /protein_id="ACM19014.1"
FT                   /translation="MNTASEETDNLPATALVRFSLATMLMEKALLDEAAKSLAAALDIA
FT                   PGFAAAHDKLGLILQCLGRREEAIAHYECAAKLSPGRPEFRNNLVSALAEQARHLLTVK
FT                   DLAGAENTVIQALELTPDLVDLHQTLGEIYLARGEQQKAIGAFCTAVHYGPGNVRLWQS
FT                   LLAHCQSSLSGKQLAALEKDLLTAYEQSPNESLADIATHLILARPEVSTLLSAAADNQQ
FT                   LLTLMFEGKLWSLLDDDLFLRVMESSLLCNWELEQLLTVLRKNLLLSHPTDTCYPADLA
FT                   GSIPFLCSLAQLCFSNEYVFYVTGEEQTAVRQLQVFICDCIGSGSKIPLLRLVLLACYQ
FT                   PLHRLPECELLTSLVDAEDHHEMLQKVFLHQVVEPLAEQRMKCMIPAISPIDALSQQVQ
FT                   DQYEENPYPRWFSMALPVPLPMDKVFSKLFPHLVIPQILNNQQPAILIAGCGTGRHAIT
FT                   TAARFEGARVTAMDLSKASLAYAMRKAEEFGCANITFVQGDILNLDHTEQDFDIIECSG
FT                   VLHHMASPEEGWRKLLRRLKPGGLMGVALYSTIARRHIAAARNFIAGRNYHPAPDDIRR
FT                   CRREIASFTDDQLIRKVMASRDFYSTSACRDLIFHVQEHTFDLLQIAAIIKDFDLAFLG
FT                   FQLDAQTLLRYSNRFPDDSTHNSLHLWHLFEQENPDTFGGMYQFWVQRSGK"
FT   gene            complement(717367..717990)
FT                   /locus_tag="Geob_0650"
FT   CDS_pept        complement(717367..717990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0650"
FT                   /product="SAM-dependent methyltransferase, type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19015"
FT                   /db_xref="GOA:B9M0H8"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0H8"
FT                   /protein_id="ACM19015.1"
FT                   /translation="MELSFAGFARLHDFLKKLENDTYPELPTQLHTEITNQQLNNLLAK
FT                   YPLQQGAAILDVGCGQGPALDIFREKGFAPLGITLNDEDIEACRKKGHQVTKMEQSFLD
FT                   YLPETFDLIWARHVIEHSIFPHFTLAEFARVLKAGGLLYLEVPAPETACHHENNQNHYS
FT                   VLNRGMWVSLLGRNGLQPLEQVNFNFTTGLGPDEYWGFICKKQA"
FT   gene            complement(717991..727026)
FT                   /locus_tag="Geob_0651"
FT   CDS_pept        complement(717991..727026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0651"
FT                   /product="SAM-dependent methyltransferase and
FT                   glycosyltransferase, TPR domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19016"
FT                   /db_xref="GOA:B9M0H9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0H9"
FT                   /protein_id="ACM19016.1"
FT                   /translation="MDKNYQIYMPKRSGGSSTSVPVLIDDHAEIINCFVSPTYKGTYHL
FT                   CFDYRNSENEIHQSMVTLAYEQQLTGLNITDQHGNDLTISRESLYSFFANGYDFAESSR
FT                   EYFGNLAATSAKPAIAFTMRHSSIKGGGPITVYRYINWLAELGYKVSVYSDDDPPDWVE
FT                   LKASFYKIIHDNGRYGAITEPIVIVYSLLELPQVLRYCHTRGKRIFHLCQGLEEFHVTK
FT                   PPQGPLPKAAPIFHLLNSLPVGRIVVSPHLHHYFQDHYQQQTFPVFNGIDLRIFSPAEK
FT                   ETNANCRTILISGDPQHPLKGIGVAREAVAILAKKCPEWDLTLSIVCGQQVKQPETQPV
FT                   GYREKVLSGLQPEEMSSQYHEADIYLNASWYEGFGLPSLEAMACGTPVVQVANHGLEGI
FT                   IEDGRNCLLVAEQDAAPIAEALERLLTDHDLRQRIIAGGIATAAQYGLSRQYGMLVAEF
FT                   QEITGRQPDAHLTNKKMKELEAAMDRNPKEPAQDSGLLFSILVPSYNQAGFLPATLDSI
FT                   LAQDYPHWEALVVNDGSTDETAAVMARYAEKDPRIRTFHKENGGVSSALNEGLKHARGE
FT                   WICWLSSDDLFEPDKLSLHAATAVKHPEVRFMHTNYFLLYDQTGEKVSVERNGEELNDP
FT                   NRQLVNFFEANQVNGISIAIHRQVFDQLGHFDEKLRNGQDFDMWLRIVSRYQPLYLDER
FT                   TVVTRIHPAQGTSLSVEAGIYDSGRSCLDFLNANGFPALFPRTDLADTRQALKAVQFVL
FT                   HILANPGSLVNLCGYGPALLERMHEWLTGQADALLKTQLSAHLPDIIQSFQQEIYPEEV
FT                   RNAFRTLPASLAAPVPYQKHDAVDDLEKKAECLDRENRFAEASALRKYLARTTGKETAV
FT                   ASNVPFWQKLQEDGYFENHPLYGKEHDGLKLFGDDDNFVRRFLPLTPEMTVVVIGCGYG
FT                   RESALLARHVKRVYGIDVSRTLLDKTERFMAEQGIANFTAVLAEEWEKVIPPGVDLVYS
FT                   IVVFQHLTKDLVRNYVNGLAGKLAPGGRFLCQFCDAQGGSEDAHLATYEPNVRWAIDEI
FT                   EDLIHSAGLQKVTIEEQKVTEGVRWYWAFFGDSVTAVSPALSASAEGDTVEAPEAVYSA
FT                   AVSLANEGNVAEAQNRLEHLLRHHPKFVLAHNDLGVLYSNLGETEKALAHFEQATQLEP
FT                   TNATFQKNLADFYQVVLGRTEDALQIYVKLLAMHPKDLEVLAGLGKICVSVGKHDDARH
FT                   FFTRALEIEPWNLEIRKSLEALEEFRRQPEQIGPAATVEEMYGKAVDLAGRNLTAEAIA
FT                   ALENLLQHFPQFALAHNDLGVLYGQQGQQDQAVAHHEEAARLEPGNGTFLKNLADFYHM
FT                   VMGRTEQALQIYVKLLAVQPKDLEVLMALGNLCVAIGKLDDGECFFTRAMEIEPWNREV
FT                   RESLAAVKEYRETAQADMGVAESAYAEIQALPEDQVEQKIAALEKLLCRHPNFATAHND
FT                   LGVLYTNQGAMEKALEHQEEATRLEPTNAVFQKNLADFYHIVLGRTEEALQIYVKLLAV
FT                   KPKDLEVLTALGNLCLSLDRLDDAACFFTRALEVEPWNAEIRQSLQALQNFARQEATPA
FT                   ASAAEPIESSTASAPSDLPAEILALYEKKQQVLNNSEKQPIDIIFLTYNRRDYFEQTIK
FT                   TLIERTRYPYRIIVVDNHSREDFQGYLQKTAILYDHLVFNDDNYFTVAFQRGIELANSD
FT                   PYVVSDPDILVPDLQGKCWLERMLDLHREYPEMGLIGLTLDPVNKPASLPDVILGEKTV
FT                   YNDKITLANVGTWMQCIKRKYFDGKYTTDWEACEQVRRNGGKVGYAREFIAYHLGYDEE
FT                   RDHPDHLVEKYHLFKDKFGSDLYSMYTDSEEILARMGEKPAAYYGFARPEVQEMVNPAA
FT                   KRILDVGCAAGATAGELKAKLKAEVWGIEMLPAAAKLAEQKLDKVCAGPVEEILPTLPD
FT                   GYFDTIIFADVLEHLVDPTAVLVAAKGKLAAGGEIVASIPNVRHWSVVRGLLEGKWDYA
FT                   DEGILDRTHLRFFTRQGVMELFGNAGFTPTTMSATVLNDVQVPPQIPKALAEAGLDVST
FT                   LADEGRHFQYLLRAVPQQARQAKPVSFPPAKEKKTAQAKVAAKEDHLTSIIILTLNQLE
FT                   YTRECLSSIQKHTPEKHEIIFVDNGSKDGTVKWLRQEMKSHKNYRLIENKKNLGFAKGC
FT                   NQGMAAAKGEYLLLLNNDVVVTEGWLTGMRECLEASADGIVAPMTNNIAGPQQLLSVPY
FT                   ANMDEMQAFAAGFRSAHRHRRIPVKLVVGFCMLFRRSLADQVGMLDEAFALGNFEDDDF
FT                   CLRASLAGLQSVIAGDVFIHHHGSRTFEGNRIDFNAAMAVNRKVFDRKWDMTKMDKGEA
FT                   FRLASHNALIKGEESFHKGDLDQAVKVLIEEGIKFAPADRRPYRLLASFLIEAKRFSDA
FT                   LAIIREMPGHGGDAESLVMEGVCREGLEQLAEAEGCADNALALESSFAQALNLKGVLAF
FT                   RAGDRSRAEELFTSAMAADPGFGEACTNLGVLRWSAQAHGEALELLEKGFMLNPTVSDA
FT                   MERYHSAISASEQFSRGEAVFREARAIFPHSRLITFKLIDLLLNQQKYEEAMAEIEQAM
FT                   VGFGADDGIIDAALHVRKTLDGQKERPQAGAPGSISLCMIAKDEAPHLARALASVKPAV
FT                   SEMIVVDTGSTDRTKDIARAFGASVFDLPWPGSFALARNESLAKASGTWVLVMDADEVI
FT                   SCRDHGLLRHLASGTPAGYTVCQKNYTCLAGSKGFLSHDGRYPEEEAGIGFQPNFIVRI
FT                   FPNDSRIRFENAVHELVEPSLERAGLPVKEADLSIHHYGKLDKEKLRGKWEFYYQLGKK
FT                   KLAEHPRDVQALTELAIQAAELGKHDEALELWGQVVEQEPDSANAHFNMGHAYLCQGRY
FT                   GEALCSSKRAVALDPHAKEAVFNYGCCELYSGEIVSVATLLENLLVNHPDYPPAIALLA
FT                   SIHFCLGEQDKGRQRLQQVREMNYDCGDFLFQHAKVLYTQGRFDWSRRLLEAAIDNGAV
FT                   TAEITHLLTECTQRAA"
FT   gene            complement(727046..728422)
FT                   /locus_tag="Geob_0652"
FT   CDS_pept        complement(727046..728422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0652"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19017"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0I0"
FT                   /protein_id="ACM19017.1"
FT                   /translation="MAESEITSMLPMLRQADLLLNKGLVEEAVEFYIRIIGMAPHQMDA
FT                   YARLGHAYHLIGSIKEAAAAYLKVLSFDDVDAGTYCGIAEFIRTGEKLKTEDESTYNRL
FT                   VELFIDHMLQQTVRGSADTSKLVVTWDFRSQPYSIGDLILLQQAANCICLAHGITQART
FT                   YLLSDRENPARPSFRALGVNGENYLDHIIRLLPVFLLCNEAPALTLEHDEDTALQSMAA
FT                   PDAVAWPTVPLLKSMLDLNLPTFRLLNMFYEQQKMLPEFRIRGSLARWARNFIEENARG
FT                   YIPVAVQMRKTKSYNLSRNSNIEAWSEFFSHCHSHLPVKFFVICAASEVDEQLRAHENV
FT                   VIAKNSRTTVDQDLALIKECAAFMGISSGPATVAFFGNRPYSIVNAHLEQSLVPLLKKE
FT                   PWGYSFTYAKKNQRIIASGNETCELLVRELGILLKDLTSDGERNIDRLLSDKDTDLRLH
FT                   "
FT   gene            complement(728409..729524)
FT                   /locus_tag="Geob_0653"
FT   CDS_pept        complement(728409..729524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0653"
FT                   /product="SAM-dependent methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19018"
FT                   /db_xref="GOA:B9M0I1"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0I1"
FT                   /protein_id="ACM19018.1"
FT                   /translation="MTGKTMPSFLNSLKDIPAGARLCLYGVGEGCLHLLQKLQSTRPDV
FT                   VVIALIDDARKNLTLTIPLVTLEEIDRLSCDLILVTSVYWIDICQKLKTAGCTEFVVAA
FT                   PDLLFEHLIFDDSELKLWARQIAQTSALLSDAQQKALYNLVVTSRTRQPEYQQRLHDYF
FT                   HAHRSSMGREYLEFINSGDLQTIIEGGVFDGADTREFARCLCPGGTVHGFDPNLATPSP
FT                   LSSSQISLYPMALWSSRTFLPFFSNRDNPPGARIVTDMAEQDEVQQVPAISIDEFTTEQ
FT                   ALERVDLIKLDVEGAEAEVLQGAIATLKRHRPQLAVCIYHKKQHLFQVPLLLNSMLHGY
FT                   HYYLGHYSPTFWDTVWYAVPEEKDYRHHGRK"
FT   gene            complement(729521..730519)
FT                   /locus_tag="Geob_0654"
FT   CDS_pept        complement(729521..730519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Geob_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Geob_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACM19019"
FT                   /db_xref="UniProtKB/TrEMBL:B9M0I2"
FT                   /protein_id="ACM19019.1"
FT                   /translation="MRYDLITILWGPGYTGYFLEIVLPSHLAKGNLEA