(data stored in ACNUC7421 zone)

EMBL: CP001391

ID   CP001391; SV 1; circular; genomic DNA; STD; PRO; 1445873 BP.
XX
AC   CP001391;
XX
PR   Project:PRJNA33273;
XX
DT   25-MAR-2009 (Rel. 100, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Wolbachia sp. wRi, complete genome.
XX
KW   .
XX
OS   Wolbachia sp. wRi
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;
OC   Anaplasmataceae; Wolbachieae; Wolbachia; unclassified Wolbachia.
XX
RN   [1]
RP   1-1445873
RX   DOI; 10.1073/pnas.0810753106.
RX   PUBMED; 19307581.
RA   Klasson L., Westberg J., Sapountzis P., Naslund K., Lutnaes Y., Darby A.C.,
RA   Veneti Z., Chen L., Braig H.R., Garrett R., Bourtzis K., Andersson S.G.;
RT   "The mosaic genome structure of the Wolbachia wRi strain infecting
RT   Drosophila simulans";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(14):5725-5730(2009).
XX
RN   [2]
RP   1-1445873
RA   Klasson L., Westberg J., Sapountzis P., Naslund K., Lutnaes Y., Darby A.C.,
RA   Veneti Z., Chen L., Braig H.R., Garrett R., Bourtzis K., Andersson S.G.E.;
RT   ;
RL   Submitted (21-JAN-2009) to the INSDC.
RL   Department of Molecular Evolution, Uppsala University, Norbyvagen 18C,
RL   Uppsala 75236, Sweden
XX
DR   MD5; 5d61208c69c66080041b2c06aa38f420.
DR   BioSample; SAMN02603205.
DR   EnsemblGenomes-Gn; EBG00001134130.
DR   EnsemblGenomes-Gn; EBG00001134131.
DR   EnsemblGenomes-Gn; EBG00001134132.
DR   EnsemblGenomes-Gn; EBG00001134133.
DR   EnsemblGenomes-Gn; EBG00001134134.
DR   EnsemblGenomes-Gn; EBG00001134135.
DR   EnsemblGenomes-Gn; EBG00001134136.
DR   EnsemblGenomes-Gn; EBG00001134137.
DR   EnsemblGenomes-Gn; EBG00001134138.
DR   EnsemblGenomes-Gn; EBG00001134139.
DR   EnsemblGenomes-Gn; EBG00001134140.
DR   EnsemblGenomes-Gn; EBG00001134141.
DR   EnsemblGenomes-Gn; EBG00001134142.
DR   EnsemblGenomes-Gn; EBG00001134143.
DR   EnsemblGenomes-Gn; EBG00001134144.
DR   EnsemblGenomes-Gn; EBG00001134145.
DR   EnsemblGenomes-Gn; EBG00001134146.
DR   EnsemblGenomes-Gn; EBG00001134147.
DR   EnsemblGenomes-Gn; EBG00001134148.
DR   EnsemblGenomes-Gn; EBG00001134149.
DR   EnsemblGenomes-Gn; EBG00001134150.
DR   EnsemblGenomes-Gn; EBG00001134151.
DR   EnsemblGenomes-Gn; EBG00001134152.
DR   EnsemblGenomes-Gn; EBG00001134153.
DR   EnsemblGenomes-Gn; EBG00001134154.
DR   EnsemblGenomes-Gn; EBG00001134155.
DR   EnsemblGenomes-Gn; EBG00001134156.
DR   EnsemblGenomes-Gn; EBG00001134157.
DR   EnsemblGenomes-Gn; EBG00001134158.
DR   EnsemblGenomes-Gn; EBG00001134159.
DR   EnsemblGenomes-Gn; EBG00001134160.
DR   EnsemblGenomes-Gn; EBG00001134161.
DR   EnsemblGenomes-Gn; EBG00001134162.
DR   EnsemblGenomes-Gn; EBG00001134163.
DR   EnsemblGenomes-Gn; EBG00001134164.
DR   EnsemblGenomes-Gn; EBG00001134165.
DR   EnsemblGenomes-Gn; EBG00001134166.
DR   EnsemblGenomes-Gn; EBG00001134167.
DR   EnsemblGenomes-Gn; EBG00001134168.
DR   EnsemblGenomes-Gn; EBG00001134169.
DR   EnsemblGenomes-Gn; EBG00001134170.
DR   EnsemblGenomes-Gn; EBG00001134171.
DR   EnsemblGenomes-Gn; EBG00001134172.
DR   EnsemblGenomes-Gn; WRi_n01240.
DR   EnsemblGenomes-Gn; WRi_n07430.
DR   EnsemblGenomes-Gn; WRi_r01850.
DR   EnsemblGenomes-Gn; WRi_r01860.
DR   EnsemblGenomes-Gn; WRi_r11990.
DR   EnsemblGenomes-Gn; WRi_t00030.
DR   EnsemblGenomes-Gn; WRi_t00160.
DR   EnsemblGenomes-Gn; WRi_t00350.
DR   EnsemblGenomes-Gn; WRi_t00990.
DR   EnsemblGenomes-Gn; WRi_t01160.
DR   EnsemblGenomes-Gn; WRi_t01600.
DR   EnsemblGenomes-Gn; WRi_t03380.
DR   EnsemblGenomes-Gn; WRi_t03470.
DR   EnsemblGenomes-Gn; WRi_t04010.
DR   EnsemblGenomes-Gn; WRi_t04320.
DR   EnsemblGenomes-Gn; WRi_t04710.
DR   EnsemblGenomes-Gn; WRi_t05220.
DR   EnsemblGenomes-Gn; WRi_t05230.
DR   EnsemblGenomes-Gn; WRi_t06170.
DR   EnsemblGenomes-Gn; WRi_t06270.
DR   EnsemblGenomes-Gn; WRi_t07290.
DR   EnsemblGenomes-Gn; WRi_t07930.
DR   EnsemblGenomes-Gn; WRi_t08320.
DR   EnsemblGenomes-Gn; WRi_t08650.
DR   EnsemblGenomes-Gn; WRi_t08680.
DR   EnsemblGenomes-Gn; WRi_t09220.
DR   EnsemblGenomes-Gn; WRi_t09230.
DR   EnsemblGenomes-Gn; WRi_t09310.
DR   EnsemblGenomes-Gn; WRi_t09470.
DR   EnsemblGenomes-Gn; WRi_t09610.
DR   EnsemblGenomes-Gn; WRi_t10750.
DR   EnsemblGenomes-Gn; WRi_t11310.
DR   EnsemblGenomes-Gn; WRi_t11350.
DR   EnsemblGenomes-Gn; WRi_t11810.
DR   EnsemblGenomes-Gn; WRi_t11900.
DR   EnsemblGenomes-Gn; WRi_t11920.
DR   EnsemblGenomes-Gn; WRi_t12140.
DR   EnsemblGenomes-Gn; WRi_t12360.
DR   EnsemblGenomes-Gn; WRi_t13030.
DR   EnsemblGenomes-Tr; EBT00001725441.
DR   EnsemblGenomes-Tr; EBT00001725442.
DR   EnsemblGenomes-Tr; EBT00001725443.
DR   EnsemblGenomes-Tr; EBT00001725444.
DR   EnsemblGenomes-Tr; EBT00001725445.
DR   EnsemblGenomes-Tr; EBT00001725446.
DR   EnsemblGenomes-Tr; EBT00001725447.
DR   EnsemblGenomes-Tr; EBT00001725448.
DR   EnsemblGenomes-Tr; EBT00001725449.
DR   EnsemblGenomes-Tr; EBT00001725450.
DR   EnsemblGenomes-Tr; EBT00001725451.
DR   EnsemblGenomes-Tr; EBT00001725452.
DR   EnsemblGenomes-Tr; EBT00001725453.
DR   EnsemblGenomes-Tr; EBT00001725454.
DR   EnsemblGenomes-Tr; EBT00001725455.
DR   EnsemblGenomes-Tr; EBT00001725456.
DR   EnsemblGenomes-Tr; EBT00001725457.
DR   EnsemblGenomes-Tr; EBT00001725458.
DR   EnsemblGenomes-Tr; EBT00001725459.
DR   EnsemblGenomes-Tr; EBT00001725460.
DR   EnsemblGenomes-Tr; EBT00001725461.
DR   EnsemblGenomes-Tr; EBT00001725462.
DR   EnsemblGenomes-Tr; EBT00001725463.
DR   EnsemblGenomes-Tr; EBT00001725464.
DR   EnsemblGenomes-Tr; EBT00001725465.
DR   EnsemblGenomes-Tr; EBT00001725466.
DR   EnsemblGenomes-Tr; EBT00001725467.
DR   EnsemblGenomes-Tr; EBT00001725468.
DR   EnsemblGenomes-Tr; EBT00001725469.
DR   EnsemblGenomes-Tr; EBT00001725470.
DR   EnsemblGenomes-Tr; EBT00001725471.
DR   EnsemblGenomes-Tr; EBT00001725472.
DR   EnsemblGenomes-Tr; EBT00001725473.
DR   EnsemblGenomes-Tr; EBT00001725474.
DR   EnsemblGenomes-Tr; EBT00001725475.
DR   EnsemblGenomes-Tr; EBT00001725476.
DR   EnsemblGenomes-Tr; EBT00001725477.
DR   EnsemblGenomes-Tr; EBT00001725478.
DR   EnsemblGenomes-Tr; EBT00001725479.
DR   EnsemblGenomes-Tr; EBT00001725480.
DR   EnsemblGenomes-Tr; EBT00001725481.
DR   EnsemblGenomes-Tr; EBT00001725482.
DR   EnsemblGenomes-Tr; EBT00001725483.
DR   EnsemblGenomes-Tr; WRi_n01240-1.
DR   EnsemblGenomes-Tr; WRi_n07430-1.
DR   EnsemblGenomes-Tr; WRi_r01850-1.
DR   EnsemblGenomes-Tr; WRi_r01860-1.
DR   EnsemblGenomes-Tr; WRi_r11990-1.
DR   EnsemblGenomes-Tr; WRi_t00030-1.
DR   EnsemblGenomes-Tr; WRi_t00160-1.
DR   EnsemblGenomes-Tr; WRi_t00350-1.
DR   EnsemblGenomes-Tr; WRi_t00990-1.
DR   EnsemblGenomes-Tr; WRi_t01160-1.
DR   EnsemblGenomes-Tr; WRi_t01600-1.
DR   EnsemblGenomes-Tr; WRi_t03380-1.
DR   EnsemblGenomes-Tr; WRi_t03470-1.
DR   EnsemblGenomes-Tr; WRi_t04010-1.
DR   EnsemblGenomes-Tr; WRi_t04320-1.
DR   EnsemblGenomes-Tr; WRi_t04710-1.
DR   EnsemblGenomes-Tr; WRi_t05220-1.
DR   EnsemblGenomes-Tr; WRi_t05230-1.
DR   EnsemblGenomes-Tr; WRi_t06170-1.
DR   EnsemblGenomes-Tr; WRi_t06270-1.
DR   EnsemblGenomes-Tr; WRi_t07290-1.
DR   EnsemblGenomes-Tr; WRi_t07930-1.
DR   EnsemblGenomes-Tr; WRi_t08320-1.
DR   EnsemblGenomes-Tr; WRi_t08650-1.
DR   EnsemblGenomes-Tr; WRi_t08680-1.
DR   EnsemblGenomes-Tr; WRi_t09220-1.
DR   EnsemblGenomes-Tr; WRi_t09230-1.
DR   EnsemblGenomes-Tr; WRi_t09310-1.
DR   EnsemblGenomes-Tr; WRi_t09470-1.
DR   EnsemblGenomes-Tr; WRi_t09610-1.
DR   EnsemblGenomes-Tr; WRi_t10750-1.
DR   EnsemblGenomes-Tr; WRi_t11310-1.
DR   EnsemblGenomes-Tr; WRi_t11350-1.
DR   EnsemblGenomes-Tr; WRi_t11810-1.
DR   EnsemblGenomes-Tr; WRi_t11900-1.
DR   EnsemblGenomes-Tr; WRi_t11920-1.
DR   EnsemblGenomes-Tr; WRi_t12140-1.
DR   EnsemblGenomes-Tr; WRi_t12360-1.
DR   EnsemblGenomes-Tr; WRi_t13030-1.
DR   EuropePMC; PMC2659715; 19307581.
DR   EuropePMC; PMC3869692; 24376534.
DR   EuropePMC; PMC3998919; 24763283.
DR   EuropePMC; PMC4201733; 25311369.
DR   EuropePMC; PMC4526672; 26244782.
DR   EuropePMC; PMC4675112; 26664808.
DR   EuropePMC; PMC5062602; 27727237.
DR   EuropePMC; PMC5100849; 27613752.
DR   EuropePMC; PMC5345876; 28245239.
DR   EuropePMC; PMC5742604; 28702705.
DR   EuropePMC; PMC5793819; 29351633.
DR   EuropePMC; PMC6293665; 30545384.
DR   EuropePMC; PMC6366345; 30729921.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; CP001391.
DR   SILVA-SSU; CP001391.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1445873
FT                   /organism="Wolbachia sp. wRi"
FT                   /host="Drosophila simulans Riverside"
FT                   /strain="wRi"
FT                   /mol_type="genomic DNA"
FT                   /note="synonym: Wolbachia endosymbiont of Drosophila
FT                   simulans"
FT                   /db_xref="taxon:66084"
FT   gene            153..1535
FT                   /gene="dnaA"
FT                   /locus_tag="WRi_000010"
FT   CDS_pept        153..1535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="WRi_000010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000010"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94873"
FT                   /db_xref="GOA:C0R531"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C0R531"
FT                   /protein_id="ACN94873.1"
FT                   /translation="MNLTSPKVSTMFFDQIITVTDHNVTWEKIQNCLYNLYGEATYNSW
FT                   LSSLKFVSSRNGEVLLSVSTRFIKEWITVHYMKKILSLWQSEDKSIRSIDIQVIEERNS
FT                   NFNVILKNREESNHNLGSPLDPRFTFDNFVVGKPNELAFTAAKRVAESIDPILGSNPLF
FT                   LYGGVGLGKTHLMHAIAWHIVNSPSAKRKVVYLSAEKFMYQYITALRSKDIMLFKEQFR
FT                   SVDVLMVDDVQFISGKDSTQEEFFHTFNALIDQNKQLVISADRSPSDLDGVEERIKSRL
FT                   GWGLVADINETTFELRLGILQAKVEQMNMYVPKDVLEFLARNIKSNIRELEGALNKVTH
FT                   TSLIGRSMTVESASETLIDLLRSNHRSVTIEEIQKKVAEFFNIKVADMQSNRRLRSLAR
FT                   PRQIAMYFAKKFTQKSLPDIGRNFGGRDHATVIHAVKQVENFIKTDSKFADEINRLKKM
FT                   FK"
FT   gene            complement(1563..2837)
FT                   /locus_tag="WRi_000020"
FT   CDS_pept        complement(1563..2837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000020"
FT                   /product="Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000020"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94874"
FT                   /db_xref="GOA:C0R532"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:C0R532"
FT                   /protein_id="ACN94874.1"
FT                   /translation="MNIANIFIFLALSLITSFHFVHAQILYTWSQVIPENKLSIRAITD
FT                   NDMCPIVYVDGEETEMLNRSSINNGDHNETVCELTVQTSAKNISIEDLRVPILPKKVNK
FT                   IAFIGDTGCRINMLFQQECNSVDSWPLKKNLDSIALHKPDLIIHVGDYHYRQTKCRNTK
FT                   KCGDIYGYNKEVWYADWFEPAKDILSQSPFLFVRGNHESCDRAYEGWFRYLDSYPFSSE
FT                   KCGNFVSSWSLDAGPMKFFIFDSSSGEDIFTTQSTIDAFERQFDKLIQNSSDKPMWFLT
FT                   HKPLWRSPKKEFLTLKSHGNLTQIEAFGDKFPSNVTTIVSGHIHIAQILLMDNVPDQII
FT                   VGNGGASLHAQDQESVYQNVEFDYLNGKNYLAHEVRNFFGFGFAILNLDDHEFTFYNQH
FT                   NKEMYSAKLTEDFKLKRIKTIVDSF"
FT   gene            3028..3112
FT                   /locus_tag="WRi_t00030"
FT   tRNA            3028..3112
FT                   /locus_tag="WRi_t00030"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUC"
FT   gene            3145..4227
FT                   /locus_tag="WRi_000040"
FT   CDS_pept        3145..4227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000040"
FT                   /product="GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000040"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94875"
FT                   /db_xref="GOA:C0R533"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:C0R533"
FT                   /protein_id="ACN94875.1"
FT                   /translation="MFIGNQSSNKVERAISEIRRGRPIVIYDESNYLLFAAAEALERDL
FT                   FNQYKLISSNVYVTLTSSKVKYISQNKEHNSKRLLVNNFDELLHLINCSKEDCIKELQC
FT                   SKTIDECAIALLKFSELLPYALVADMTFENKYEMRNWCEENDIIALDTLLVNDFQQNQS
FT                   VYEVCKTSLFLKQTQEVDIISYRTESGGREHHAIIIGNPDKDDEPLVRIHSSCYTGDLL
FT                   DSLSCDCRSQLHQAIQMIADFGSGIILYLMQDGRGIGLTNKLRAYSVQREHNLDTVDAN
FT                   RILGFEDDERSFVVAAKMLKKLNINKIQLLTNNDRKLSELESSGIEVTKCLPLIVERNK
FT                   YNDSYMETKFGKLGHKLRVF"
FT   gene            4300..4980
FT                   /locus_tag="WRi_000050"
FT   CDS_pept        4300..4980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000050"
FT                   /product="type IV secretion system protein VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000050"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94876"
FT                   /db_xref="GOA:C0R534"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C0R534"
FT                   /protein_id="ACN94876.1"
FT                   /translation="MLRFFKREKSTESLDKDINWNSNRYSTVIAQRNILLLFALILLAT
FT                   ISISILVIFKISTSSTIEPFVIEIDKKSGIVQLVDPVTVKQYSADEALNDYFISEYIKA
FT                   REVFDPYHYNYNYYTKVRLFSSPNVYNEFRNYIGSQNMDDLFNLYSDTKNEFKIRSIQK
FT                   LGNDALQVRFFVEFIRKDGSSTRKNKIVIMSYRYASLEMNDQQRYINPLGFQVISYRVD
FT                   DEYV"
FT   gene            4973..5767
FT                   /locus_tag="WRi_000060"
FT   CDS_pept        4973..5767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000060"
FT                   /product="type IV secretion system protein VirB9"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000060"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94877"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:C0R535"
FT                   /protein_id="ACN94877.1"
FT                   /translation="MYRILLVLVLLVSSNLNASINYNEPISVDSRIKTFVYSPNEVFTV
FT                   VFSQGYYSYIEFAEGEKVKNIAVGDASSWKINPYDNKLLIMPFEVSSRTNMIITTTKKR
FT                   NYIFDLISRPNYDKYPDTDAKKVDHDYSAEKDISYVVRFYYPQEEGEFDVDLDEVSLPT
FT                   QMQYTTDKLEKIIQENDTKYNYTYIDEGGNADIVPIELFDDGYLTYLKFRNNNKIPQIF
FT                   VEEEDKPCKRLLFDDYVIIKGVHKKLFMRYEDGEVEIINRSL"
FT   gene            5784..7280
FT                   /locus_tag="WRi_000070"
FT   CDS_pept        5784..7280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000070"
FT                   /product="type IV secretion system protein VirB10"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000070"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94878"
FT                   /db_xref="GOA:C0R536"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:C0R536"
FT                   /protein_id="ACN94878.1"
FT                   /translation="MNKERRNNSEDESEIENKVVTVGSNQGHRALMVMILVLLVGGVYY
FT                   FYFSPSHKEDSEVIKKEETKQNVQEFKGKLEQVPDNVIVPERIITDPLPPLPPLPTPQI
FT                   VPEIKQIKKEEEKPKETPVSNIPILPKQNFPSNNVISNLPTSFPTIGDGGYPRERRSAQ
FT                   MLTISGGSGENKAADAILSDTSVQSSKATRVGKLGLMITQGKIIDAVLETAINSDLQGM
FT                   LRAMVSRDVYAETGDTVLIPKGSRLIGSYSFDSNVAKSRVNINWNRVILPHGIDIAISS
FT                   LSTDELGRAGIAGIVDNKIVSALFSSVALAGVSISSAVIGQKASNLIDVLTAMDVVKSI
FT                   TATEIDISSLKGAIVERLEDAIKTEVGKVGDEKWKLGLRAIEKIRNAKSDQDLLRIIKE
FT                   EIVSVIKSSGASGVDAITSDNIGITLDDVRQLLRQTQKRSKSVYDEAIGKSINDFSKDM
FT                   RDIVGRYTDKKPTIYVDQGTALKVFVNQDIVFPPQAILNQ"
FT   gene            7282..8274
FT                   /locus_tag="WRi_000080"
FT   CDS_pept        7282..8274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000080"
FT                   /product="type IV secretion system protein VirB11"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000080"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94879"
FT                   /db_xref="GOA:C0R537"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R537"
FT                   /protein_id="ACN94879.1"
FT                   /translation="MNYAALDTYLEPLQGIFQEEGVNEISINKPKEVWIENRGEIRCEK
FT                   LEIFDLNHLKSLGRLIAQATEQKLSEEAPLLSATLPNGYRIQIVFPPACEPDKVVMSIR
FT                   KPSSMQLALDDYEKMGAFSETVTEATDNPVDRHLDLLLRQKKIKEFLEYAVISKKNIII
FT                   SGGTSTGKTTFTNATLRAIPAEERIITVEDAREIVLNDHPNKVHLIASKGGQGRAKVTT
FT                   QDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADSPTMALEQIKLMV
FT                   MQANLGIPPDQIIPYIKNVIDIVIQLKRTGGGKRSISEILFTRSASENA"
FT   gene            8305..10323
FT                   /gene="virD4"
FT                   /locus_tag="WRi_000090"
FT   CDS_pept        8305..10323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virD4"
FT                   /locus_tag="WRi_000090"
FT                   /product="type IV secretion system protein VirD4"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000090"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94880"
FT                   /db_xref="GOA:C0R538"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R538"
FT                   /protein_id="ACN94880.1"
FT                   /translation="MSNGNHLRNILIGGVVAFSVLEFCFYLSGILFVLFADGPDAVDFK
FT                   AINPSLTPFPQALWPTIFDHIQYCWHHPELYSLELKITLIISSALPIIVLMIILWNLRE
FT                   RIIEWRPFKKKESLHGDSQWASEKDIRKAGLRSKKGLLLGKDKRGYFISDGFQHALLFA
FT                   PTGSGKGVGFVIPNLLFWTDSVIVHDIKLENYEITSGWRERQGQKVYVWNPAQPDGISH
FT                   CYNPLQWISEKPGQMVDDVQKIANLIMPEQDFWQNEARSLFVGVVLYLLAAPEKVKSFG
FT                   EVVRTMRSDDVVYNLAVALDTMGKILHPVAYMNIAAFLQKADKERSGVVSTMNSSLELW
FT                   ANPLIDTATASSDFNILDFKKKKTTVYVGLTPDNLTRLRPLMQVFYQQATEFLCRKLPS
FT                   DDEPYGVLFLMDEFPTLGKMEQFQTGIAYFRGYRVRLFLIVQDTEQLKGIYEEAGMNSF
FT                   LSNSTYRITFAANNIETANLISQLIGNKTVQQESLNKPKFLDLNPASRSLHISEIQRAL
FT                   LLPQEVIMLPRDDQIILIESTYPIKSKKILYYSDSTFTKRLLKQTRVPTQEPYDPNKVL
FT                   SAAASKDKVNNEGNNALEGPNSVDYPAETKTEDAVYDESNEFADEDIDDEDIDDKFEDD
FT                   DDGFDDEEKSDDGFDDEEEEDEFEDEDIDDKFKNDEK"
FT   gene            10446..11297
FT                   /locus_tag="WRi_000100"
FT   CDS_pept        10446..11297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000100"
FT                   /product="surface antigen Wsp-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000100"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94881"
FT                   /db_xref="InterPro:IPR002566"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C0R539"
FT                   /protein_id="ACN94881.1"
FT                   /translation="MISKKTLAVTALALLLSQQSFASETEGFYFGSGYYGQYLNYTGEL
FT                   KAKIGDTAATATNNVSVNDRSAQNTEGQSLSKYKGDYNPPFAANVALGYTGELNGNSYR
FT                   AELEGMYSSVKVDNIGLTSGQMTISYTKDKTRPEESYGAIVNHDQIENISVMANVYHHW
FT                   KSDRFSFSPYVGVGVGATRMTMFEKSSIRPAGQLKAGLDYRINEDVNMHIGYRGFGAIG
FT                   SSEYKLDTLKWDPNHDNGKDKPKGGMAEQTGDNQVSTTIQNDFFHTHGIEAGLTFHFAS
FT                   KA"
FT   gene            complement(11460..12314)
FT                   /locus_tag="WRi_000110"
FT   CDS_pept        complement(11460..12314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000110"
FT                   /product="modification methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000110"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94882"
FT                   /db_xref="GOA:C0R540"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:C0R540"
FT                   /protein_id="ACN94882.1"
FT                   /translation="MKTISTLIQEGSELLSSHKVESPHLDCEIIMQHVLGVERSFIIVN
FT                   HADQVPMEKELLFWKLTKKRAERYPISQIIGNREFWSKNFIVNQHVLDPRPDSETLIST
FT                   VLKYYPNKKQRLKIADFGTGTGCLLISVLSEYKYAVGVGFEKSLEAYKVAYQNTKKHDL
FT                   LSRAKIFPSSWIECSDLFDLIISNPPYIKRSKLKDLQAEVQKEPKTALDGGIDGLNCYL
FT                   SIFPILRRCLKKNGFAILEIGEDQSNIDKIIPSYELAFQEYVYDLAGMKRCIVVKQCIA
FT                   PLL"
FT   gene            13428..13802
FT                   /gene="rpsL"
FT                   /locus_tag="WRi_000120"
FT   CDS_pept        13428..13802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="WRi_000120"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000120"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94883"
FT                   /db_xref="GOA:C0R541"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R541"
FT                   /protein_id="ACN94883.1"
FT                   /translation="MPTINQLIRKGRLGLTHKKKVPALGKSNPQRRGVCTKVYTTTPRK
FT                   PNSALRKVARVKISGYGEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALD
FT                   LRGVQNRKKARSKYGVKKSG"
FT   gene            13808..14287
FT                   /gene="rpsG"
FT                   /locus_tag="WRi_000130"
FT   CDS_pept        13808..14287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="WRi_000130"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000130"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94884"
FT                   /db_xref="GOA:C0R542"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R542"
FT                   /protein_id="ACN94884.1"
FT                   /translation="MARRNKAKKREISPDSRYGSVLLMRFINTIMKCGKKSTAEKIIYD
FT                   ALSLAEKKIGEGGLSIFETAVGNVTPSIEVRSRRIGGATYQVPVEVRQDRAVSLALRWI
FT                   AKATSAARKKSGKTTVDCLQSEILDAYNKRGGAFKMCEEKYKMAEANKAFSHLRF"
FT   gene            14309..16384
FT                   /locus_tag="WRi_000140"
FT   CDS_pept        14309..16384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000140"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000140"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94885"
FT                   /db_xref="GOA:C0R543"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R543"
FT                   /protein_id="ACN94885.1"
FT                   /translation="MEIGISKYRNIGIMAHIDAGKTTTTERILFYTGKQNRIGEVHDGA
FT                   ASMDWMEQEKERGITITSAATTCFWNDHRVNIIDTPGHVDFTIEVERSLRVLDGAVAVF
FT                   DGVAGVEPQSETVWRQADKYSVPRICFVNKMDRIGANFYRCVDMIKTKLGAAPLVIHLP
FT                   IGSEKDFKGIIDLISMKAIIWQEETLGAKFSYEDIPSDLLDKAQEYRNLLLDAAAEMDD
FT                   EAMNTYFESNDLPVDLLKKCVRNGTIKGKFVPVLCGSAFKNKGVQPLLDGVVDFLPSPI
FT                   DVDVIVGIDPKDSEKKIEVKPSEKEKFVALAFKVMTDKFVGSLTFIRIYSGKLKSKSTV
FT                   SNALKNETEGIGRMLLMHANNREDITEARAGDIVALVGLKKTTTGDTLCSVDFPILLER
FT                   MEFPEPVIEIAVEPKTTSDQEKLGIALNRLVAEDPSLRMSVNAESGQTILKGMGELHLE
FT                   IIVDRMKREFNVEANVGAPQVAYRETITKSVEIDYTHKKQSGGAGQFAKVKIKFEPLEP
FT                   GSGFQFESKIVGGAIPKEYIPGVENGLELIKEGGIISGFPLIDFKATLLDGAFHEVDSS
FT                   PLAFELAAKGAFKEMANKAGPKMLEPIMKVEIITPEEYMGDVMGDINSRRGNVADMLDL
FT                   GNNSKIITASVPLANMFGYINVLRSMSQGRAQYSMHFSCYEQVPQYVVDELKLEYN"
FT   gene            16396..17568
FT                   /locus_tag="WRi_000150"
FT   CDS_pept        16396..17568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000150"
FT                   /product="Translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000150"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94886"
FT                   /db_xref="GOA:C0R544"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C0R544"
FT                   /protein_id="ACN94886.1"
FT                   /translation="MTAVVEAFGKPHVNVGTIGHVDHGKTTLTAAITKHYGNFVAYDQI
FT                   DKAPEERKRGITIATAHVEYQTEKRHYAHVDCPGHADYVKNMIVGAAQMDAAILVVSGV
FT                   DGPMPQTREHILLAKQVGVGYIVVYINKADVADADMIDLVEMEVRELLSKYGFPGDEVP
FT                   VVVGSALKALEDDSSEYGKKSIDKLMEKLDEYVAVPPRPVDLPFLLPIEDVFSISGRGT
FT                   VVTGRIEKGEIKTGEEIEIIGLKGTQKTICTGVEMFKKLLDKGSAGLNVGILLRGTKRE
FT                   EVERGQVLAKPGTITPHRKFKAEVYILKKEEGGRHTPFFANYQPQFYLRTTDVTGSIKL
FT                   LDGKEMVMPGDNVSVEVELQVPIAMDKGLRFAIREGGRTVGSGVVSEILE"
FT   gene            17582..17654
FT                   /locus_tag="WRi_t00160"
FT   tRNA            17582..17654
FT                   /locus_tag="WRi_t00160"
FT                   /product="tRNA-Trp"
FT                   /note="codon recognized: UGG"
FT   gene            17665..17874
FT                   /locus_tag="WRi_000170"
FT   CDS_pept        17665..17874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000170"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000170"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94887"
FT                   /db_xref="GOA:C0R545"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C0R545"
FT                   /protein_id="ACN94887.1"
FT                   /translation="MVEMLKSLCGFFCDIKQEIRRIAWVKKQEVLSSLFVVMIVILCFS
FT                   IFFCFVDFMSLYVIKALFGIIYGM"
FT   gene            17864..18700
FT                   /locus_tag="WRi_000180"
FT   CDS_pept        17864..18700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000180"
FT                   /product="Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000180"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94888"
FT                   /db_xref="GOA:C0R546"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C0R546"
FT                   /protein_id="ACN94888.1"
FT                   /translation="MECEYKWYIIKVDYGYEQGIRELVSNAVYFKEVFIPYQTVCNSKS
FT                   DIKELCEVYVYMHLCDESKNILNQTPGFCSGESGNFEMILDDEISLKCKEFNRYKWYIL
FT                   RVASNCEEKVRQHILENSMRLGVNDYFKEVFIPYEELSEVELKSKKIATRRKCFPGYVF
FT                   LYVNLCDEVLNFINSIPKSLKVYGFLKNGNIPKVILDDEIHSMCNALYNAQETKKLGYG
FT                   YEKGEKVKINDGLFQNFTGKVNMVNDEKKIINVEVSILGKPTIIELDLAQVEKIED"
FT   gene            18703..19143
FT                   /gene="rplK"
FT                   /locus_tag="WRi_000190"
FT   CDS_pept        18703..19143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="WRi_000190"
FT                   /product="ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000190"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94889"
FT                   /db_xref="GOA:C0R547"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:C0R547"
FT                   /protein_id="ACN94889.1"
FT                   /translation="MSVIVAKINLLMEAGKAVPGPKIASVLGPRGIPVPKFCEAFNKVT
FT                   SAANANYKVGDLVTVRISIKDDRSHDFTVSGPPVAYLLKQEAKLSKSSGNPGKELVAKL
FT                   PMSAIIKVAKCKMVDMKVDNEDSAVKMVVGTAKSMGIEVVEG"
FT   gene            19148..19801
FT                   /gene="rplA"
FT                   /locus_tag="WRi_000200"
FT   CDS_pept        19148..19801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="WRi_000200"
FT                   /product="ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000200"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94890"
FT                   /db_xref="GOA:C0R548"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C0R548"
FT                   /protein_id="ACN94890.1"
FT                   /translation="MNTYNDNPKQCLKKIVESASAKFNESVDIVVNLGVDSRKSEEQVR
FT                   GTVVLPKGIGKNIKVAVFAQDKHLLEAEKAGADIAGGEDLVEEIKKGRKLDVDWCITTP
FT                   DFMAKITPIAKVLGAKGLMPNPKFGTVTSNIAEAIKTIKSGQVKFRTDKNGVIHGKLGN
FT                   IKFDIDDLLENLKAFLKVIKDNKPISAKGIYFKGVFLNSTMGKAYKIGKVEDII"
FT   gene            19814..20332
FT                   /gene="rplJ"
FT                   /locus_tag="WRi_000210"
FT   CDS_pept        19814..20332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="WRi_000210"
FT                   /product="ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000210"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94891"
FT                   /db_xref="GOA:C0R549"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="UniProtKB/TrEMBL:C0R549"
FT                   /protein_id="ACN94891.1"
FT                   /translation="MKRKDKDEFIQSTINVFVNNDFLILVNFKSINANDSLTLRNSLKS
FT                   IAGGVLVVKNTLARLALGRTGKFSYLSGKFSGPVAIIYSSGIVEAAKLIVDFTNANKEK
FT                   MSVICAAHLNELLTVEDVNKLAKLPSLDELRVKIMRLISYDIPARLALSINSSSMRLMR
FT                   VLDYYSSKK"
FT   gene            20359..20760
FT                   /gene="rplL"
FT                   /locus_tag="WRi_000220"
FT   CDS_pept        20359..20760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="WRi_000220"
FT                   /product="ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000220"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94892"
FT                   /db_xref="GOA:C0R550"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C0R550"
FT                   /protein_id="ACN94892.1"
FT                   /translation="MSNVTSDLVDKILSLNLLEASELVKVLEEKIGLPAGSFLGGAVGA
FT                   GAPIGDNAAAPAAQEKAEYKVVIKEIDASKKIGVIKAVREVNSTLGLKEAKELVESLPK
FT                   DLTANVPKDEAEKIKQKLIEAGATKVELE"
FT   gene            20819..29332
FT                   /locus_tag="WRi_000230"
FT   CDS_pept        20819..29332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000230"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000230"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94893"
FT                   /db_xref="GOA:C0R551"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:C0R551"
FT                   /protein_id="ACN94893.1"
FT                   /translation="MVDSSYMYASGAFVPRVSYSRSIDLKDSLLDLVKVQKESYDSFTP
FT                   KNKGNERLEVIFHTIFPINDPLRRATIEFISCRVDDPKYDESECIKRGVTFSAQVIASI
FT                   RLVVMQDGISLDEYKSIKESGDHSKLATVVKSIEEQKVHFCGLPMMTDKGTFIINGVEK
FT                   VIVSQMHRSPGVFFDSDKGKTYNSGKLIYSARIIPYRGSWLDIEFDVKDHLYFRVDRKR
FT                   KLPISVLLKALGLSNNDILDRFYEKIKYVKHKDGWKVPFVPDKFKGVRLPFDLMDIEGN
FT                   VLLKANVRITSRLAKKLYDNELKEYLVPFNSICGLFLAEDLMDSASSTKILSAGESIKL
FT                   EDIKKLELLSVDEISVLNIDNLFVGPYILNTLFLDENMSYQDALYEIYRVLRPGEVPVL
FT                   EIVEEFFRNLFFSPEYYDLSNIGRLKLNSYLGLNYDEDLTVLTHEDIIEIVKKIVLLRD
FT                   GQGSVDDIDHLGNRRVRSVGEFIENQFRTGLLKLERAIVDSMSTSSLDKVSPSDFINPK
FT                   VLTNVLRDFFNSSQLSQFMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHY
FT                   GRICPIETPEGQNIGLINSLAIYARINKYGFIESPYRKVVNRVVTDQIEYLSAIDEGSH
FT                   HIADTSVKLDENNCFVDDMLYCRYAGSFVMVSSDQVSYIDVSPKQVISVAASLIPFLEN
FT                   DDANRALMGSNMQRQAVPLLKPTAPLVATGMESFVASGSGAVVLAKRDGIVDSSDSNSI
FT                   VIRAFDKERVNYLDVDIYHLRKFQRSNHNTCINQRPLVCVGDYVKKGDVIADGPAINSG
FT                   ELALGKNLLVAFMSWQGYNFEDSIIISSEVVKKDLFTSIHIEEFDCVVHDTPLGSEKIT
FT                   RAIPGVNEENLYHLDDSGIVKIGTRVGPGYILVGKVTPKPSLSLPPETKLLMTIFGEKS
FT                   FDCADSSLYTSPDVEGTVIDVQVFTRRGVEENERALLIKQKEINDFEEERDYIINVTSE
FT                   YFYDELKKLLINSGSQDREKFDSIEREQWWGIGLKNQSISEQVKSLKKDFDEKVSHAIA
FT                   QFKRKVEKLHEGYDLPQGVSMSVKVFIAVKHSLQPGDKMAGRHGNKGVISRVVPVEDMP
FT                   YLEDGTPVDIILNPLGVPSRMNVGQILETHVGWACRKLGEKVSNILDEINKIKSAFCKG
FT                   IRSLNDDNFTQFAVAYLDNKKIENIDDDEITASVLNTPNKNALNDELNELVENYLNSCK
FT                   SSYSNLRNFLIEVYSYGSNVSICNDIRNISDNNLIEFARKLRDGVPVAAPVFEGPKDEQ
FT                   IAKLFELAGLDNSGQAVLYDGCSGEKFDRKVTVGYMYMLKLHHLVDGKIHARSVGPYSL
FT                   VTQQPLGGKSHFGGQRFGEMECWALQAYGAAYTLQEMLTVKSDDINGRVKIYESIIKGD
FT                   SNFECGIPESFNVMIKELRSLCLNVDLKQNDVVIEDISHTNIAQPFNEVSISIASPESI
FT                   KRISCGEIEDVSTANYRTFKVEKGGLFCPKVFGPVNDDECLCGKYKKRRHRGRICEKCG
FT                   VEVTSSKVRRERMGHIELASPVAHIWFLKSLPSRIGALLDMSLRDIENILYSDNYIVID
FT                   PLVSPFEKGEIISEKAYNEAKDSYGIDSFVAMQGVEAIRELLTRLDLHEIRKDLRLELE
FT                   SVASEIRRKKIIKRLRIVENFIKSGNRPEWMILTTIPILPPDLRPLVSLESGRPAVSDL
FT                   NHHYRTIINRNNRLRKLLSLNPPEIMIRNEKRMLQEAVDSLFDNSRRNTLVNKAGAVGY
FT                   KKSISDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPTLKLNQCGLPKRMALELFKPFVY
FT                   SKLKMYGMAPTIKFASKLIRAEKPEVWDMLEEVIKEHPVLLNRAPTLHRLGIQAFEPIL
FT                   IEGKAIQLHPLVCTAFNADFDGDQMAVHVPISLEAQLEARVLMMSTNNVLSPSNGRPII
FT                   VPSKDIVLGIYYLTLQEPKEDNLPSFGAFCEVEHSLSDGTLHIHSSIKYRMEYINSSGE
FT                   THYKTVCTTPGRLILWQIFPKHENLGFDLINQILTVKEITGIVDLVYRNCGQSATVAFS
FT                   DKLMVLGFEYATFSGVSFGRCDMVIPETKATHVDHARGEIKKFSMQYQDGLITRSERYN
FT                   KVIDEWSKCTDMIANDMLKAISIYDGNSKYNSVYMMVNSGARGSTSQMKQLAGMRGLMT
FT                   KPSGEIIETPIISNFREGLNVFEYFNSTHGARKGLADTALKTANSGYLTRRLVDVSQNC
FT                   IVTKHDCKTKNGLVVRATVEGSTIVASLESVVLGRTAANDIYNPVTKELLVKAGELIDE
FT                   DKVKQISIAGLDVVKIRSPLTCEISPGVCSLCYGRDLATGKIVSIGEAVGVIAAQSVGE
FT                   PGTQLTMRTFHIGGVMTRGVESSNIIASINAKIKLNNSNIIIDRNGNKIVISRSCEVVL
FT                   IDSLGSEKLKHSVPYGAKLYVDESGSVKIGDKVAEWDPYTLPIITEKTGTVSYQDLKDG
FT                   ISITEVMDESTGISSKVVKDWKLHSGGANLRPRIVLLDDNGKVMTLASGVEACYFIPIG
FT                   AVLNVQDGQKVHAGDVITRTPRESVKTRDITGGLPRVIELFEARRPKEHAIVSEIDGYV
FT                   AFSEKDRRGKRSILIKPVDEQISPVEYLVSRSKHVIVNEGDFVRKGDLLMDGDPDLHDI
FT                   LRVLGLEALAHYMISEIQQVYRLQGVRIDNKHLEVILKQMLQKVEITDPGDTMYLVGES
FT                   IDKLEVDRENDAMSNSGKRSTHYLPILQGITRASLETSSFISAASFQETTKVLTEAAFC
FT                   GKSDPLSGLKENVIVGRLIPAGTGLIMNKIRALSLCDNVDKYEKYFDIETYDEEWLMDN
FT                   GCHLHSGEEESVVAYDQSN"
FT   gene            complement(29339..30301)
FT                   /locus_tag="WRi_000240"
FT   CDS_pept        complement(29339..30301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000240"
FT                   /product="NifR3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000240"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94894"
FT                   /db_xref="GOA:C0R552"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C0R552"
FT                   /protein_id="ACN94894.1"
FT                   /translation="MSLQVGNLTIDSPVILAPMSGVTDYPFRSIVKKLGASLLVSEMIA
FT                   SRAMIMQTRQSLQKAKVDALTAVQLAGCEPDVMAEAAKLNEDMGAKIIDINFGCPVKKV
FT                   VNGYAGSALMRDEKKAAEIIEAVVKAVNMPVTVKMRTGWNDENRNAPRLAKIAEDLGAK
FT                   MITVHGRTRAQLYNGQADWKFVRNVKEQVKIPVIVNGDIKNLNDIQNALKESGADGVMI
FT                   GRGAYGKPWLINQAMNFLSGSETSEPTASERLSIILEHYDNILEYYGNDTGIKMARKHI
FT                   GWYSSGLQGSSEFRVRVNNMTDSTEVKENIIGFFGQETH"
FT   gene            complement(30307..32229)
FT                   /locus_tag="WRi_000250"
FT   CDS_pept        complement(30307..32229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000250"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94895"
FT                   /db_xref="GOA:C0R553"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C0R553"
FT                   /protein_id="ACN94895.1"
FT                   /translation="MLGITKNNQKESTDFAGEKFVIYATCVCLAATFAAGCLGAVIGSP
FT                   LLTFPLAMLISNPVVWVLMGIILTVAYKMVVEPLFYLAKNYINGKRASKGEKSEEKDTE
FT                   LQDLQGKTPEKQARPKTPDRDSGIFDCKENKDSFVYKTNKKEDYKFWLSNFDIAEIAKS
FT                   YYGWMPYRKKGHREFSKGVFFSCLDNLTSFLGNRLQEYKDKVKGDNNLVLSSILNLNNN
FT                   HWVTLVISHDEKSKKFRAYYCDSFGEPLPEEVSSALQKTLGIDNSSIRNSKAKQQDDKY
FT                   NCGIFALENAKKITDMLKAGKSFDEIDDQLKYELSSEQLIEKRKEFAKALKKDEQSRAG
FT                   TPSPVLGGPGNISRKDSGVSLDSVESKQTKIVQYNTTGDGNCFFHAVFGDNSSGQYKTE
FT                   KAQDMRMGWHKFLSQFNSLNDPRMPELLKGQMQKVFGAFLENPNHLIGMSDSIKDLVQH
FT                   TNRRVEKIKKKTNKLIKKLCCLTTLKENEVIGDLRSISASNLNISERKYDRNYNSDTAA
FT                   NSFLNGKSIYRSYLEAISSQSYHVFIEEISILASLANIEIDVYYKNNGNDVNTLFLPNA
FT                   GMINEGYQQNNELWGNKEQETVYLAPGHYERAEIVEVEPSLMEKVSSAIQSVVTVCVNA
FT                   LGLNT"
FT   gene            32352..33650
FT                   /gene="serS"
FT                   /locus_tag="WRi_000260"
FT   CDS_pept        32352..33650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="WRi_000260"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000260"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94896"
FT                   /db_xref="GOA:C0R554"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C0R554"
FT                   /protein_id="ACN94896.1"
FT                   /translation="MLVIAQYMHDIEYIRKNPEGFEKAMKSRGIRESTAEEILEIDHEK
FT                   RSLTTKLQDLNRQRNEITEEIKKLKMSKSPCEEQIELSKSITNEIEAISLKEQAEKDKL
FT                   VNVLSNLPNIPAQDVPIGADENSNLEVRRYGGKRQFDFVPESHYELGEKLGLIDFEQAA
FT                   RISGSRFTILKGQLAKLGRALINCMLEMHVNEFGYTEVYHPALVKNEAMYNVGQLPKFS
FT                   DDSYLTTDELRLIPTSEVFLTNLVADKIMEEKELPIRFTAYSECFRKEAGSAGRDTRGM
FT                   IRQHQFGKVELVSITTEDQSNDELERMTSVAEEILKKLELPYRVMLLCSGDMGFAAQRT
FT                   YDIEVWLPGQNKYREISSCSNCGAFQARRMNAKYSSETDKKIKKYVHTLNGSALAIGRT
FT                   IIAIMENYQNSDGSIAIPNVLQKYMSNDTVISK"
FT   gene            33685..34956
FT                   /locus_tag="WRi_000270"
FT   CDS_pept        33685..34956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000270"
FT                   /product="Phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000270"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94897"
FT                   /db_xref="GOA:C0R555"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C0R555"
FT                   /protein_id="ACN94897.1"
FT                   /translation="MKVLVIGSGGREHALLWALKKSPILTELYVTPGRQAMKDLGALVD
FT                   VNIQNSVDVTQFCKRENIELVVIGPEQPIIDGLADDLVAEGINVFAPSQATAKLEGSKS
FT                   FTKGLCKRYGIPTAKYECFVDEGLAKDFVRSNKIKFPLVVKANGIAAGKGVVICNTESE
FT                   AFSAINSMLVEKKFGESGEEIIIEEFLVGEEVSFFALIDGLKVVTLGCAKDYKRVDESN
FT                   ESQNTGGMGSYSSPSIISKDMEQKIIQKIIYPTAQALVNMGTSYKGVLFAGLMICKDSP
FT                   KLLEYNVRFGDPETQSILPRFDSNCDLLKLMLSVAEGKLNVKMVELNNKSTVCVVVASK
FT                   GYPGDYQKGEVIKGLDKIESIPGVLVFHAGTKLDESGNLVSDGGRVLNIVAEGSTIEEA
FT                   KSKVYSALNFLEWPGGFFRYDIGS"
FT   gene            complement(35593..37758)
FT                   /locus_tag="WRi_000280"
FT   CDS_pept        complement(35593..37758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000280"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000280"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94898"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R556"
FT                   /protein_id="ACN94898.1"
FT                   /translation="MLSLIRKTLRKKMTHQVNDSKLKEKDEKSILKLASKIKGKKSSIA
FT                   EELEKISKKEKQRILTTEVSKHRGKEPTIISLAYAILRKDSIAVEKMLRVAKENGILKD
FT                   ILDATTTIKYPGGQEETCTPLTYAILCKNSKTIEETLKVSKENGILKDILNATTTIKYP
FT                   DGRRATVTPLAYAILYEDSIAIEEILKVSKENGILKDILNTTATIRYPDNKEVTYAPLA
FT                   YAMFWKDSKAIKEILVADEENSILKDILDATTTIKYLDGQEEIYTPLTYAISCKNSKTI
FT                   EEILKVSKENDILKDILDATTTIKYLDGQEEIYTPLTYAISCKNSKTIEEILKISKENG
FT                   ILKDILDATTTIKCSDGHEETCAPLTYAILRKDSIAVEKMLRVAKENGILKDILDATTT
FT                   IKHSDSREVTYTLLAYAILRKDSIAVEKMLRVAKENDILKDILDATTTIKYPDGQEETC
FT                   TPLAYAILRKDSIAVEKMLRVAKENGILKDILNTTITIKHKNNQKVTDKLLAALHDRKV
FT                   IQEILDIARENDILKDILNATITIKYPDSEEKIYTPLTYTISCKSNEAFNTTRAINQDG
FT                   QEKTHIPFPTVSVLDERETELKLKEKRQSRRDEGLNFNNGSSDKNVEIKVNGDILLQHS
FT                   SGTKNEINHTAVRNDVGGVKPLIESRVNVKVQNINAVIATSVTFKMIATSVTLELVASK
FT                   ITCVLSKPTTKLEEVAITYFQGLALYL"
FT   gene            38172..39038
FT                   /locus_tag="WRi_000290"
FT   CDS_pept        38172..39038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000290"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000290"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94899"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R557"
FT                   /protein_id="ACN94899.1"
FT                   /translation="MTEETKDGYASLYVAIQEGNIEAAELLIKCGTNVNDHYERNRTPL
FT                   HIAIGRKQLEIAKLLIKNGANVNAKTQNHGKDDLTPMHFAVFANTPEFIELLASHGALI
FT                   NERESTEGYTPLHFAALYGNKNIIQALIDKGQDIEDVDNNGRTALFLAARQCTEAEDDS
FT                   RIEIIKYLIDKLKADVTKKDNNNNAVLFPAANNCPGKVVEFIIEQYIKIFELENFINHK
FT                   NNDGMDALDIALNSGNEKAIEVLRSYGADIKNKVDGSIQKITAEKPSSTLDRAESAEVA
FT                   PPIKQRV"
FT   gene            39342..40268
FT                   /gene="prsA"
FT                   /locus_tag="WRi_000300"
FT   CDS_pept        39342..40268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="WRi_000300"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000300"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94900"
FT                   /db_xref="GOA:C0R558"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:C0R558"
FT                   /protein_id="ACN94900.1"
FT                   /translation="MKIIIGNASKELGESVVNRLDVQPSSAWISKFTDGEVNVEVANDL
FT                   YNQEVYIIQSLSPPVNDNLMELLLIIDAVNRLGAKRIVVIIPYYGYSRQDRIIKNNNMQ
FT                   SALSAKLVANLIQTAGASSVAVIDLHSSQIEGFFDVPITNLNCFEAFVDSIHTENLAIV
FT                   APDVGAIGRARAFAKTLEEKYKIGLSDKIIVVDKYREKAGTSQVMNIIGEVANKNCVIV
FT                   DDIVDSGGTLCNAALALKSYGAKSVTSCITHGVLSGSAVEKISSSSLDKLVITDTILHK
FT                   LEKTGKIEVVSVVNILTHFIQGGRNAS"
FT   gene            40258..40611
FT                   /locus_tag="WRi_000310"
FT   CDS_pept        40258..40611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000310"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000310"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94901"
FT                   /db_xref="GOA:C0R559"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:C0R559"
FT                   /protein_id="ACN94901.1"
FT                   /translation="MPAKSTEDVITSLIEFANKRKITITKEEMLKIAQLVRIKLSNDEI
FT                   DHYSKELTMLDWIHDTLLQVNTEGVSPMRYGSIDKDIHVRDDVINSQNIKEEILSNTKP
FT                   EHGYFVVPKVISD"
FT   gene            complement(40653..41915)
FT                   /gene="tolB"
FT                   /locus_tag="WRi_000320"
FT   CDS_pept        complement(40653..41915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="WRi_000320"
FT                   /product="translocation protein TolB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000320"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94902"
FT                   /db_xref="GOA:C0R560"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R560"
FT                   /protein_id="ACN94902.1"
FT                   /translation="MKLFVHLVLFISLFIPYFTKAALYVDIKKSSVGNIGLVVSKCTCK
FT                   TALESELSENIAKVIGTNLSNCGLFNVKRGAEAESKSWKSDTVVTVSLSEISGSALELS
FT                   FRLFDTFTKRELLTQSVVFPAKDWRKIGHLVSDVIHDRLIGEKGHFNTKITYIAEEKDS
FT                   NYKSVRKIAVMNQDGSNIKYLTNGDRFVSTPRFSPNGKGIVYISYANGKSYIILKNLKD
FT                   NTESIISTFEGVVSAPRFSPDGKSLLISHSLGGETNILSLDLSSKRTKKITKGSAISTS
FT                   PSFSPDQKYMAFSSDISGSQQLYVIDFTNKSKKPKRISFGSGRYATPVWSPKGDLIAFT
FT                   KIQSGKFYIGVMKPDGKEERLLSEGHKIESPAWLPNGREIIFTRTESPSNSKLYLVDLV
FT                   KKNQKMVSTPTNASLPDWSYF"
FT   gene            complement(41921..43555)
FT                   /locus_tag="WRi_000330"
FT   CDS_pept        complement(41921..43555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000330"
FT                   /product="Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000330"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94903"
FT                   /db_xref="GOA:C0R561"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:C0R561"
FT                   /protein_id="ACN94903.1"
FT                   /translation="MNINKNEFLFLPLGGVGRIGMNVSLYHYQGKWIMIDLGVGFADET
FT                   MPGVELLIADIDFIAQRKKDLLGIIITHAHEDHCGAVPHLWEELQCSIYTTKFTVNFLK
FT                   EKLKEFRLEGIVPVKEVDINGSINLGPFTVEFINVTHSIPEANSILISTEMGSALHTGD
FT                   WKFDPKPVVGLTSNMERLKEIGDKGDLLAAICDSTNILSKHHPESEGEIYNNIYNIIKR
FT                   SKKLVAVSLFASNVARIETISQAAKALNRKVVLLGRSLWRIVKVAQDSGYLTDSPQFLE
FT                   AKEAVNFPREELVLLCTGCQGEPLAATARLAAKSHQAFKMQQGDTMIFSSKIIPGNETR
FT                   AHNMLNAFIEMGVEVITEKTEHVHASGHPTREELKEMYSLIKPKMSIPVHGEYIHTHAH
FT                   VKFAKECGVAKAIMIAPGDIVNLENGEKVDSIDVDYFGIDGMLLRHPESSVIKMRKRMR
FT                   DAGVIVVTAVVNKKNKLLAKPKVFVPGVFEVLEDAATIQKIVKKVESLFSLQPTKKIKN
FT                   KIESSILSILKEYLLKRPIIEVQIEQV"
FT   gene            complement(43764..44882)
FT                   /gene="dnaJ"
FT                   /locus_tag="WRi_000340"
FT   CDS_pept        complement(43764..44882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="WRi_000340"
FT                   /product="dnaJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000340"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94904"
FT                   /db_xref="GOA:C0R562"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R562"
FT                   /protein_id="ACN94904.1"
FT                   /translation="MSKKDYYDLLEVGRNASIDEIKKAYKKLALKYHPDRNPGNQEAEE
FT                   KFKEVTAAYEVLSDSEKRAGYDRYGHEGASGGFQGFSSAGDFSDIFNDFFGGGFGGGAS
FT                   RSRAKRSTTGVSGADLRYDLEITLEDAFKGIQAPIHYVTNVKCDTCQGTGGEGAIKPVQ
FT                   CHTCQGSGRIRTQQGFFTIERTCTTCYGEGEIIQNKCKKCGGSGRRRDEVNISVSIPKG
FT                   IEEGAKVRISGKGEAGTKGGKSGDLYVYVKIIFHKIFARNKADLHCKVPIRMTLAVLGG
FT                   EIDIQSIDGAKIKVKVPEGTQTGTKLRCREKGMPYMNSHARGDLYVQVIVETLNPKNLT
FT                   KKQIELLKALEEEENASVQQQSEGFFSKVKKK"
FT   gene            complement(44968..45042)
FT                   /locus_tag="WRi_t00350"
FT   tRNA            complement(44968..45042)
FT                   /locus_tag="WRi_t00350"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGU"
FT   gene            complement(45109..46053)
FT                   /locus_tag="WRi_000360"
FT   CDS_pept        complement(45109..46053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000360"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94905"
FT                   /db_xref="GOA:C0R563"
FT                   /db_xref="UniProtKB/TrEMBL:C0R563"
FT                   /protein_id="ACN94905.1"
FT                   /translation="MVASYSVLKRYALAYIKKSGSNSDVKEFLQFCNTQNTTNWSEENF
FT                   KNAYEKFTHPNSSNRHDTGSRNDQYNAGNNAQPTGSQITHIHVHNRGLDFWDYLLLQCW
FT                   MDSLFGGRGHTTVNNITNINNGNTTHQGRKENKKESEDSRKLLALGIVAAVVCVAFHAG
FT                   MCFWYNSSRKVARKKEKIDYLDSKFKTFRNIEFAVGVVSLAALVACAVYPVLPVWGLAI
FT                   LGVNSLVCFAGGLAFHMKHEEESENIEKAKGAVDSCLRQGHGYGDSSRYDAPPPYFSQD
FT                   PNTTPTAPPQNAFDNPYLQQKFGNCKGFTRDKN"
FT   gene            complement(46268..46543)
FT                   /locus_tag="WRi_000370"
FT   CDS_pept        complement(46268..46543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000370"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94906"
FT                   /db_xref="UniProtKB/TrEMBL:C0R564"
FT                   /protein_id="ACN94906.1"
FT                   /translation="MIAEKSPIVKLAYDELDKFCWNEKDLVAYEERIMDLRKEEAILEY
FT                   KLEEGIEKGKIEVAKNLLKAGVSVNLIAESTGLSQAEIVQLKQEVA"
FT   gene            complement(46740..47679)
FT                   /pseudo
FT                   /locus_tag="WRi_p00380"
FT                   /note="transposase, degenerate; disrupted by frameshift"
FT   gene            47985..48173
FT                   /locus_tag="WRi_000400"
FT   CDS_pept        47985..48173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000400"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94907"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C0R565"
FT                   /protein_id="ACN94907.1"
FT                   /translation="MRYLTVVSIIAWRIFFITSIARTNPTLPCTALLAEEEWKVLYVKI
FT                   HRKPCPNIAPTIKEAVS"
FT   gene            complement(48221..48896)
FT                   /pseudo
FT                   /locus_tag="WRi_p00410"
FT                   /note="transposase, truncated; disrupted by frameshift;
FT                   ISWpi5"
FT   gene            complement(49073..49282)
FT                   /locus_tag="WRi_000415"
FT   CDS_pept        complement(49073..49282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000415"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94908"
FT                   /db_xref="GOA:C0R566"
FT                   /db_xref="UniProtKB/TrEMBL:C0R566"
FT                   /protein_id="ACN94908.1"
FT                   /translation="MGIETKKLLYKLRQPSYHKTEGIQLSSSVQIKQQENNVVGVLFLI
FT                   FCTMCTLCLHNISRFLPTQAETRL"
FT   gene            49328..49969
FT                   /locus_tag="WRi_000420"
FT   CDS_pept        49328..49969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000420"
FT                   /product="dioxygenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000420"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94909"
FT                   /db_xref="GOA:C0R567"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039387"
FT                   /db_xref="UniProtKB/TrEMBL:C0R567"
FT                   /protein_id="ACN94909.1"
FT                   /translation="MNVKNILLAFLVQMVFSLPLFAADPVLLNCIETPEIYDLDARPKN
FT                   FNSSNNLRRKPGSPNSAIGELIHIVGKITDINCLPIQNAVVSIWHANSRGVNHYDKNIE
FT                   DDLNFAGSGRFVVNNLGYYNFITIAPGKIGDRAPHINFLVQHPDFPEFTTQMFFADHNC
FT                   DNCADPVLEDFVSNGLASLLITPFTYSDQVIKTYTFNITLGGYNKFSNKR"
FT   gene            50030..51568
FT                   /locus_tag="WRi_000430"
FT   CDS_pept        50030..51568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000430"
FT                   /product="leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000430"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94910"
FT                   /db_xref="GOA:C0R568"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:C0R568"
FT                   /protein_id="ACN94910.1"
FT                   /translation="MKNILLMFLLCFMYSLQLFATEIPAMKITISKISPDFKTIVMGLF
FT                   EDNETVNDDGVLQGKQVIDNIKQFSDFNGSFGEFFSTALPEEKNVIVVGLGKKDEWNEN
FT                   KELNIGGKIYCELSRLKIKKAAVLIEGSAANVAYGAFLRSFKFDKYKTKKDEKITEVEE
FT                   ITVLVKDEQLSNAERSFEHLRQEGESIFLARSFITEPPNILYPESYADHIKKELTKLGL
FT                   EIEVLDKKQMEEKKMGALLGVAQGSSKEPKLVVIKWNGASKEQKPIAFVGKGITFDTGG
FT                   VSLKPSRGMESMKYDMAGSATVVGVMHALAGRKAKVNAIGVVALAENAVGGNAQRPSDV
FT                   VTSMSGQTIEVLNTDAEGRLILADALWYTQDRFSPKFMIDLATLTGAIVVALGNNEYAG
FT                   LFSNNDELANRLIDAGNEVNEKLWRFPMNETYDKIIDSPIADVQNIAPAGSGGDSIMAA
FT                   QFLQRFVNETCWAHLDIAGTAWHEKGTDICPRGAVGFGVRLLNKLVEKYYEAND"
FT   gene            52263..53450
FT                   /locus_tag="WRi_000440"
FT   CDS_pept        52263..53450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000440"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000440"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94911"
FT                   /db_xref="GOA:C0R569"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0R569"
FT                   /protein_id="ACN94911.1"
FT                   /translation="MESRAKAWFIWLISNLVVIFSNMQIIYTFISVNLEKELGLTIAQV
FT                   ALANSVYTWTFAILQFFSGATFNVFSSKKIYFFSLSTMILGFFVLINSDNFSHLILSQV
FT                   LIATGASFGFIGAAHTSSICFSAAQFGLMFSLVQTISSLSALVIQILFSNLLAEDAYWK
FT                   NLIVCIILFGVLIFVLTLFCPNTLPESSSEKRTIKSSMKTVMCSILTVLKLRDIWITSV
FT                   VGAITFGTFLALNTLWAPRLLGNSELNAMESGIATAILWLGLAVGAPIADRISNLFKNR
FT                   KHVISAFALLQGVSIIILLYSHLTVHVVYFCMLMFGFFAGGHMLNFTVGSEIVKRKYIS
FT                   TSSSIINGFMFIGSGVIVSMLALFTDHKMALFAIFAILIVAGILNYATKETYSKK"
FT   gene            53511..53816
FT                   /locus_tag="WRi_000450"
FT   CDS_pept        53511..53816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000450"
FT                   /product="DNA-binding protein, HU family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000450"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94912"
FT                   /db_xref="GOA:C0R570"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:C0R570"
FT                   /protein_id="ACN94912.1"
FT                   /translation="MDHVTTKDTTVTKATIVGDINQEIGLSKEDSASIIDDILDEIKTS
FT                   LAKDGIVKISSFGTFLVKKKKERPGNIPNTSEKVMIQARNSVSFRPSKIIKKSINN"
FT   gene            53816..54142
FT                   /locus_tag="WRi_000460"
FT   CDS_pept        53816..54142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000460"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000460"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94913"
FT                   /db_xref="GOA:C0R571"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C0R571"
FT                   /protein_id="ACN94913.1"
FT                   /translation="MNKEKLFYTIGEVAEELHLEQHVLRFWEGQFHQIKPTKRKGRRLY
FT                   DRKCIEAIKKVKYMLYDKGYTIKGVQKEFGNDIKVTKNLLQELTDLRDYLTSKINSEES
FT                   NKQT"
FT   gene            54188..54784
FT                   /gene="nlpD"
FT                   /locus_tag="WRi_000470"
FT   CDS_pept        54188..54784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD"
FT                   /locus_tag="WRi_000470"
FT                   /product="peptidase, M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000470"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94914"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C0R572"
FT                   /protein_id="ACN94914.1"
FT                   /translation="MWHIASFLMLLAILIGCGLQKPAPVLLKGEEFYGKRDLEYTREYH
FT                   LIREPSVQKESRKAIINRIYRDNNNAQNVEVNCKFVMPVKGSATSSDETCKDGIKIAAQ
FT                   NGTNVIASAPGKVIYVGKGLRWYGNLIIVEHKDNYMTVYSYLKNIHVEIGDKVKQGQVI
FT                   GSAGKSSTQDKDPQMCFTIRHNGQAVDPLAHTNCD"
FT   gene            54797..57313
FT                   /gene="leuS"
FT                   /locus_tag="WRi_000480"
FT   CDS_pept        54797..57313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="WRi_000480"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000480"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94915"
FT                   /db_xref="GOA:C0R573"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R573"
FT                   /protein_id="ACN94915.1"
FT                   /translation="MKYDFKNVERFCQDKWDFSVSKSSKQEKCYVLEMFPYPSGKIHMG
FT                   HLRNYAIGDVIARYKRARGFEVLHPIGWDAFGLPAENAARDNNISPEIWTKENIDNMRA
FT                   QLKSIGLSYNWNRELSTCEPNYYTHEQKFFLDFLKHGLAYRKESWVNWDPVDQTVLANE
FT                   QVVDGKGWRSGAVVEKRKLSQWFLKITDFAEDLLKCLQSLKNWPEKVKTMQERWIGKSE
FT                   GATIEFEVVGLNKKLKVFTTYPHTLFGASFCAVAAEHPIVQDLKNGSSVVIPVLDTGIQ
FT                   EIKSKRENDEKIGVYTGLNVKHPFLDKELPLYIANFVLMEYGEGAIFGCPAHDQRDFEF
FT                   AQKYNLPIIPVISSAHLGVIPARDQNSYNGSQCQATQMTKEAYTGDGVMFNSEFLNGLM
FT                   VSEAKEVIIKKLKEKGIGKKTTNYRLHDWGVSRQRYWGCPIPIIYCKDCGTVPVPEKDL
FT                   PVILPADVEFTSGGNPLDKHPTWKFVDCPKCGKQAERETDTFDTFFESSWYFAAFCSED
FT                   KSIDKDACNRFMPVDYYIGGIEHAILHLLYSRFFCRALTKCGYFDIKEPFSTLITQGMV
FT                   CHATYKDENGKWLFLAEAKELIARGTKVQVGKVEKMSKSKKNTVDPNFIIEKYGADTAR
FT                   LFVLSDTPPEKDMEWSDDGVEGCSRYVNKLWRMVMQLKPVNMHYDNKSVTGGLLEYRKK
FT                   IHKLLHGLTDDLENCRLNCVVAKFREMTNLIAEIDVAAGKSLIDEGICILIRVIEPFMP
FT                   HLAESLWQEIGGQPWPKADESLLVDDTVTIAVQINGKLRATIEVAINLPQEELKKIAID
FT                   SVSSKIDQNKVRTVYAVPNKIVNIVI"
FT   gene            57432..58037
FT                   /locus_tag="WRi_000490"
FT   CDS_pept        57432..58037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000490"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94916"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C0R574"
FT                   /protein_id="ACN94916.1"
FT                   /translation="MKMKRLCALAVLLTSSLAGTANNSASKSEDQYYAGLNFGAGWGGG
FT                   LKIKPSVVFGYHHDKNSKFELEVLTDISDMFGKEEKKMGASLLANYRYYPDLDIDPVKL
FT                   YVSGGLGGYLQVIPFGFGNSGTSEPASKDIEAAGEKASVVDKILGSISYKLKVGVDYEI
FT                   TPQIVGTVGITAGGQLSGFKPPVQIPDAILEVGIRYNF"
FT   gene            complement(join(58513..58557,59478..60518))
FT                   /pseudo
FT                   /locus_tag="WRi_p00520"
FT                   /note="transposase, degenerate; disrupted frameshift and
FT                   IS-insertion; ISWpi3"
FT   gene            58618..59450
FT                   /locus_tag="WRi_000510"
FT   CDS_pept        join(58618..58992,58992..59450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="WRi_000510"
FT                   /product="transposase, IS5 family"
FT                   /note="ISWpi1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000510"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94917"
FT                   /db_xref="GOA:C0R2R0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R0"
FT                   /protein_id="ACN94917.1"
FT                   /translation="MRKKYPTDLSEREWARIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKKVKGRKRHIITDTQGFILGCYVGAANENDRDGIKIALN
FT                   NMRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFWVHKDTPPELLPTR
FT                   EQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMSRVMLKREYA"
FT   gene            60655..61362
FT                   /gene="pdxJ"
FT                   /locus_tag="WRi_000550"
FT   CDS_pept        60655..61362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="WRi_000550"
FT                   /product="pyridoxal phosphate biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000550"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94918"
FT                   /db_xref="GOA:C0R576"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R576"
FT                   /protein_id="ACN94918.1"
FT                   /translation="MKLGVNIDHVATLRNARGTSYPDPLKAAEIAIDAGADFITVHLRE
FT                   DRRHIRDEDVFNLKKSISTELNLEIAATEEMLEIAKKVKPYSISIVPEKREELTTEGGL
FT                   DIVNMHSKLSSIIEEMHSSSIKVSLFIDPNIDQLKYLEKLGTKPDIIEIHTGDYCDNPS
FT                   EKKLQLITNAAEYVNKLGIECHAGHGITYEHAKKMTRIPHISALNIGHYLISEAVFYGL
FT                   HSVVKTMKMTMSN"
FT   gene            complement(61355..61666)
FT                   /locus_tag="WRi_000560"
FT   CDS_pept        complement(61355..61666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000560"
FT                   /product="DNA-binding protein, HU family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000560"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94919"
FT                   /db_xref="GOA:C0R577"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:C0R577"
FT                   /protein_id="ACN94919.1"
FT                   /translation="MSKEDIIKQLKEDCSSQNIDITKSDLSKIHDAFIKIIKNELHGKG
FT                   EIRLHGIGTFSTAISQEKQCRNPQSGEIMTVPKKTRVKFKASQTLLSILNEKEKAAVS"
FT   gene            complement(61813..62268)
FT                   /gene="rpsI"
FT                   /locus_tag="WRi_000570"
FT   CDS_pept        complement(61813..62268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="WRi_000570"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000570"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94920"
FT                   /db_xref="GOA:C0R578"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C0R578"
FT                   /protein_id="ACN94920.1"
FT                   /translation="MKSSTINNNDWSEKTIKSAVDSLGRLYATGRRKESVARVWIKPGS
FT                   GKFSVNKKGDLISYFKRESVCQTVKMPFVATSMLDKYDVFATVKGGGLSGQAGALAHGI
FT                   SRALSSVSQDLHSILRNGEFLTRDSRVVERKKYGQHKARKKCQFSKR"
FT   gene            complement(62279..62737)
FT                   /gene="rplM"
FT                   /locus_tag="WRi_000580"
FT   CDS_pept        complement(62279..62737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="WRi_000580"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000580"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94921"
FT                   /db_xref="GOA:C0R579"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R579"
FT                   /protein_id="ACN94921.1"
FT                   /translation="MKTFFLKEKQINKKWFVIDAEGLVVGRLAAFVATLLRGKHKPEYT
FT                   PHMDCGDNVIIINAEKVHFTGKKLKDKIYYKHTGYSGGLKKTTPDNILNGKFPERVIEM
FT                   AVKRMLDDGPMARRRFENLYVYSGSEHKHQGQQPEKIDFASLNRKNKK"
FT   gene            62867..64090
FT                   /locus_tag="WRi_000590"
FT   CDS_pept        62867..64090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000590"
FT                   /product="outer membrane protein TolC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000590"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94922"
FT                   /db_xref="GOA:C0R580"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C0R580"
FT                   /protein_id="ACN94922.1"
FT                   /translation="MFRLIITLAIIFNTISCYATDVGEVISKAIKNSSKIKSQFYQYKS
FT                   AEKHYKSSGLAGFLPDINLQYNFDSNFNLDTSEKKLTLRQKLIDGGGTFATFSRSSHLL
FT                   KAEKMRFQQLKQELALNAVKAYVNVLQKTEILKLREHKERVSLEHLSAMKKRFSLGEVT
FT                   NAEVLLAKAKFSSSISERVDAEGKLKLVNIAYYHLIGEDADDLSEANDKLPSVPELNEC
FT                   LQLAKTNNLSLKAAVYQKRAAGMEVIAESSKWLPSLNLSASKNFGEDGMKVDKLLENVH
FT                   VVFTLDVPIFKRGVNAFGVSKAKMDAKKSTYDYYETVKNIEQAVVNAWNNVLTAKAIIK
FT                   ASQEAEKAAALALEGVEQEVNLNLKSTSDLLDTEDALFKARSDLVEAKSNYVISVYNLL
FT                   FMINSIDL"
FT   gene            64110..64685
FT                   /locus_tag="WRi_000600"
FT   CDS_pept        64110..64685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000600"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94923"
FT                   /db_xref="InterPro:IPR019632"
FT                   /db_xref="UniProtKB/TrEMBL:C0R581"
FT                   /protein_id="ACN94923.1"
FT                   /translation="MHDEQGNQSVKDILEDIKKAISGKNASNDKAEIKDENDDVLYLEE
FT                   EYPEEIEEDGKKENSEKEDIDNDDQGEEMACNSNQFNGHSYNSEEKKDIYLYDNIQTSN
FT                   KKVSNSGLQAQNNDHLILKENMEEIKALLGKMQNELQHKQQKKANLTVEELVTSLLKPQ
FT                   LSEWLNKYLHALVKEVVEKELKDIINNK"
FT   gene            64762..65340
FT                   /locus_tag="WRi_000610"
FT   CDS_pept        64762..65340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000610"
FT                   /product="ribosomal RNA large subunit methyltransferase J,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000610"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94924"
FT                   /db_xref="GOA:C0R582"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0R582"
FT                   /protein_id="ACN94924.1"
FT                   /translation="MNDQYVQKTSKDGYRSRSAYKLVEMDNKFKLFQEGQKIIDLGASP
FT                   GGWLQVASQKGANVVALDVKPMNAINGVEFIQCDIINEFEILREKFKDQKFDVILSDMA
FT                   PESCGLKSLDHIRIMLLCEAALNFAKHFLSHGGTFVVKIFQGESDKDFCNELKKMFKTV
FT                   KYFKPKSSRSESTEMYLVSLGFIGSRLSI"
FT   gene            66128..68224
FT                   /locus_tag="WRi_000620"
FT   CDS_pept        66128..68224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000620"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000620"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94925"
FT                   /db_xref="GOA:C0R583"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R583"
FT                   /protein_id="ACN94925.1"
FT                   /translation="MAMEKKKFFEIINEVSKSEGLNENNLLERIGNKLKDADSIVYSTY
FT                   NNLKIDKMFSILDSDKIVDYMLVHLAVECNSVPIVKLLLAKEAKVNEPIYELDEAKSKL
FT                   TALHIAALHGHQEIVQLLLNNDANPLLKDSQGRTPRDIVGDVKGKKAIIEMLEEGDSQG
FT                   RTPRDIVGDVKGKKAIIEMLEEGEQRYAEAGATRRQNRQGTLPQPNNKTPGNLAVNGNN
FT                   ATAAVQACNARDQEENNGTTPNNRKIYVQDEDEQTSSNSIINENNTDKVDDTLEREQAL
FT                   RERNAVEQKLQEVEQRLANNQKRIEQTGHNQHSEQYGATYNGEQTFLNKSNSGDSGIYF
FT                   DADESEALGQSILENGEDINAQDKDGVTHLHYAATYGYVEIAEYLIDNGADVDAQDKDG
FT                   VTPLHYAAAKSAKESVKLLIKRKANINAQDKDGHTPLYFAVANDNKELAKLLIKYGADR
FT                   SLIKDEDLIDRLNSMCDQPSEVVSSTSSHSKTHNAMETPEEAEKVKKSKVKLKELRTQL
FT                   KDKQKKNELLKQQIQDLESEKATLKDKLDKTESQHSKTEVLLEKAQKELEESKSCIAGY
FT                   GTKLKEFNKENESLRQEIQDLESENTTLKGELGKTKTKTNEVSLEKAGKRQMSFLKVAS
FT                   VNLVTMLTVGATLSIAFDLSVLPIIVVFVTSALIASGVTYAISTKPTTELKEVDIQGSA
FT                   QRCL"
FT   gene            68588..68899
FT                   /locus_tag="WRi_000630"
FT   CDS_pept        68588..68899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000630"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94926"
FT                   /db_xref="UniProtKB/TrEMBL:C0R584"
FT                   /protein_id="ACN94926.1"
FT                   /translation="MKTFTKNFKNNEKKLEEFNKEIEDITTIAQDKFAHELENIAYDSV
FT                   QKFRSLLAKELNSIFNNIHSQNVNLLKSSLVEYAISSNFINKKGETALIRSLLNIFIR"
FT   gene            join(69036..69260,70446..70616)
FT                   /pseudo
FT                   /locus_tag="WRi_p00640"
FT                   /note="hypothetical protein; Disrupted by IS-insertion"
FT   gene            complement(69291..70307)
FT                   /locus_tag="WRi_000650"
FT   CDS_pept        complement(69291..70307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000650"
FT                   /product="transposase"
FT                   /note="ISWpi2"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000650"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94927"
FT                   /db_xref="GOA:C0R585"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0R585"
FT                   /protein_id="ACN94927.1"
FT                   /translation="MSQACKVMGYSRDTFYRFKELYENGGEEALHEISKKKPLLANRVS
FT                   DDIERAVIGIATEFPAYGQKRAANELRKRGIIISQGGVRSVWLRNDLETLKKRLKALET
FT                   KVAQDGIILTEEQLAALEKVKEQREAHGEIETQHPGYLGSQDTYYVGNIKGIGRIYQQT
FT                   FVDTYSRVAMVKLYTDRTAITAADLLNDRVIPFFDEQKIPLLRILTDRGTEYCGKPENH
FT                   AYQLYLGIENIDHSRTKANSPQTNGICERFHRTMQDECYNIIFRKKIYSSLEDLQIDVD
FT                   HWLRSYNETRPHSGKYCYGKTPMQTFLDSKYIAFQKNISSITQEPDISFDYLNSSVS"
FT   gene            70915..71325
FT                   /locus_tag="WRi_000660"
FT   CDS_pept        70915..71325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000660"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94928"
FT                   /db_xref="UniProtKB/TrEMBL:C0R586"
FT                   /protein_id="ACN94928.1"
FT                   /translation="MKKIQAINELYNSIYEALKANSDLRKYVTNIYDYLPKQVTIPYLR
FT                   LRAVNYSNLHMLSNFATKARFSCDIYTYHINSMFAIIRHINLILKSIEGFSSEVILESN
FT                   CAMDQHDEILHSTINFDILIKGGDNEQITAKN"
FT   gene            71300..71689
FT                   /locus_tag="WRi_000670"
FT   CDS_pept        71300..71689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000670"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94929"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:C0R587"
FT                   /protein_id="ACN94929.1"
FT                   /translation="MSKLQLKIKDHDNNFIVLNNIRNLRFTLRNNREEVKDISSFGWRK
FT                   VLDCAGSRHITIKINGILDSVLADELLRNSAMLNSNNDYEISFNAKEKIRLRCSVELYE
FT                   RYYDPVTFDSFTVVLASAEVVNAFH"
FT   gene            71725..72540
FT                   /locus_tag="WRi_000680"
FT   CDS_pept        71725..72540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000680"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94930"
FT                   /db_xref="UniProtKB/TrEMBL:C0R588"
FT                   /protein_id="ACN94930.1"
FT                   /translation="MRILTKLKKIMNDKDLFEEDGDDIEENNDDKREKSLENENQQNQE
FT                   EQHKEEDKQYIIQYIQDYLKVFEDILNQIDEGIDNSDSYERTMQIKRSIDRLIETLYSQ
FT                   AASEDIDAEFETTKHTRDKSESMKRVREKRRKQVIEEVLSSMFAQQQKELMNAKHLSHG
FT                   HETAKDGDVHEAKEKVKSSIRGVLFSVIAHRMDPRRRAGETADGNEKQAHIYGREAVGG
FT                   ALGALLKTFLTAVVAVVREIAKPLQKPETSFAKQVEESRNADSQKGRSV"
FT   gene            complement(join(72945..73431,75457..76010))
FT                   /pseudo
FT                   /locus_tag="WRi_p00690"
FT                   /note="transposase, degenerate; disrupted by frameshift and
FT                   IS-insertion; ISWpi3"
FT   gene            73493..74325
FT                   /locus_tag="WRi_000710"
FT   CDS_pept        join(73493..73867,73867..74325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="WRi_000710"
FT                   /product="transposase, IS5 family"
FT                   /note="ISWpi1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000710"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94931"
FT                   /db_xref="GOA:C0R2R0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R0"
FT                   /protein_id="ACN94931.1"
FT                   /translation="MRKKYPTDLSEREWARIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKKVKGRKRHIITDTQGFILGCYVGAANENDRDGIKIALN
FT                   NMRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFWVHKDTPPELLPTR
FT                   EQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMSRVMLKREYA"
FT   gene            complement(74362..75372)
FT                   /pseudo
FT                   /locus_tag="WRi_p00730"
FT                   /note="transposase, degenerate; disrupted frameshift;
FT                   ISWpi10"
FT   gene            76084..76480
FT                   /pseudo
FT                   /locus_tag="WRi_p00760"
FT                   /note="HNH endonuclease family protein; Disrupted by
FT                   IS-insertion"
FT   gene            76477..76887
FT                   /locus_tag="WRi_000770"
FT   CDS_pept        76477..76887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000770"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94932"
FT                   /db_xref="UniProtKB/TrEMBL:C0R590"
FT                   /protein_id="ACN94932.1"
FT                   /translation="MKSTKLERSRMRLKVSRTVLKSSEEGRPSSLRQQYADETTEEDLR
FT                   KIAEKAPIIKLAYDELDRFSWNEKDLVAYEERIMDLRKEEGILAKKLDEGKIEGKIEVA
FT                   KNLLKADISIDIISQTTGLPQAEIKRLQEEIT"
FT   gene            76895..77899
FT                   /locus_tag="WRi_000780"
FT   CDS_pept        76895..77899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000780"
FT                   /product="GTP/ATP binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000780"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94933"
FT                   /db_xref="GOA:C0R591"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C0R591"
FT                   /protein_id="ACN94933.1"
FT                   /translation="MINEKIVRENLKKVIEQKSGKDVIALGIISSIIIKGQDVGFVLEV
FT                   AGNTQANEELRRNCEQAVKAIPGVTKVTVVATCQKQTGQQKAKLHIEGVKNIIVVASGK
FT                   GGVGKSTVALNLALSLAKLKHKVALVDADIYGPSIPKMLGAEKLKPEIQDSKAMPIEKY
FT                   GLHTISIGYFIDKDRAAIWRGPMITKALYSLLMGTKWSDIEYLIIDTPPGTGDVHLSLM
FT                   ENFNLTGAIIVSTPQELSLIDARKIYDMFTKLSVPVIGIVENMSYFIQSGSKIYIFGKD
FT                   GAKKMSEELGIKLLGRVPLDPQICHASDCGNPLMLSEDLAEIYEDIAQSIVKQ"
FT   gene            78626..79774
FT                   /locus_tag="WRi_000790"
FT   CDS_pept        78626..79774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000790"
FT                   /product="monoxygenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000790"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94934"
FT                   /db_xref="GOA:C0R592"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0R592"
FT                   /protein_id="ACN94934.1"
FT                   /translation="MNYDVIISGGGLLGLITAIGLSCDSVSVAVIEKNSLPRVVDDNRA
FT                   FAISQGSKKILEKLGIWQFVESEAEPILDICILDAVTVHYNHKMVSEEPMGYVINNATI
FT                   WNAINNNFLNKLNIYSPHSYKTIVCDSGYVEVILDNNQELISSLLICAEGKNSKLPELF
FT                   SIPTVKFDYKQSSIVFNVKHELHHQNLAVERFFPGGPFAILPMKGGYTSSIVWTEKSEI
FT                   SKMLMDLSEEEFIIELKKRFGSYLGEIKLEGERKLYPLSFAFAKKLYKGRVLLIGDAAH
FT                   SIHPVAGQGLNLGIRDVESVIKHVVAAKAAGTDVGSSYLLKKISRNRYFDNFTMALATD
FT                   GLNRMLSNRIFCAKALRNLGLIAVENSNFLKKRFIRHAMGFI"
FT   gene            80217..81179
FT                   /locus_tag="WRi_000800"
FT   CDS_pept        80217..81179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000800"
FT                   /product="transposase"
FT                   /note="ISWpi4"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000800"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94935"
FT                   /db_xref="GOA:C0R593"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0R593"
FT                   /protein_id="ACN94935.1"
FT                   /translation="MGQILHGCAKTTETIRRAIQNSKESIAKLSRYYNLNPKTIIKWRK
FT                   RSFAKDADMGPKHARSTVLTLEEEAVIVAFRKHTLLPLDDCLYALQTSIPHLTRSSLHR
FT                   CLQRHSISRLPDVDGEVKPKKKFKQYPIGYFHIDIAEVRTEEGKLYLFVAIDRTSKFTY
FT                   VELHKSATKPIAAEFLRNLIKILPYKIHTILTDNSVQFTNQKRHKYAFQHIFDRACEEN
FT                   DIEHRLTKVSHPWTNGQVERMNKTLKNATVKKYYYQSHQQLKEHLYDFVMAYNYAKRLK
FT                   TLKGLTPFEFISLQWTKSPELFILNPHHHTLGPYTPCVS"
FT   gene            complement(81182..81730)
FT                   /gene="pth"
FT                   /locus_tag="WRi_000810"
FT   CDS_pept        complement(81182..81730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="WRi_000810"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000810"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94936"
FT                   /db_xref="GOA:C0R594"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R594"
FT                   /protein_id="ACN94936.1"
FT                   /translation="MHLIVGLGNPGSQYELTHHNIGFITVDAICKYWGFQLFSKKADYL
FT                   ITSGMINDNKIMLIKPYSFMNNSGIPVAKIRNFYKLSLDNIVVIHDDADLELGRIKVKK
FT                   GGSSAGHNGLKSIDSFIGNDYWRLRFGVGRPEDQRSLADYVLSKFSNFDNVTPLVEKIA
FT                   KNIHLMLQGDNTAFINLIV"
FT   gene            complement(81730..82341)
FT                   /locus_tag="WRi_000820"
FT   CDS_pept        complement(81730..82341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000820"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000820"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94937"
FT                   /db_xref="GOA:C0R595"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R595"
FT                   /protein_id="ACN94937.1"
FT                   /translation="MTQQEIVTINAELRDITKTKAMHSLRKKGNIPGIIYGKGHDNVNL
FT                   TLSAKEFTKQYKSGSLSAHLIELNISGKKEYALVRDIQLHVVKDTVQHVDFQFVDKGSE
FT                   IKIDIPLSFVNESKAPGIKLGGVLNVLCRSIAVKCSPDKIPQVIEVDLSGKMIGQSIHI
FT                   NDVKLPEGVKFVAHEEENFTIVTISAADSDVEEPQAETEE"
FT   gene            82487..82786
FT                   /locus_tag="WRi_000830"
FT   CDS_pept        82487..82786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000830"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000830"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94938"
FT                   /db_xref="GOA:C0R596"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:C0R596"
FT                   /protein_id="ACN94938.1"
FT                   /translation="MGIDDKVIFRIYKPTRTATQSGLGNTNFWHLKIESGSYYIEPLMG
FT                   WVGSKDPKKQIVLKFDSLEKAVFYAKKRNVKYIIEMPKNVKRLPKSYASNFILK"
FT   gene            complement(83079..83390)
FT                   /locus_tag="WRi_000840"
FT   CDS_pept        complement(83079..83390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000840"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94939"
FT                   /db_xref="UniProtKB/TrEMBL:C0R597"
FT                   /protein_id="ACN94939.1"
FT                   /translation="MRTFCIISIVMFFLSIVGLFKVKLHVQSLNRELIKIKSEINLVQS
FT                   DIKVLQAEWSYLNNPKRLASLVKKYLKNNSLILASQVKNLDSLNGRSVLAQLKIHDQQ"
FT   gene            complement(83387..84268)
FT                   /gene="mraW"
FT                   /locus_tag="WRi_000850"
FT   CDS_pept        complement(83387..84268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="WRi_000850"
FT                   /product="S-adenosyl-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000850"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94940"
FT                   /db_xref="GOA:C0R598"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R598"
FT                   /protein_id="ACN94940.1"
FT                   /translation="MTHTPVLLKEMLSLLSPQDGGIYVDATFGAGGYSKAILESADCKV
FT                   YAIDRDETVTKFYDDLSVRYPDRIKLFIEKFSNIKNLLDSNNIEGIDGIVFDIGVSSMQ
FT                   LDNGDRGFSFLHDGPLDMSMDNSSYINASTFVNALREEEIANTIYNYGGERHSRKIARA
FT                   IVNARKKKTIKTTFELADIVRSVVFRGKSKIDPATRTFQAIRIWVNDELGELEKGIKAA
FT                   SEILSENGKLIVVTFHSLEDRIVKTFFKDLCATDCKTFSLLNKKVIEASIEEVSANPRS
FT                   RSAKLRAIQRLS"
FT   gene            84487..85734
FT                   /locus_tag="WRi_000860"
FT   CDS_pept        84487..85734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000860"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000860"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94941"
FT                   /db_xref="GOA:C0R599"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0R599"
FT                   /protein_id="ACN94941.1"
FT                   /translation="MQQITKVIFSSLICNTLLWYDHMLFGHLINIIGGVFFPSDDQLTS
FT                   VLKAFGVFAVGFLMRPVGAAIFGHIGDKHGRRVALLLSIILMTLSTVLIAFVPGYQSIG
FT                   ILASMLVVCLRLLQGISLGGEAGNAPFLIEHAPKNKKGFFGSIEVLSAIFGSVLSLIAV
FT                   LICKKVSDFESWGWRLPFIFSLAMGLISIYMRYILDESPEYKRQKNPSKLPLKELLNNY
FT                   KKPVLISIGIDLVENASLYIYLVFFNVLTNKILTVNTHFNHIVEILSQIALGGLTILFA
FT                   ILSDKVGREKVMKFAFIAFVIVSYPVFSMLCSGNYLLAHILFIIPIAASLGPVSALMCE
FT                   LFPTKVRYSGFGLSRNIAAGFFGGLAPFICTTIIKVTGQETSASFYMIFCALIGLVAIS
FT                   QIKGELSSKSPKVNQV"
FT   gene            complement(85762..86544)
FT                   /gene="map"
FT                   /locus_tag="WRi_000870"
FT   CDS_pept        complement(85762..86544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="WRi_000870"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000870"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94942"
FT                   /db_xref="GOA:C0R5A0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5A0"
FT                   /protein_id="ACN94942.1"
FT                   /translation="MNITIHSQEDFEFMRKAGRLAAKTLDFIAPYVKVGVTTNELNDLC
FT                   HDFIINAGAIPAPLNYRGYPKSICTSKNAVVCHGVPDNKPLKDGDILNIDVTVILNGWH
FT                   GDTSRMFWVGKPSIKAKRLCDATYHALMEAIKQVKPGNKLNEIGLAIEKYIRDFGYSIV
FT                   RSYCGHGIGKVFHAPPNVVHFYDQDENLVLKEGMFFTIEPMINAGKHETLLSKLDDWTV
FT                   TTRDLSLSAQFEHTIGVTKDGAEIFTLSPKNWHFPPYN"
FT   gene            complement(86677..87915)
FT                   /locus_tag="WRi_000880"
FT   CDS_pept        complement(86677..87915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000880"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000880"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94943"
FT                   /db_xref="GOA:C0R5A1"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5A1"
FT                   /protein_id="ACN94943.1"
FT                   /translation="MYSAVIAKPKRNVFAVLDIGTTKIICLIVKINGNFSYKVTGTGYK
FT                   IAEGVNGGSITNVKHANYSISSTIGLAEQVSEETIDQIYVNIAGCSISSFNVHNEIIAA
FT                   NHEISDRDIKRVVFQTFEKYIEENVIIHNIPLKYHLDDMTDIKEVGGLYGKRLSADVNV
FT                   VTASRPALTNIENCITNNGGLNMAGCIASAYSAGLACLSGDEKELGTAIVDIGGGCTAI
FT                   GIFKRGKLVYASSVPIGGVHITRDIAYGLCTSIERAEYIKILYGSTIVTSIDENEYITV
FT                   QNSENDEPTQVFKSELINIIRPRVEEILEMVREQFQEQKDPINKVVITGGTSQLTSMKE
FT                   IAGYIFNKQVRIGSPESLSGLDGEYDKNPVFSAAIGSIKLIVDTFYKNNSGILGQDGKM
FT                   SKLYNWVKSKVTV"
FT   gene            88054..88593
FT                   /gene="def"
FT                   /locus_tag="WRi_000890"
FT   CDS_pept        88054..88593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="WRi_000890"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000890"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94944"
FT                   /db_xref="GOA:C0R5A2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5A2"
FT                   /protein_id="ACN94944.1"
FT                   /translation="MSILPIVIAPDERLITRASEVTDINDKIKELVNDMFETMYDAEGL
FT                   GLAAVQVGVLKRIFVVDVQLETIENEPAGYGSTGKFYMINPEITELSDEQVILKEGCLS
FT                   IPEQSHEIKRPKYLTVKYKDLDNEEQTLKASGWLARCIQHELDHLNGILYIRHLSKLKY
FT                   DMAITKAQKIKKQHEQ"
FT   gene            88583..89395
FT                   /locus_tag="WRi_000900"
FT   CDS_pept        88583..89395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000900"
FT                   /product="uracil-DNA glycosylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000900"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94945"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5A3"
FT                   /protein_id="ACN94945.1"
FT                   /translation="MSNEDLELLKFYHEVGVDCTLMEGEEEKKLESKEPSVIQTGTQKK
FT                   DADTRWGDTKDGKDMFPSDWIIEARKLAGKCGSVDELRSAVKSFEGCEIKKTATNTVFS
FT                   DGNPNAKIMLVGEAPGANEDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFWRPP
FT                   GNRKPTDLELDMCRPFVEKHIALVSPQILILVGGIACYSLLDSTKTISNLRGRFHTYTN
FT                   QYLSNSITTAAIFHPAYLLRQPAQKRLAWEDSKKIREYLDNTNNCTNT"
FT   gene            90314..90526
FT                   /locus_tag="WRi_000910"
FT   CDS_pept        90314..90526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000910"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94946"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5A4"
FT                   /protein_id="ACN94946.1"
FT                   /translation="MAAGGKAKTASKNNPTQRKKAEQKMYKDKPVKPVRYIDRDSRMNY
FT                   MSAQYDNGNLVEDEVSGNPIKWEAV"
FT   gene            90511..92580
FT                   /locus_tag="WRi_000920"
FT   CDS_pept        90511..92580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000920"
FT                   /product="NADH dehydrogenase I, subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000920"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94947"
FT                   /db_xref="GOA:C0R5A5"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5A5"
FT                   /protein_id="ACN94947.1"
FT                   /translation="MGSCIIVVVKVTINSKECEVEHGLTIIQACEVVGVEIPRFCYHER
FT                   LAIAGNCRMCLVEVEGGPPKPVASCAMPVAEGMVIHTDTPKVKKAREGVLEFLLINHPL
FT                   DCPICDQGGECDLQDITMAYGKGTSRLDEHKRAVPKKHFGPLIETAMNRCIHCTRCVRF
FT                   LSDVAGTNELGGIGRGENVEISTYIKRHISSELSGNIIDLCPVGALTSKPYSFTARPWE
FT                   LSHCETIDVLDAVGSAIRVDYRGPEVMRILPRLSEEVNEEWISDKTRFAYDGLKVQRLD
FT                   QPYIKKDGKLAPVDWNEALTVAAKKLKNTKSNKIAAIAGDLADCESMLLLKEMMQKLGS
FT                   GNIDCRQDGAKLIPSNRGSYVFNTTIEGIENADLCLLINTNPRIEAPIINVRLRKRYLQ
FT                   GNFPVASVGPNIEYLYHVEKLGDNPDILSEIANGNHKFCELLVAAQNPMLIIGQDALIR
FT                   DDSESVLILAGKIAEKFNMVRDDWNGFNVLHKAAARVGGLDIGFVPEKGERDINQILEH
FT                   AESGETEVVYLLGADEIDTSKLENTFVIYQGHHGDKGAHVADVILPGAAYTEKYATYVN
FT                   TEGRVQRTNLAVFPPGEAKEDWLIIKNLSQYLDLSLPYDSLFDVRKKLDTIGPQFRNAD
FT                   QVIKNTWVPISNGKINLSDTPFTLKECNFYMTDSISRASKIMADCTKAFYEHAS"
FT   gene            92564..93589
FT                   /locus_tag="WRi_000930"
FT   CDS_pept        92564..93589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000930"
FT                   /product="NADH dehydrogenase I, subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000930"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94948"
FT                   /db_xref="GOA:C0R5A6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5A6"
FT                   /protein_id="ACN94948.1"
FT                   /translation="MNTLVNILFILVPLLLSVAYLTYFERKVLAAIQLRHGPSVVGPFG
FT                   LLQPFADAIKLLIKEPIIPFRASTILFIMAPMLTFILALIAWAVIPFGAEVIVENGQQV
FT                   VIPKVIANINVGVLYVLAISSLGVYGVIIAGWSSNSNYAFLGAIRSAAQMISYEVSIGL
FT                   IVATVVITTGTLNLGEMVVAKHNMPFWVDLLLMPIGIIFFISLLAETNRHPFDLPEAEA
FT                   ELVSGYNVEYSSMPFALFFLGEYANMILASAMMTIFFLGGWYPPLELGLLYKIPGLIWF
FT                   VLKIIILLFVFIWIRATIPRYRYDQLMRLGWKVFLPISVFWVILISGVLLFTGNLPGSN
FT                   V"
FT   gene            93582..94577
FT                   /gene="hemB"
FT                   /locus_tag="WRi_000940"
FT   CDS_pept        93582..94577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="WRi_000940"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000940"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94949"
FT                   /db_xref="GOA:C0R5A7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5A7"
FT                   /protein_id="ACN94949.1"
FT                   /translation="MFNFPNTRLRRRRSSKWVRNLTSENSLSVNDLVLPLFVHDREETT
FT                   EPISGLPDVKCYSIDGLVSIVKEAKDLGINAVAIFPVVDSKLKSENAEEAYNSDNLICR
FT                   AICAVKLKVPEIGIIADIALDPYTIHGHDGILKDNQMDVENDETISVLCKQALALAKAG
FT                   CDIVAPSDMMDGRIGRIRKSLDDNNFQDVLILSYAVKYCSSFYAPFRQVVGSCGLSHSI
FT                   DKSGYQMDYKNAREAMCEIEMDINEGADFIMIKPGMPYLDIIKTASDKFNFPIFAYQVS
FT                   GEYAMIKAAANNSWLDYDKVIYESLIGFKRAGASAIFTYAALDIAKNLSA"
FT   gene            94724..95482
FT                   /locus_tag="WRi_000950"
FT   CDS_pept        94724..95482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000950"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94950"
FT                   /db_xref="GOA:C0R5A8"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5A8"
FT                   /protein_id="ACN94950.1"
FT                   /translation="MGIFFKFLGKMLGKVFPAKTVSSLLGIGYLPSWQNYWSSFLILFI
FT                   VDVILILTYGGEYLLYKMPGSGIVVAAVFTKLAIVMLVMQLIGIFIFHAQDPSANSGEE
FT                   IVIQIASGQVLTVALSMPAIMSIYYAVSKLYGNICKQMFQCPFWFNDFMHFFFFLMIPY
FT                   VFFNVVEVIKPWPISSIQLSYNNAMSITFEGIFHTFYAVILLYLTAFIFCDLTMHDAIV
FT                   LNKSIIQYVRESSAVLGDYLHDTVKKIGIE"
FT   gene            95527..96366
FT                   /gene="glyQ"
FT                   /locus_tag="WRi_000960"
FT   CDS_pept        95527..96366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="WRi_000960"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000960"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94951"
FT                   /db_xref="GOA:C0R5A9"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5A9"
FT                   /protein_id="ACN94951.1"
FT                   /translation="MNLQSIIKELQDFWASEGCVILHSYTSEVGAGTLHPATIMSAIDT
FT                   KPTKIAYLQPVIRPADGRYSDNPNRLYQHHQYQVIIKPSGNNLQDVYLDSLKVLGISTE
FT                   KCDIKFVEDDWENPSVGASGLGWEVTCNGMEVTQLTYIQQVGGIDCKMIPGEVAYGLER
FT                   LAMCIQGVDNVYDIIWNDNGVTYGDIFKQREYEFSYLALDYYDTKVVQQQFEDTEKLCK
FT                   FLIEKELPMAAYDQCIKTSHLLNLLDARGVLGVNERTAYIGRVRELTKKCCELYMSK"
FT   gene            96370..98487
FT                   /locus_tag="WRi_000970"
FT   CDS_pept        96370..98487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_000970"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000970"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94952"
FT                   /db_xref="GOA:C0R5B0"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5B0"
FT                   /protein_id="ACN94952.1"
FT                   /translation="MSLQLLFECLSEEIPPRMQNSATVQVKSCIANVFNKNNVKFTSME
FT                   VFITARRITLFVDNINALELKDSNNEVKGPNINAPKSAIEGFLRKYQKNEEDLLVRKVN
FT                   NEDFYFIKRESCSFNIREFLKNQLEEMLKNFSWLKSMRWGEGKERWVRPIKNILCILND
FT                   EIIPVSFAGITASNTTYGHRFLSSGTALTVKAPKDYFELLEKNSVILQMDKRKQFILDQ
FT                   INKFTKEQNLQLEKNDYLLNELTGLIEWPIVLFGEVNQEKSFGLPKEVILSIVNTQQKY
FT                   LALSNGKRISHFVTVVNVNNGEVVKGHERILEARLADAQFLISQDKKENLDYYVKKLGS
FT                   ILFHASLGSVGEKVKRITALSKYIAIFIPHASLIKVERAAYLAKADLATSIVREFPELQ
FT                   GVMGGYYASYFQEDREIVEAITEHYKPIGPEQECPKSPSAIAVSIADKVDSLVGLIAAG
FT                   EKISGSYDQFGLRRMTIGIIRTILENNLHIPIRLMIDKSVSLYSRLLFNKNTTSVDKPN
FT                   RKQISELVFRFCLERFKVILKNRDIRQDIVDSILYKIGINDLLTAEKQTVILDRYLSMP
FT                   EGEQILSTYKRVSNMMSKVRKSDGTTYSASYGKRFLIENEEIALSNCAITACKNIKQAI
FT                   KNNHFNAALDELAGFAPFINQFMDSVKINCDSDKLRRNRLSLLENVVSIFHLVADFNLI
FT                   QVKQWINAQAI"
FT   gene            98471..100288
FT                   /gene="uvrC"
FT                   /locus_tag="WRi_000980"
FT   CDS_pept        98471..100288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="WRi_000980"
FT                   /product="excinuclease ABC, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_000980"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94953"
FT                   /db_xref="GOA:C0R5B1"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5B1"
FT                   /protein_id="ACN94953.1"
FT                   /translation="MLRQYKEQIKSSPQSCGVYKMVGDKNKVLYVGKAKNLKSRLSDYL
FT                   QFENLSERIRVMLSQVIKVEIFITENEIEALLLEAQLIKSLKPLYNIVLKDGKFYPYIT
FT                   ISKHDYPRIAKYRGKFKKNEFHYYGPFTSAAAVKQTILSLQKAFLLRVCSDQYFSSTKR
FT                   PCIEYQIKRCSAPCVDKITKDDYCQSVKQARNTLLGRNKEVKEQLLFTMRKCSSEENYE
FT                   LAAIYRDRVKFLEQIQIQHTDFSFEKDADFFSIVREEDLACISVLSFRNKDNYGSTPYF
FT                   AENCGDHSNDEILSTFLVNFYNSANIPPIQIYVPDSIVDKEIIEQALYKVAQKPVKVLH
FT                   AKNKKERDLLKFVYDNSQHSLEQKLIDYRNNLEKLEELSKIFLLPNIPKRIEVYDNSHI
FT                   FGNQQIGVMVVAGQEGFLKSEYRKFTIKEKFSGDDYKMMREVLTRRFSGNIKGIIPDFL
FT                   LIDGGPGHVSIVQNVLEVLNINVPFACMAKGPDRNAGNERFYMLGREEFSLANDSKVML
FT                   YLQSLRNEAHRFAITSHRKKRDKQFIVSQLSKIPGIGNKRKKALMSYFGSVKNISKASL
FT                   AEIQNIPGISKGLAEVILKHVNYKRGVLE"
FT   gene            complement(100393..100466)
FT                   /locus_tag="WRi_t00990"
FT   tRNA            complement(100393..100466)
FT                   /locus_tag="WRi_t00990"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGG"
FT   gene            100614..101387
FT                   /locus_tag="WRi_001000"
FT   CDS_pept        100614..101387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001000"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001000"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94954"
FT                   /db_xref="GOA:C0R5B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5B2"
FT                   /protein_id="ACN94954.1"
FT                   /translation="MLVNNIGYFYNNQNDFALSNINIKVKKGNVACLLGHSGCGKSTIL
FT                   KLIAGIENPKSGTIFINDRLVASNKASVAIEHRNIGLIFQHSALFPHKTVVENITFAIR
FT                   SSSKREKHLIALEILKLLNIEKYENMYPNALSGGQQQLVAIARVMAQNPDVVLLDEPFS
FT                   NLDILLKCRIRQHILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGKIIQSGVSSDI
FT                   YHKPKDDTLAKFFSELSSTLQLSEKFPLIRCKKII"
FT   gene            101504..101683
FT                   /locus_tag="WRi_001010"
FT   CDS_pept        101504..101683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001010"
FT                   /product="Sec-independent protein secretion pathway
FT                   component, TatA"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001010"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94955"
FT                   /db_xref="GOA:C0R5B3"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5B3"
FT                   /protein_id="ACN94955.1"
FT                   /translation="MEVKMSLGPWQLFLVLIIILVLFGAGRLPQVMGDLGKGIKNLKQE
FT                   LKDSEKLSSNEPDR"
FT   gene            101850..102506
FT                   /locus_tag="WRi_001020"
FT   CDS_pept        101850..102506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001020"
FT                   /product="exopolysaccharide synthesis protein ExoD-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001020"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94956"
FT                   /db_xref="GOA:C0R5B4"
FT                   /db_xref="InterPro:IPR010331"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5B4"
FT                   /protein_id="ACN94956.1"
FT                   /translation="MQKSEKLTKDKKLASDILKEVADTNNNDSNKVTLFDIKTALHERG
FT                   FGILIIIFSLPLSVPIPVPPGYTTILSIPLILFSLQLLFGFDSPWMPSWLERRSFQRST
FT                   LALVVEKTSPVLEKIEKFMKPRLSFIFYGPGEKILAFMMLLCAIIIALPLPFTHFLPAI
FT                   GTTLISLGIMSKDGFLSILGVLVSLCALLLTLIVILKGPQLITGALSLLKSFTTL"
FT   gene            102597..103253
FT                   /locus_tag="WRi_001030"
FT   CDS_pept        102597..103253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001030"
FT                   /product="exopolysaccharide synthesis protein ExoD-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001030"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94957"
FT                   /db_xref="GOA:C0R5B5"
FT                   /db_xref="InterPro:IPR010331"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5B5"
FT                   /protein_id="ACN94957.1"
FT                   /translation="MSKNDKLTKSDKLASDILKEVADTNNNDSDKVTLFDIKTALHERG
FT                   FGILIIIFSLPLSVPIPVPPGYTTILSIPLILFSLQLLFGFDSPWMPSWLERKSFQRST
FT                   LALVVEKTSPALKKIEKFMRPRMSFIFYGPGEKILAFIMLLCALSIALPLPLTNFIPAI
FT                   GTTLISLGIMSKDGFLSILGVLISLCGLLLTLVVVVKGPQLIIGAFSFLKSFVYG"
FT   gene            103246..104619
FT                   /locus_tag="WRi_001040"
FT   CDS_pept        103246..104619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001040"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001040"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94958"
FT                   /db_xref="GOA:C0R5B6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5B6"
FT                   /protein_id="ACN94958.1"
FT                   /translation="MVRLYNTLTKKKELFIPIDKDHVKMYVCGPTVYDTAHIGNARSVV
FT                   VYDVLFQLLKFCYGKVTYVRNITDIDDKIINAASEKNSNIESITTYYIKAFHDDMESIN
FT                   CKKPTYEPKATENVDYIIKLIEHLLQSGHAYESDKHVYFNIESYHEYGALSGKKTDELV
FT                   PGSRVEVNENKKHPGDFVLWKPANDIDYKLSSYWNSPWGEGRPGWHIECSAMSYAYLGK
FT                   DFDIHGGGIDLQFPHHENEIAQSKSAFAGSMFAKYWMHNGFLTVNEEKMSKSLFNIVKV
FT                   RDLLDSGIKGEVIRYALLKTHYRKPLDWTENVISDAQETLNKFYRLSRGLDTINIDESN
FT                   AEISKDFIDALKNDLNIPEALAILHEMAAKINKMSNESEKLKLTESFVKSARFIGLLES
FT                   SYQEWFTAGVSHQEIERLIDLRRAAKQNKDYNTADKIRDQLKQIGVTISDNEDGTTTW"
FT   gene            104626..105045
FT                   /locus_tag="WRi_001050"
FT   CDS_pept        104626..105045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001050"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94959"
FT                   /db_xref="GOA:C0R5B7"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5B7"
FT                   /protein_id="ACN94959.1"
FT                   /translation="MENYFLLFTDSLVSSLVLPIHQGFVFNTMLYFRSYYTPLLMLFFG
FT                   VLGSSLGGIVNWYLGRITISIRKSYRKLENEHKTPKIVRNLLICAVASLSWVPALGSVI
FT                   QILSGYFKLNLYILAPLIILSNFFYLLYLILTFGV"
FT   gene            complement(105130..108414)
FT                   /locus_tag="WRi_001060"
FT   CDS_pept        complement(105130..108414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001060"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001060"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94960"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5B8"
FT                   /protein_id="ACN94960.1"
FT                   /translation="MYLEDDSTWGVKRIYHGITFQELLIVISLMSKMGKECSFSIDTEL
FT                   ESAQGFDDIVVRHEQNKGIVHEFTQVKHNQDGTEKISVSSLLTKSGKFSILKLFPAYLK
FT                   IKNSEKFSDGIKHFFVATNMDFDSPYSIQHKVRNLRAMLSGENKGKKLSFVRIDTKDEF
FT                   LDIGDSARYRISDSDGSAAQYLKQNMDFIKREIGKEVSNKEIEDFLNESVFVVNLPHEA
FT                   QLRELLLGKLSSRLNKKFDYIGNNQIFCNDLLKKISDWVKDIKARPLSYKEGEELFREV
FT                   ELWASTLGKIEQGVKEKNERIDKVIEQQHKDSKTLHKIYVAVTTQDNKRVGKPIQFNIK
FT                   HPVEMFVGRKNELQEIYDRLHKSTDKPMAISRIVVIGGSEGVGESELARKYACEYKEHY
FT                   DGNLVWVNAGTQKDLEESFKGLAKELNRRLPEGSKIFITDEDTEQEKGIRSIIKSVYRY
FT                   FKDVKSLFIFDNAREYKDISKFLPLSLYPDYKKPYVLITSRDNKWEARGDIEVIKLDIF
FT                   NKTEALGFIKKSLNIDDPLQDKEIKELMEKLQYLPLALKQVVVYIRNKNKESKLRGYGR
FT                   FEISDYLKECQRYTGKSLKEGVCKDEDCYAEAVSITCTITMTHIQKEYGCETLNILEIM
FT                   AYLAPDKIRIEEIFLKLIANDEDKLRGAVELLDRYSMIDLKEKVASIHRVVQRITRLKL
FT                   QKEGREEEVLRKALELVNIGGLTQGGMSHIASVWGYTSIYGKLIDNFYFNSSYVYGGTL
FT                   FIRKSTPLHLLAESGDCKAISAIVTHIEKHYPGEFVKTVNVKDNHGQTLLHIAAQSGNL
FT                   GVMKCLVNKGASTNTKDKYDNIPLHSAVYAGELDIVKYLVITNNNINAKGEDGRTPLHI
FT                   AAINGDLDMVEYLIKSYANIDAKDNYGMTPLHLAADVGELGIVEYLINEDAYVDARDEH
FT                   YRTPLFFAAENGKLNVVKCLIEKGANVNAENEYGETALHRAVYRATFSGDLRIVESLIN
FT                   KGANVNARDRNSKTLLHYSALSGSYNIAECLIQEGAGINAKDKDGNTALHLAVIRRKVD
FT                   ITKTLLKHNADVNARNNLGNTALDCAVDNCQELVELLLAHGASRDY"
FT   gene            complement(108426..109847)
FT                   /locus_tag="WRi_001070"
FT   CDS_pept        complement(108426..109847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001070"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001070"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94961"
FT                   /db_xref="GOA:C0R5B9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5B9"
FT                   /protein_id="ACN94961.1"
FT                   /translation="MTKEDWEAVIGLEVHAQVSSNTKLFSSSSTEFGAEHNTQVSLVDA
FT                   AMPGTLPILNYYCIEQAIRTGLALSAEINKYSYFDRKNYFYPDLPQGYQITQFFEPIVK
FT                   NGRVFINDNEKEIRIARIHLEQDAGKSVHEESKTYVDLNRAGVALIEIVSEPDLRSSAE
FT                   AAECMKKLRQILRYTGSCDGDMEKGSLRCDANVSVRLKGSNTFGTRCEIKNLNSIRHIV
FT                   QAIDYEIQRQIEILESGEEISQDTLLFDVASGKTKVMRSKEDASDYRYFPEPDLLPVEV
FT                   SQEKIDLIQSSLPELPDQKKLRYIEELGINEYDANVITSDKAIADYFEELIKKHDSKLA
FT                   VTWLTVELFGRLNKANIDIVSSPIKANALSELLDFIVDGTISAKLGKQVFDIMFETGKP
FT                   ASLIIEEQDLKQITDKCQISEVIDKIINSNQDKVQEYKSGKTRLYGFFVGEVMKLTKGK
FT                   ASPDVVNSILSERLG"
FT   gene            complement(110405..111787)
FT                   /locus_tag="WRi_001080"
FT   CDS_pept        complement(110405..111787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001080"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001080"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94962"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN94962.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            112684..113706
FT                   /locus_tag="WRi_001090"
FT   CDS_pept        112684..113706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001090"
FT                   /product="transposase"
FT                   /note="ISWpi7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001090"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94963"
FT                   /db_xref="GOA:C0R2Q0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q0"
FT                   /protein_id="ACN94963.1"
FT                   /translation="MINNFLGIDVSKERFDVSLSFISKKGKRETRKRKFKNDDTGFQGL
FT                   LNFLQKHNVEEVKACMESTGCYSEALAEFLHNAGYFVSVVNPACIRFYAKSKLTRQKND
FT                   QTDAEIIADYCQRQEPSRWTPPSPEKKKLKHLYRCSNALKDELTLANNHLEKKERLPKE
FT                   VANAWEDLAMNIEQKIETIKNSIRELLKQHKELLEDFQLLLTIPGIGEETAIAILAEIP
FT                   GIKAFINARQLAAYAGTIPQNITSGSSVHAKPRLSKTGSRTLRKAMYFPAIAAKKHNPI
FT                   IMASCERLKEKGKHAMAIVGAAMRKLLHIVFGVLSSKKAFDPDHIKNYRAKRLTEGLVL
FT                   "
FT   gene            114087..114554
FT                   /locus_tag="WRi_001100"
FT   CDS_pept        114087..114554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001100"
FT                   /product="putative holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001100"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94964"
FT                   /db_xref="GOA:C0R5C2"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5C2"
FT                   /protein_id="ACN94964.1"
FT                   /translation="MLHRNPDEFLKSIPKDKRIMCLDMGEKQIGIAFSDKTQLIATAHS
FT                   IYHRKNMSKDLGYLHRIFKENEAGSMVIGIPLNIDEQETKWCKTIIQFANKIIKKYKVN
FT                   TYLQDESLSTSIATHTLKITGISITKSKKIDDKISACIILQRTLDKINTIK"
FT   gene            complement(114599..115087)
FT                   /gene="ruvC"
FT                   /locus_tag="WRi_001110"
FT   CDS_pept        complement(114599..115087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="WRi_001110"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001110"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94965"
FT                   /db_xref="GOA:C0R5C3"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5C3"
FT                   /protein_id="ACN94965.1"
FT                   /translation="MVKIIGLDPGISKTGWAIISLNEKNNIEFLGGGTISTDGKLGTGE
FT                   RLHIIFEQLKKVISLYSPNEAAVEKIFVNKNPKSSLTLGYARGVVILALKITKLTMNEY
FT                   DANYVKKSITGNGHADKDQIIFMVKQIVKNLNIKCHHAADALAVAICHAYTKGSCFVE"
FT   gene            complement(115088..115915)
FT                   /gene="coxC"
FT                   /locus_tag="WRi_001120"
FT   CDS_pept        complement(115088..115915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxC"
FT                   /locus_tag="WRi_001120"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001120"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94966"
FT                   /db_xref="GOA:C0R5C4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5C4"
FT                   /protein_id="ACN94966.1"
FT                   /translation="MKSKEHDFHLVDPSPWPIAVSAAILILALGLVGALHKQIVGMFCL
FT                   VLGISAVSGVLFYWWRDVIREAIYDKCHTAIVKHGLKFAMYLFILSEVVFFIVFFCSFF
FT                   KAWLDPVFLFEAFSPAKKVEWPPEGILPPDPWSLPFMNTLILLLSGTTITWANHSLLKN
FT                   DKKSMIKMLSITILLGVFFIIVQAIEYHEASFSLQETGEKLIYTSNFYMITGFHCAHVI
FT                   IGIIFLSVCLFRARKGQFTLQDHLCFEFASWYWHFVDVVWIFLFLFVYWLSVY"
FT   gene            complement(115963..116622)
FT                   /locus_tag="WRi_001130"
FT   CDS_pept        complement(115963..116622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001130"
FT                   /product="transcriptional activator, tenA family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001130"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94967"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5C5"
FT                   /protein_id="ACN94967.1"
FT                   /translation="MFSGIIRSCYGSNLLKDIIEHPFNVELVNNTLNIENFKFYTQQEA
FT                   LLLGDYIRATLIAASRMEDYSSIILLAEVAQRAVTASKVLHDYCFAIYGINRGKKSLEC
FT                   FNFTNFLLSISYSNTYEAMTVLYSCMFIYETVVDSMKNRFKKNNRYRDWFNFCYSDSVK
FT                   SGCIILENIVDGYCSRARENEKSRMLELFRITAQFVLDFLNGAYNFSRFNQFPKEH"
FT   gene            complement(116667..117350)
FT                   /locus_tag="WRi_001140"
FT   CDS_pept        complement(116667..117350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001140"
FT                   /product="transcriptional activator, tenA family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001140"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94968"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5C6"
FT                   /protein_id="ACN94968.1"
FT                   /translation="MYNEIEGELYNVIVKEFSDLIDKIKEHPFNVELINNTLDYEKFKF
FT                   YLQQDFLYCIDCARAFLIVPARVDDIEMMSSLINLAQGAFYVREQYKKYFEDCDLSDDH
FT                   KKSRACSAFTDFFMSAAYHNSVNEALVASYSCFNIYQIVIRHMVNEITTKGVKNNKYKE
FT                   WINIYSSETVNAVIDEITDITNKLYKKASDCEKKRMYEFFKKGLELEIMFWDEAYYSNI
FT                   SSKEY"
FT   gene            complement(117477..118649)
FT                   /locus_tag="WRi_001150"
FT   CDS_pept        complement(117477..118649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001150"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001150"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94969"
FT                   /db_xref="GOA:C0R5C7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5C7"
FT                   /protein_id="ACN94969.1"
FT                   /translation="MSLYKNLVTSESVAAGHPDKVADQISDAILDEYLFTDPFARAAIE
FT                   TLVTKDNVIIAGEVFGPNIKNSRIESIVRNTIKDIGYEHDGFHWRKVKVNILLHEQSND
FT                   IAIGLDQGAGDQGIMYGYATTETKNLMPAPIFYAHSILKNIMSAVKEAKLGPDAKSQIT
FT                   LAYENNLPVRAESIIVSIQHPEDLDQSKVKEIIYPYIVSSLPEGWMCPEENLLVNPTGR
FT                   FVIGGPVSDCGLTGRKIMVDTYGGYIPHGGGAFSGKDATKVDRSAAYMARYLAKNIVFA
FT                   GLAERCLVQLSYAIGVSKPTSFYIDTFGANTVEEGVIKKFIENNIDLSTKGIIKHLSLN
FT                   HPIYKRTACYGHFGKQSERDGGFSWENMDLSADLCREFNIEGNSKISLDC"
FT   gene            complement(118710..118783)
FT                   /locus_tag="WRi_t01160"
FT   tRNA            complement(118710..118783)
FT                   /locus_tag="WRi_t01160"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUC"
FT   gene            complement(118793..119062)
FT                   /gene="rpmA"
FT                   /locus_tag="WRi_001170"
FT   CDS_pept        complement(118793..119062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="WRi_001170"
FT                   /product="ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001170"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94970"
FT                   /db_xref="GOA:C0R5C8"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5C8"
FT                   /protein_id="ACN94970.1"
FT                   /translation="MATKKSGGSSCNGRDSAGRRLGIKKNGKVIPGNIIVRQRGTKFHP
FT                   GKNVGIGKDHTIFAKIEGWVSFRRSANKKTFIDIVPTDNMKASA"
FT   gene            complement(119073..119375)
FT                   /gene="rplU"
FT                   /locus_tag="WRi_001180"
FT   CDS_pept        complement(119073..119375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="WRi_001180"
FT                   /product="ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001180"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94971"
FT                   /db_xref="GOA:C0R5C9"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5C9"
FT                   /protein_id="ACN94971.1"
FT                   /translation="MFAVIETGGKQYLVKEGSIIKVEKLEAEEKKEVEINKVICISNNG
FT                   LSYSSNATVKAEVLEQCRGEKIIIFKKKRRKNYRRKTGHRQYITVLRINEISLQK"
FT   gene            complement(120589..121881)
FT                   /gene="glmU"
FT                   /locus_tag="WRi_001190"
FT   CDS_pept        complement(120589..121881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="WRi_001190"
FT                   /product="bifunctional protein GlmU"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001190"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94972"
FT                   /db_xref="GOA:C0R5D0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5D0"
FT                   /protein_id="ACN94972.1"
FT                   /translation="MISKTHTFVILAAGHGRRMNSDLPKVLHKIGNFSMLQHVIYNAKQ
FT                   LNPENIAVVVDQPLIERLKCFEDIQLITQESTLGTGDAVKTAMRNLKELPDSNIVVVQY
FT                   GDTPLIKSSTITKMISYLEGKALVCLGFRASNKEYGRLIIENGSLREIVEAKSDKNNHE
FT                   EFLANAGIMVAYAKNLRELVEKIECNSSTHEYYLTDIVSIAVKSNLNVGYVITGGEEAT
FT                   GINNRNDLIKAEFYFQENKRKIFTDAGVTLVAPETVFFSLDTQIARDSVIYPYVFFGTG
FT                   VKIESGAKILPFSHLENCLIKSNAEVGPFTRIRGNTTIGNKAKIGNFVEVKTSEVGQNT
FT                   RIKHLSYIGNAKVGQESNIGAGTIVCNYDGKNKHETNIGSNCFVGANSSLIAPLNIHDE
FT                   SVIAAGSVIVEDVPEKSLAIAREKQVTKRIK"
FT   gene            complement(121882..122925)
FT                   /gene="pheS"
FT                   /locus_tag="WRi_001200"
FT   CDS_pept        complement(121882..122925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="WRi_001200"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001200"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94973"
FT                   /db_xref="GOA:C0R5D1"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5D1"
FT                   /protein_id="ACN94973.1"
FT                   /translation="MNKELLDDILSLEDKAVSEIENASSLQDLEKVRLSYLGKKGVIKA
FT                   YFDNLKEIEDAGKKRNLGEVINVLRNKLDQLIMNKENILKAEEVNFKLQNEAVDITLPA
FT                   RPEKIGKVHPLSKVINEVKLIFAHMGFKAVDGPDIEDEFHVFDALNTPSHHPAREEQDT
FT                   FYLKNKRNDKRMVLRTHTSSVQIRTMEKTKKFPIKIVAPGRVYRNDFDATHTPMFHQIE
FT                   GLYVDENVNMGQLKFTIHHFLNKFFGDKGLKIRFRNSFFPFTEPSAEVDISYKGSKWIE
FT                   VLGCGMVHPNVFQNVGIDHTKYNGFAFGIGIERLAMLKYQISDLRSFYDNKISWLDHYG
FT                   FHFSSLR"
FT   gene            123072..124802
FT                   /locus_tag="WRi_001210"
FT   CDS_pept        123072..124802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001210"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94974"
FT                   /db_xref="GOA:C0R5D2"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5D2"
FT                   /protein_id="ACN94974.1"
FT                   /translation="MHNSNTETKNKYKIEDLPKLFKEKSRNISKAFSSETIKISTIRSR
FT                   SIESNIQEFSFELTATDKDTFNIRLFRINSLINFFKICLSREKNFTANIKVPKESSELY
FT                   NNYCKTNSYKTVKEFVNNAPPQILLQGTTITLQTDVENINLDNLHQIELFLNEKLQHAE
FT                   KTENEDKKEQSEANQKNAQNRQIVPVTGSFGFDVTNNGKQVTRASIAVAVMHENVFWFR
FT                   SFFCLPNLFNTSQFFSQQLPKFSIQSNNILFGVIPALDQEKRNMDPSSQATRMTGGSIE
FT                   NPIPQEAEQNVGQTTSHTEYFKANRKKKSKKQTKELSEKEKPLAIKQAQNDARVAMIDN
FT                   QIEHRGKKLDKIFIEVMSGYKNQDPETFCNIFSSVFNIVYFQDKQLHAILEPGEISEVL
FT                   QILERPQPLSNSLLGKEYLQKQVYRKKEQLLKLVSGVYIQQPSPQHENTPHKSTNPLPI
FT                   KDLSPATNEAKTLPPTNITLKSPLKTVFSSKKAYFCLFIILASASTLCLWHFPLGKVSM
FT                   LKGLVPPEKRESIGLALNIGLPILIALCILNLARFIYSEYSIESIKQVSENDPLSRAYS
FT                   "
FT   gene            124984..125580
FT                   /gene="ribE"
FT                   /locus_tag="WRi_001220"
FT   CDS_pept        124984..125580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="WRi_001220"
FT                   /product="riboflavin synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001220"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94975"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5D3"
FT                   /protein_id="ACN94975.1"
FT                   /translation="MFKGIITDIGTITDTTTHSNSDQIFHIKTQNLSSINKGDSIACSG
FT                   VCLTVVDIMSDTFTVQASQETMKVANLNTWRIGKKINLEQAMRLSDKIDGHLVQGHVDG
FT                   IVKFLTINQNLDSHEIKLSCPQELIKFVAKKSSVTLDGVSLTVNSVVNQEFTVNITPYT
FT                   WENTTFQYNKVNDYLNLEIDMIARYLDQLMQHKYN"
FT   gene            125638..126228
FT                   /locus_tag="WRi_001230"
FT   CDS_pept        125638..126228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001230"
FT                   /product="membrane protein CvpA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001230"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94976"
FT                   /db_xref="GOA:C0R5D4"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5D4"
FT                   /protein_id="ACN94976.1"
FT                   /translation="MLFDSLIIFIVVLCVIISVTRGFIKELCALMFLFLSVFLTANHYD
FT                   FFTPNYSKYFDSKVTLNILSTISVFIILNLIFMIINNWLMYILLPIRLGFIDRVTGIFL
FT                   GVLKGILLSYVLFFAVHLYCYTVYDKKEGEYKIEAEDILPNWIINSHSYQALFVTAEEV
FT                   IDIYVPESLILKIKEIGGEMVDQEKPKNNKKEE"
FT   gene            126380..126708
FT                   /locus_tag="WRi_n01240"
FT   tmRNA           126380..126708
FT                   /locus_tag="WRi_n01240"
FT                   /product="10Sa RNA (tmRNA)"
FT   gene            126706..127143
FT                   /pseudo
FT                   /locus_tag="WRi_p01250"
FT                   /note="hypothetical protein; invalid start codon"
FT   gene            127344..127565
FT                   /locus_tag="WRi_001260"
FT   CDS_pept        127344..127565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001260"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94977"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5D5"
FT                   /protein_id="ACN94977.1"
FT                   /translation="MANSGINIALSEETLKHLAELSEFTKQPVQELAGKLFREAVELEM
FT                   EDFLVSKISDERDVEGAETVDFEDIKWD"
FT   gene            127556..127831
FT                   /locus_tag="WRi_001270"
FT   CDS_pept        127556..127831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001270"
FT                   /product="Putative addiction module toxin, RelE/StbE"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001270"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94978"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5D6"
FT                   /protein_id="ACN94978.1"
FT                   /translation="MGLERYKVKSLKSVVEKDLPNLPKIIRLRVQKAIKERLTVDPINF
FT                   GEPLHHNLKGCRRLRVGDYRVIYRVNQLDHIVTITEIGHRDDIYKK"
FT   gene            128003..128278
FT                   /locus_tag="WRi_001280"
FT   CDS_pept        128003..128278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001280"
FT                   /product="YggT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001280"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94979"
FT                   /db_xref="GOA:C0R5D7"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5D7"
FT                   /protein_id="ACN94979.1"
FT                   /translation="MHPIIYLLNTLLDLYSFILICWVVLNWLIKLNMVNIYNEIVSSIM
FT                   HILNQLTYPPLKIIRRYIPPFNGLDLSIMILLIAIRFVQYTMNYYF"
FT   gene            128283..130397
FT                   /gene="ftsK"
FT                   /locus_tag="WRi_001290"
FT   CDS_pept        128283..130397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="WRi_001290"
FT                   /product="cell division protein FtsK, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001290"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94980"
FT                   /db_xref="GOA:C0R5D8"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5D8"
FT                   /protein_id="ACN94980.1"
FT                   /translation="MLKRYLKAAVYLSLLIYIYISVFSYNYKDPSLNTATNEKVTNLGG
FT                   IVSSYLADILVQFLGLTSVTIATTIVYLLIFRPSKRLLKILYLILINLGICAILPQLSL
FT                   GITARYRHSGIIGNALINNCPFYIFVIVTSIGLVGSVGWKRTIYSLFFLCKKIACLFVN
FT                   VPFFRSHKTTEYSIAPLVVEEKHRTKITTKQQPKERQKKATEEVLSEFKFPSIHLLSKA
FT                   EESLQRKQLNEMESNKNLSLLEQVLSDFGVQGKIISVCYGPVVTLYKLEPQAGTKSARV
FT                   IGLADDIARSMSALSARISIIRGQNAMGIELPNKEREIVMLRDLLESPEYQNANLNLPI
FT                   ALGKEISGKPVIADLTKMPHLLVAGTTGSGKSVAINTMILSLVYRLSPDECKMIMIDPK
FT                   MLELSIYDAIPHLITPVVTEPKKAVVALKWIVKEMENRYRMMSYLNVRNVINYNQRITE
FT                   AMNSGIELKRVVQIGFNSTTGKPLFEKLPIKMETFPYIVVIVDEMADLMLVAGKEIECS
FT                   IQRLAQMARAAGIHIIMATQRPSVDVITGVIKANFPTRISFAVTSKIDSRTILGEQGAE
FT                   QLLGMGDMLYMASGGKIIRIHGPFVSDDEVQDIVDHLKMQGEPNYMEEITKEDENSSVE
FT                   SEGETEDEENDLYNQAVAIIQRDQKVSTSYIQRQLRIGYNRAANIVERMEKEGVVSAPN
FT                   YSGKREILVE"
FT   gene            130579..131022
FT                   /locus_tag="WRi_001300"
FT   CDS_pept        130579..131022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001300"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94981"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5D9"
FT                   /protein_id="ACN94981.1"
FT                   /translation="MALSKFLDPKLDLTFKKIFGTEKNKNILIHFLNDILGCTEVNTIQ
FT                   EVEFLSTIMDPEIASDRQSIVDVLCRDSSGSRYIIEMVRPESLRSYCLKGEEFLQKETE
FT                   RILKLIKPDVLPSESTHQCESGNRLVPSDADNEPPLEKEDAQS"
FT   gene            131183..131449
FT                   /locus_tag="WRi_001310"
FT   CDS_pept        131183..131449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001310"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94982"
FT                   /db_xref="UniProtKB/TrEMBL:C0R416"
FT                   /protein_id="ACN94982.1"
FT                   /translation="MYANNNSTGIEKSPNPLLYDRRNRVSLYFRLHGKQTARNADGSAG
FT                   KGEWRKRMPFCNEMDRICNINSRENEQTSVWSLVTRNFVNHLR"
FT   gene            131458..133005
FT                   /locus_tag="WRi_001320"
FT   CDS_pept        131458..133005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001320"
FT                   /product="reverse transcriptase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001320"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94983"
FT                   /db_xref="GOA:C0R417"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:C0R417"
FT                   /protein_id="ACN94983.1"
FT                   /translation="MITSKPVSASTESFEAWKQLPWKKCQKVIVRLQRRIVKAVQKGRW
FT                   GKVKALQHLLTRSFSGKALAVKRVTENQGKNTAGVDRQLWSTCNAKFQGIKQLKQRGYK
FT                   PSPLKRIYISKSNGKRRPLGIPSIKDRAMQALYLFALEPIAETISDRHSYGFRPKRSCA
FT                   DATVACHLLLASRNQLQWILEGDIKGCFDNINHEWLMKHIPMEKKILHSWLKAGFLESK
FT                   TLYPTTAGTPQGGIISPILANLALNGLEKLLESRFGKLGSRRRNKIRSGVNVIRYADDF
FT                   IISGFTHEVLENEVKPLVSSFLHERGLILSEEKTKITSITTGFDFLGCNVRRYNKKLII
FT                   KPSKESIKRLLNKARTLIKANIENTQAIVIKSLNSLLRGWGNYYHHVCAKKAFRKIDNE
FT                   IWHSLWKWAKKRHPRKGLRWIKNRYFKVMGQRQWVFAAPICKNKPKEIRYLRLLKLIDI
FT                   PIRRHVKIRADANPLDLKWKKYFDERVKRTRMLASSFSREGSLLLVSPLRMMFPEES"
FT   gene            133002..133736
FT                   /locus_tag="WRi_001330"
FT   CDS_pept        133002..133736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001330"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94984"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5E2"
FT                   /protein_id="ACN94984.1"
FT                   /translation="MKDKPVLEKKNLDKGLKRSVGKPACCVSKGGGSSNTASLPDQLAR
FT                   DKGFEKRAQLYAAKAYSRQADKNYINLKKVFFIAISNGMLFPEEVEYISTHNIRDIKTN
FT                   GHYLKDFQFVFIELPKFSKSRVEELESTIERWCFFFKHAEETTDEDLKKIAEESPIIKL
FT                   AYDELDKFHWSEKDLLAYEERVMDLQKEEAILEYRLDLAEEKGVRKGKIEVVKAMLANN
FT                   VDVNTIVKFTGLSMSEIKELQN"
FT   gene            133933..134469
FT                   /locus_tag="WRi_001340"
FT   CDS_pept        133933..134469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001340"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94985"
FT                   /db_xref="GOA:C0R5E3"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5E3"
FT                   /protein_id="ACN94985.1"
FT                   /translation="MVKGILCNWLGVTELQESQKIDAEQFEKVFGALKEWQEAQKIDAK
FT                   QFEEVFSALKEWQEAQKIDAEQFEKVFSALEDKIGTEQFQAMQEHLNGLQEKVETLAEA
FT                   VADQEKTLLICTIATAVAVIAITSFVAFCIYQGVKCEREKEKNLSKDTPDAKLNNVDAT
FT                   DGTKKLRNDLKVANI"
FT   gene            134666..135286
FT                   /locus_tag="WRi_001350"
FT   CDS_pept        134666..135286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001350"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94986"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5E4"
FT                   /protein_id="ACN94986.1"
FT                   /translation="MLRIFSKVLFILMFLVSSFFTVHSAEAKSKLSKRYIPPGNPGGAS
FT                   FHTDEDFAESYKLYEKRRELLKKKKSQDRAINKEDLIKKLKEKKIASLDNEPNDMEACI
FT                   VDDEESAMINQHGINITRLKGAVFIDQEPVSQYENKQHESEQQEGKKVTSTREKKVSPI
FT                   NITIKETPSRRTCSHDSIANLDNVDAYSLNGSSSFGSVADTVK"
FT   gene            135312..136592
FT                   /locus_tag="WRi_001360"
FT   CDS_pept        135312..136592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001360"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001360"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94987"
FT                   /db_xref="GOA:C0R5E5"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5E5"
FT                   /protein_id="ACN94987.1"
FT                   /translation="MLDKDLILNDNTYELSQISRHKTHVVEVGKVKIGGNNPVVVQSMA
FT                   LGVHIDADNIKSSAKHYAKEITELARTGSELVRIALNSEEVARAIPYIVEEINKEGFDG
FT                   KILVGCGQYELDKLVQDYPDNIKMLGKIRINPGNIGFGDKRDEKFERVIEYAIMHDLPV
FT                   RIGVNWGSLDKYLLQKLMDENSSLSNSRPSDVILRKALVMSALDSAKKAEGIGLNSNKI
FT                   IISCKVSKVQDLILVYMALAKSSNYALHLGLTEAGMGNKGVVNTAAGLTYLLQNGIGDT
FT                   IRASLTQRPGESRTNEVVVCQEILQSIGLRYFNPQVNSCPGCGRTSSDRFRILTEEVNG
FT                   YIKTHIPIWKKKNPGVEHMSIAVMGCIVNGPGESKHANLGISLPGYGEKPVSAVYKDGK
FT                   YFKTLQGDNVSEEFKAIIDNYVKEHYT"
FT   gene            136771..138065
FT                   /pseudo
FT                   /locus_tag="WRi_p01370"
FT                   /note="transposase, degenerate; disrupted by frameshift;
FT                   ISWpi6"
FT   gene            138335..139377
FT                   /pseudo
FT                   /locus_tag="WRi_p01380"
FT                   /note="transposase, degenerate; disrupted by frameshift;
FT                   ISWpi3"
FT   gene            complement(139687..139866)
FT                   /pseudo
FT                   /locus_tag="WRi_p01410"
FT                   /note="transposase, truncated; disrupted by IS-insertion"
FT   gene            complement(140397..142826)
FT                   /gene="gyrB"
FT                   /locus_tag="WRi_001420"
FT   CDS_pept        complement(140397..142826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="WRi_001420"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001420"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94988"
FT                   /db_xref="GOA:C0R5E6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5E6"
FT                   /protein_id="ACN94988.1"
FT                   /translation="MNVILINIHKRSNTMENSYNADAIKILRGLDAVRKRPGMYIGDTD
FT                   DGSGLHHMVYEVIDNAIDESLAGYCDKIEVSINKDGSVSVTDNGRGIPTDIHEEEGISA
FT                   AEVIMTQLHAGGKFDSNTYKVSGGLHGVGISVVNALSSWLELTIWRNKKEHFMRFEDGE
FT                   SIEPLKVVNENTNKRGTKVTFMPSTETFNGINFSYSTLESRIRELAFLNSNIDITLRDL
FT                   RNEPYTESHFNQSNQSKDNFGTANFVQYLDKNKTHVTKIASMKGDAEDLGISLEISMEW
FT                   NDSYYENMLCFTNNIRQRDGGTHLAGFRSALTRCINTYATNEGFLKKAKVNLTGEDVRE
FT                   GLTCVLSLKMPDPKFSSQTKDKLVSSEARAVVESIVSDKLSTILETDPKLAASIVERAI
FT                   RSAKGREAARKARELVKSKNNIDIATLPGKLADCQEKAPELSELFIVEGNSAGGTAKQG
FT                   RNRKTQAVLALRGKILNVERVSLDRIFSSAEIGSLITAIGAGIGSEHFDIEKARYHKII
FT                   IMTDADVDGSHIRTLILTFFFRHMREVIEKGYLYIAQPPLYKVTKNAKDTYIKDDETFE
FT                   EYIINSAVKRLTLSSTATEFNDLRLILNKCVSISNISKNYDREIPQNLLESLLILSKKN
FT                   ALSSADDILKYLKLMYSEYTWEVEIKDEEKEIHISKLFQGLADKYIFALSMLEGKDMQN
FT                   ILSLLDGISNLFNGDSFLKSQETEIRITSPSTLAKIIMDYGKKGLTLQRFKGLGEMNAD
FT                   QLWDTTLNPEARTLLKVEIKDCEEADSIFSILMGDIVEPRRDFINSNALNVHDVDI"
FT   gene            complement(143001..143609)
FT                   /locus_tag="WRi_001430"
FT   CDS_pept        complement(143001..143609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001430"
FT                   /product="SCO1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001430"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94989"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5E7"
FT                   /protein_id="ACN94989.1"
FT                   /translation="MVRFIRLLSNVLAALAVVFLGYCYFTKKGIFAPAAIHNAEVKIGG
FT                   DFSLINQDGQILRSSDFKDKYMMIFFGFSSCKRICPMNLGIISETLARLDEKTNNKLQT
FT                   FFITVDPERDSTERLKEFQQQFDHRIQMLTGEREKIDEVVAKYKVYASKVDGEEEINHS
FT                   SIIYLIGPGGRYVTHFAADLNSDESQSDKILAEIRKYVN"
FT   gene            complement(143654..144349)
FT                   /gene="dnaQ"
FT                   /locus_tag="WRi_001440"
FT   CDS_pept        complement(143654..144349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="WRi_001440"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001440"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94990"
FT                   /db_xref="GOA:C0R5E8"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5E8"
FT                   /protein_id="ACN94990.1"
FT                   /translation="MESKLRELVLDTETTGLDTESGHRIIEIGCVELINRIPTGKVFHR
FT                   YLNPERDIPYHSFKIHGISEEFLEDKPLFSDVALEFLDFISNDILVIHNAEFDVKFLNM
FT                   ELSKLNAGLISSDRVLDTLPLARKKFAGSPASLNALCKRFDISLENRELHGALVDAQLL
FT                   AKVYVELTGGLQTFLFDNECNQDSNSTFVQHKVRNLTPREHSPNSEEIDEHKKLLDKIN
FT                   NTLWNKYIE"
FT   gene            complement(144374..145024)
FT                   /locus_tag="WRi_001450"
FT   CDS_pept        complement(144374..145024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001450"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94991"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5E9"
FT                   /protein_id="ACN94991.1"
FT                   /translation="MIELVIYALLAAFIFSRLYNSLGRSANLNLKKLTSVLDVSRSRED
FT                   VVENIEGYIDSNDENSIKVTYEQILKKNKDFSISHFIEGSSIAFELIIKYFNQGNLSQL
FT                   KPLLDKDLYDNFAEKIKHRKEVHESIIVSIVSQKILEIKLVKNVVFIAVYFLSEQINFV
FT                   KNNEGDIISGSTSTINKVEDVWQFKKNVNSSDPSWLLVSIHYKKTSNDKTNDK"
FT   gene            145189..145692
FT                   /gene="secB"
FT                   /locus_tag="WRi_001460"
FT   CDS_pept        145189..145692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="WRi_001460"
FT                   /product="protein-export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001460"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94992"
FT                   /db_xref="GOA:C0R5F0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5F0"
FT                   /protein_id="ACN94992.1"
FT                   /translation="MPQQKMRIHGQYVKDLSFENPNSPFLSSSKAPDINVMVNINSAKL
FT                   EGTKNKEEVNEEKSFHEITLHIEVKATVKDEGIKDGVAFICETKYCGIFSIENLKELSE
FT                   EEVRQALFIGGPTFLFPFAREIIARVTSSGGFPPLMLDPIDFETMYEQQGQQQKSNGSN
FT                   SNFN"
FT   gene            145707..148301
FT                   /locus_tag="WRi_001470"
FT   CDS_pept        145707..148301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001470"
FT                   /product="aconitate hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001470"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94993"
FT                   /db_xref="GOA:C0R5F1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5F1"
FT                   /protein_id="ACN94993.1"
FT                   /translation="MNNSLNAKTTLNIDGKSYNYFSLSSASEFLGIDVTKLPYSLKVLL
FT                   ESLLRNEDGVNVKLDDIRVLADCVNKHTNHEISYKPARVLMQDFTGVPAVVDLASMRDY
FT                   VKKNGGNPSNINPSVPVDLVIDHSVQVDSYGSVSAFSKNVELEVKRNLERYQFLKWGES
FT                   SFTNFRVVPPGTGICHQVNLEYLAQVVCNNDGVIYPDTLVGTDSHTTMVNGLSVLGWGV
FT                   GGIEAESVMLGQPISMVIPEVVGFKLIGRLSEGVTATDLVLTVTNILRTKGVVGKFVEF
FT                   YGDGLDYLSLADRATIANMAPEYGATCGFFPIDQKTLDYLSLTGRPEKLIKLVEAYAKE
FT                   QGLWRSSDELAFFDALELDLSSVKPVMAGPKRPQDKVFLSQVAESFSKSFSVNESKESD
FT                   KLQDGSVVIAAITSCTNTSNPSVMIAAGLVARNAIKLGLKSKPWVKTSLAPGSQVVTEY
FT                   LEKSGLQVDLNALGFNLVGYGCTTCIGNSGPLNKDIEDGIKNKNLTVAAVLSGNRNFEG
FT                   RIHPLVKANYLASPPLIVAYALAGTVQIDLTKDPICKDKNGSDVYLKDIWPTNNEIEDC
FT                   VKNVVTREMFIQKYKDVFSGDKHWRKIKCEKSEIYNWDANSTYIQNPPYFDNLSPKNNK
FT                   IDIKGAQILAMFGDSITTDHISPAGNIASSSPAGIYLKNLGIEPQDFNSYGSRRGNHNV
FT                   MMRGTFTNIRIKNEMVSTEGGYTKYIPSQEIMSIFDAAMRYKENNVPLIIVAGKEYGTG
FT                   SSRDWAAKGTLLLGVKVVIAESFERIHRSNLVGMGVLPLVFQNGITRKIFDGSKVISIK
FT                   GEIVPGGNLECIIKRKDNSRQSIQLKCCVQTATETKYLMCGGVLSYILAQSF"
FT   gene            148436..151576
FT                   /gene="putA"
FT                   /locus_tag="WRi_001480"
FT   CDS_pept        148436..151576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="WRi_001480"
FT                   /product="Proline dehydrogenase /
FT                   Delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001480"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94994"
FT                   /db_xref="GOA:C0R5F2"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5F2"
FT                   /protein_id="ACN94994.1"
FT                   /translation="MISSIQEPNELRKRLQGFYRTDEKSYIRYLVEKAELSADSKNRIY
FT                   NIAKQVIEKIKHNKLSIVDSFMQQYSLSNDEGIALMCLAESLLRIPDDYTIDELIKDKI
FT                   ANQEWSKYLGYSSSLFVNASMWSLMIGSSILRDNEGDSKFYYAISKLLKNLGEPIIRKA
FT                   VKQAMSMLGNHFVVGETIEEALRYAKLDDNSKFLYSFDMLGEAAHTTEDAEEYFNSYMH
FT                   SIKAIGESTEINDCFKSHGISIKLSALHPRYEFSQFGRIAGEIFTKVLELCREAKKYNI
FT                   SLCIDAEETERLEISLILFEQLRLDESLSEWEGLGLAVQAYQKRALSVLDFVEDVAIRS
FT                   KHKIMVRLVKGAYWDSEIKCTQELGLNDYSVFTRKSYTDVSYLVCAQKLLSKPNSFYPC
FT                   FGTHNVYTFASIMELADKNHPGFEFQRLHGMAKDLYDYAMSELATNVSCRVYAPVGEHS
FT                   DLLPYLIRRLLENGANSSFVNQISNPNVKIDELISDPLEKAINFNYEPHPGIPLPQDIL
FT                   GPERKNSLGMDISDSVIVSQFADDIKGFSEKKWQVGPIIDGKALFDNAEFIEVVNPAHL
FT                   ENVIGEVSSATSDQALNALEIAHSAFAKWQNVSAEERAKCLEKAADLLEERMKELIYIL
FT                   IVEAGKILSDAIAEVREAIDFLRYYAMIAKNELSDWKKLPGPTGEDNFIFFEGRGVFLC
FT                   ISPWNFPLAIFIGQVSAALAAGNAVLAKPAEQTPIIAYEAVKILHEAGIPKNVLHLIPG
FT                   DGGYLGKILVPDNRIAGVAFTGSTQTAQIINKMLANRDGPIVPLIAETGGLNAMIVDSS
FT                   ALLEQVTTDVLLSAFRSAGQRCSALRVLFIQEDIAEKQIKMICGAAQELKIGDPIQLST
FT                   DIGPIIDKASIDMLTQHTQKMSEDKDSNLLFKVPMDTNSHNGYFFPPYIYEIQKISQLK
FT                   QEVFGPILHIIRFNKSQLNEVISDINSTGYGLTFSLQSRIQSQIDTISKKISVGNVYIN
FT                   RNQIGAAVGIQPFGGRGLSGTGPKAGGPHYLQRFSTEKVVSVNTTAFGGNTTLMCLD"
FT   gene            complement(151795..151968)
FT                   /locus_tag="WRi_001490"
FT   CDS_pept        complement(151795..151968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001490"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94995"
FT                   /db_xref="UniProtKB/TrEMBL:C0R4V8"
FT                   /protein_id="ACN94995.1"
FT                   /translation="MCNILSLHICDAQGPWNPDQITEYRLNFSVLFGVMRQKLYQVLIA
FT                   PKNFQALFKYTR"
FT   gene            complement(152292..152576)
FT                   /locus_tag="WRi_001500"
FT   CDS_pept        complement(152292..152576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001500"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94996"
FT                   /db_xref="UniProtKB/TrEMBL:C0R4I1"
FT                   /protein_id="ACN94996.1"
FT                   /translation="MNLSWRGYRLIAADGSGMRLPSSGEIVSEFEPNGTTGTIGNLFVD
FT                   LCTSLICSARLAAWNIGEQTLAAEQLPEVITQMRLLNQEKLLFIYDRLQ"
FT   gene            complement(153120..153464)
FT                   /locus_tag="WRi_001510"
FT   CDS_pept        complement(153120..153464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001510"
FT                   /product="sugE protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001510"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94997"
FT                   /db_xref="GOA:C0R5F5"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5F5"
FT                   /protein_id="ACN94997.1"
FT                   /translation="MNWIYLLLSSLIEVFWVITLKHSCGFTHLVPSIISIFSMALSTYL
FT                   LSLATRSIPIGVCYAIWTGVGAIGASILGVYLFDEPVNLFEVICFILVTFGIIGLKLFD
FT                   TAKQTVDKME"
FT   gene            complement(153480..153794)
FT                   /locus_tag="WRi_001520"
FT   CDS_pept        complement(153480..153794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001520"
FT                   /product="small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001520"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94998"
FT                   /db_xref="GOA:C0R5F6"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5F6"
FT                   /protein_id="ACN94998.1"
FT                   /translation="MCWLYLLLSSILEILWAVTLKFSNSFTKVVPSIATLVIMIISIYF
FT                   LSLAACFLPIRVCYAVSSGICTIGITIIGATTFTENINLSQVLCIVLIVIGTIGLKLSI
FT                   "
FT   gene            complement(153894..155000)
FT                   /locus_tag="WRi_001530"
FT   CDS_pept        complement(153894..155000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001530"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001530"
FT                   /db_xref="EnsemblGenomes-Tr:ACN94999"
FT                   /db_xref="GOA:C0R5F7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5F7"
FT                   /protein_id="ACN94999.1"
FT                   /translation="MLSRLVILLLVFILPFSSYSYQFRTKAKQAVVLDLASDSFIFDHN
FT                   SDEKMAPSSMSKLMTLYIAFDYLKAGIIHMEDKFRVSRKAWERKGSSMFLKEGQFVTVR
FT                   ELLEGITIVSGNDACITLAEGIAGSEENFVAEMNEVAQNLNLNDSHFVNSSGWPDGDHF
FT                   MSAKDLVMLAKRIFTDFPEYYDLFSEQYLTYNEIVQKNKNLLLFHDIGVDGLKTGYTNA
FT                   GGYGIVASAKRNDRRIFAVVNGLNTEKERIEEAKRLIQYSLNHFNTKKIFAQDSVVEEV
FT                   NVLYGKDKKVPITVANDVTITYNRKLHDQIKVRIEYKDMIPAPIKKGQEVGKVFVEIPG
FT                   IEQQTTPLYAANDVQELNFVEKFFRMLF"
FT   gene            complement(155778..156536)
FT                   /locus_tag="WRi_001540"
FT   CDS_pept        complement(155778..156536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001540"
FT                   /product="cell division protein FtsQ, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001540"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95000"
FT                   /db_xref="GOA:C0R5F8"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5F8"
FT                   /protein_id="ACN95000.1"
FT                   /translation="MLSSITRSQRSFLRKCALVIITALFLTLILYSSLDKIINRFNYYF
FT                   TWYNDCLSSLLLSSGFSIDEVVVSGNKFTNKKDILSLTDRTQPILYISLSKLAGNIQSV
FT                   SRWIKHVRVHRILPNTLHINIDEHKPFALWKDNNKTSVIDFEGKVIVDDYLVDDLVVIT
FT                   GQNSLSNLEFVRDVLESKTQLRDHISSFAYIGNRRWNIILDNDSTVKLPEDNPYSAWDY
FT                   LNHLHNTTDFTFSDWSIIDMRITDKIFVKR"
FT   gene            complement(156517..157470)
FT                   /locus_tag="WRi_001550"
FT   CDS_pept        complement(156517..157470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001550"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001550"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95001"
FT                   /db_xref="GOA:C0R5F9"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5F9"
FT                   /protein_id="ACN95001.1"
FT                   /translation="MLMIPTIAILSGGFSCEREISLMSGKAVKKALDSLSYNAIEIDVD
FT                   SNIAEKLKKINPGLAFIALHGPYGEDGCIQGLLEILGIKYTHSGVMASAVAINKVMSKH
FT                   IFRSLNIDTPKGYVISREDVLKNNIKIDYPYVLKPINEGSSIGVYIIFSHEDYLELKDN
FT                   SSTIMEKMIVEEYIPGIELHTAVLLDEAIGTIEVRPKNKFYDYEAKYTDGFAEHIFPAK
FT                   IPDNIYKMTLEHALKIHQFLGCKTISRSDFRYNPKNNTLKMLEINTHPGFTELSLVPEI
FT                   AKLAKGINFNELVKIIIEDSLQHKNIRDLSHVEQYY"
FT   gene            complement(157550..158335)
FT                   /locus_tag="WRi_001560"
FT   CDS_pept        complement(157550..158335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001560"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95002"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5G0"
FT                   /protein_id="ACN95002.1"
FT                   /translation="MSINKRETIKKIEGLLFQANGNLEKACDLLSTVELTEDDIKILLE
FT                   EMIKEYHSLSEKISYSCGITAGGAQDANANSFNEVFKLGSQELALAMMSDFRKSYDQEL
FT                   FKKYKKEEMSYPEGEGIQFIRELRVLSRILTISLIRKLDEVYKFTPEEIERLKEYMLVS
FT                   NYDTSKSLSDIDKYMHALSALIRNPSLDTKKIFELNNRMIIHTTALIDLVTSGVVKKEE
FT                   AKEQSAEDLEKLICEQYKGAANKPLPLPSTLFEVDKKSA"
FT   gene            complement(158529..158903)
FT                   /locus_tag="WRi_001570"
FT   CDS_pept        complement(158529..158903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001570"
FT                   /product="ferredoxin, 4Fe-4S"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001570"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95003"
FT                   /db_xref="GOA:C0R5G1"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5G1"
FT                   /protein_id="ACN95003.1"
FT                   /translation="MTHFVTDKCIKCKYTDCVEVCPVDCFYEGKNMLVINPDECIDCGV
FT                   CIPECPVDAIVTDDSVKDILELDEELLSSEQKTFKSFYNINVEYSQKWPNITAKKQPLY
FT                   TAEEYKEKKDKTAYFDENLE"
FT   gene            158965..160053
FT                   /gene="dprA"
FT                   /locus_tag="WRi_001580"
FT   CDS_pept        158965..160053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="WRi_001580"
FT                   /product="DNA processing chain A"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001580"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95004"
FT                   /db_xref="GOA:C0R5G2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5G2"
FT                   /protein_id="ACN95004.1"
FT                   /translation="MKINKLNNKELEVWLSLARTIGPIKFFSILKTHGSLDEVLKYLNR
FT                   VANNKVYGIQDAREEINNAERIGAKIIPACDPDYPDLLRNISSCPPVITALGDISLLSR
FT                   EIIAIIGGRNSSMNGRNFANKLALDLSEAGFVIVSGLAKGIDTAANSVIYKNHSTIAVT
FT                   ASGIDVVYPKENFDLYKKITGNGGLVITELPFATKPKPQYFPQRNRIISGLSLGVAVIE
FT                   ASKRSGSLITADFALNQGREVFAVSGFPLDSRCSGSNYLIKNGAKLIESADDIIESVRF
FT                   SLPPQQKNLFDVEHYAVNQKQEKLQQAKSVIVDHINSVPVDIDELILASGLSTNIALMA
FT                   LLELELENKIERSPGNKISLIF"
FT   gene            complement(160267..160995)
FT                   /gene="tpiA"
FT                   /locus_tag="WRi_001590"
FT   CDS_pept        complement(160267..160995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="WRi_001590"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001590"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95005"
FT                   /db_xref="GOA:C0R5G3"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5G3"
FT                   /protein_id="ACN95005.1"
FT                   /translation="MSFLIVANWKMNGMRSSFVDFIGKLNNKSNEITSKLVICPPFTSF
FT                   PSSIELNNNINIGAQNCHHKKFGSYTGEISAEMLKELGCTYVILGHSERANEKDSEIKL
FT                   KSEIAIESGLHPIICVGENSEDYKNEKTKEVIEYQCKNRLPTHGEYTVAYEPIWAIGTG
FT                   HVPNNDAIAKVIEVIKLCTSKKHIIYGGSVSSENIENLLNISNLSGVLIGSASLDFDHF
FT                   YKIIQQVEKKFSLINSKISN"
FT   gene            complement(161020..161092)
FT                   /locus_tag="WRi_t01600"
FT   tRNA            complement(161020..161092)
FT                   /locus_tag="WRi_t01600"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   gene            161171..161989
FT                   /gene="ksgA"
FT                   /locus_tag="WRi_001610"
FT   CDS_pept        161171..161989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="WRi_001610"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001610"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95006"
FT                   /db_xref="GOA:C0R5G4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5G4"
FT                   /protein_id="ACN95006.1"
FT                   /translation="MKKFLLKPKKSLGQNFILSSEITKKIVALAGSLENFNVIEIGPGY
FT                   GALTREILVHNPKSLLSIEKDRDLVKHHDQLLNEHQGKYRIIEADALHVTEEELIERPV
FT                   KVIANLPYNISVVLFLKWLNNIKFFTNLTLMFQKEVADRITARPNSKDYGSLSVLSQLL
FT                   CDIKKEFDIEPKEFFPRPKIHSSVITVNPLPIPKFAVNLETLTRLTRAVFSQRRKMLRN
FT                   SLQNITNHTETVLENAKLSGNERPENLTIEQFCLLANNVECLFCKSPIAI"
FT   gene            162021..163514
FT                   /gene="guaB"
FT                   /locus_tag="WRi_001620"
FT   CDS_pept        162021..163514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="WRi_001620"
FT                   /product="inosine monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001620"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95007"
FT                   /db_xref="GOA:C0R5G5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5G5"
FT                   /protein_id="ACN95007.1"
FT                   /translation="MKKMEACYSFDDILLLPAYSNILPCGADTKTYLTNNIELNIPLIS
FT                   SAMDTVTESGFAIAIAQHGGIGCIHKNLSIDEQVLEVRRVKKYESWIVYNPITISPDKT
FT                   VAEAISLMREHNYSGIPVVDQRKLVGILTNRDVRFIEDQNMNVKVSEVMTKDKLVTVRE
FT                   QGVNSASAMKLLHENRIEKLLVVDENSCCIGLITVKDIEKYNRYPNSCKDSKGRLRVAA
FT                   AIGTGKKDGIDRCEALIGEEVDVVVVDTAHGHSENVINTIREIKKMYPNTQLIGGNIAT
FT                   KEAAEALIDAGVDAVKVGIGPGSICTTRIVTGVGVPQFSAIKNVAEACRARNVRLIADG
FT                   GVKYSGDVAKAIAAGADSVMIGSIFAGTDESPGEIIMYKGRAYKGYRGMGSISAMKRGS
FT                   ASRYFQDKDSKLKLVPQGVEGRVPFKGPASGVIHQLIGGLQAAMGYTGNRNIEEMKKNC
FT                   KFVTITASGLRESHAHDIVITQEAPNYAYQTSNLSTDSE"
FT   gene            163590..164555
FT                   /pseudo
FT                   /locus_tag="WRi_p01630"
FT                   /note="transposase, degenerate; ISWpi3"
FT   gene            164723..166231
FT                   /locus_tag="WRi_001660"
FT   CDS_pept        164723..166231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001660"
FT                   /product="Preprotein translocase, SecD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001660"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95008"
FT                   /db_xref="GOA:C0R5G6"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5G6"
FT                   /protein_id="ACN95008.1"
FT                   /translation="MYNRLIVKSFSVLCICLFALYITLPNFFDNKLFISKKRINLGLDL
FT                   KGGASLLLNIDLDFYFKEKLSMLANEIKETLLTKNIESNVQNSVITLNNIDDYKKASVL
FT                   INAINPNLELNRKDSSILISYKPHYKNSLISEVAAESINNVQRRLDKLGTKEVSVQKQG
FT                   QNKILVQVPGVEDTKQIKSLLGKTAKLAFHLANTNIAKVQDIDHETTVMLKDSLGNSYP
FT                   IFRKTEIGGDSLVNASVRFGNLGKPTVHFKFDSIASKRFAKITKENVGKPFAIVLDNTV
FT                   LTVPTIREPILNGEGEISGNFTEKQASELAILLKSGALPAPLKIIEEKNIGPSLGEESI
FT                   KAGEMAATISIIAVALFIIITYGKLGVLASVALFSNVVLILSILTLLEATLTLPGIAGI
FT                   ALTVGMAVDANVLIFERIREEIKSGKRVERAIEEGFKNAIKTILDSNITTLIAAGIMFI
FT                   IGSGAIRGFSVTLSIGILCSMFSAITVTKLLIELCMNPKELVLC"
FT   gene            complement(166228..167013)
FT                   /gene="fabI"
FT                   /locus_tag="WRi_001670"
FT   CDS_pept        complement(166228..167013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="WRi_001670"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001670"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95009"
FT                   /db_xref="GOA:C0R5G7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5G7"
FT                   /protein_id="ACN95009.1"
FT                   /translation="MTTSLLQGKKGLITGIINKRSIAYGIAKTLSEHGAELAITYQNEI
FT                   IKEKLSPIADELNVELILHCDVSNEKIIDNAFEIIEKKWGTLDFLVHAIAFSDKNELDG
FT                   KYVNTSLDNFLNAMHISCYSFTALAQRAEKMMSNGGSLLTLSYYGAEKVMPNYNVMGLC
FT                   KAALEASVKYIACDLGPQNIRVNAISAGPIRTLASSGISDFHSISEWNRNNSPLRRNVT
FT                   IEDVGKAALYLLSDLSSGTTGEILHVDSGYNVVGMKVVD"
FT   gene            167288..168574
FT                   /locus_tag="WRi_001680"
FT   CDS_pept        167288..168574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001680"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95010"
FT                   /db_xref="GOA:C0R5G8"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5G8"
FT                   /protein_id="ACN95010.1"
FT                   /translation="MLSEIIKQAGGSDTKALATIFSRKKFFRQVDGGEERYKNYLIDLV
FT                   SESSGYQDNTVTLPREIIPDSVTLDALYFTHKKDPLTLPILLRYFTHKNLLQEAKDDLD
FT                   KLNQKLQGAMDEELKKLQDELKLLCEETVELSGKKVDVKQSKVLVTKSEKITETASKIE
FT                   EIKSYKKNIKNLFNGSKTKLNSYPSQYFSILNSGLIEIMEKKLTAYVKGDTDIGETYSS
FT                   LNSRAKKIIRVRNVKNTLVLSASLTFFIPCISVMCLGMFCMGVQHGPRPSFLFAMIDIT
FT                   LFYIVPIMLSIAVALYATAGVAHLIKRRYEQSFEKEMQDFIEGPKRAEKATNEDVKKLE
FT                   QEGTKVGDVIDLSGNCEMNDKVEPSAPPKRSGLYPDLSEELLASSCNKKDSQPNSNVDS
FT                   TLSGVTQVRESNVQLLRGIVIGKEQEIGV"
FT   gene            168755..169569
FT                   /pseudo
FT                   /locus_tag="WRi_p01690"
FT                   /note="hypothetical protein; disrupted by frameshift"
FT   gene            169632..170804
FT                   /locus_tag="WRi_001700"
FT   CDS_pept        169632..170804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001700"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001700"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95011"
FT                   /db_xref="GOA:C0R5G9"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5G9"
FT                   /protein_id="ACN95011.1"
FT                   /translation="MKLRYYLIALLSLLFSQNSASSRTILDKEIFYVELDGKIDLRFGY
FT                   AFNRDSFNAKAKDKTSSYSYLRFLYLQQVYPNTQMGVNVKAGVSGIANLKALDIEKLDM
FT                   EEWYFIIKNQELGSVEYGKRSLVSQSMLINTSKIYAAAGGINGHWTNYANLRGNKNKDN
FT                   DPGYDKDKTFWVKPNIYSDYNGLELGLRQSSINYISPEIYNFQLGFSYVPGKNNLQYSN
FT                   LIAAGLSYKNSLSDDIGFTTALTGEFARENLTGCSDGTPEGYKCRNQLLHWNFGLKLKL
FT                   FDLDCIFSYGNGGKSGEKHNPETNNTYYINAGIAYRSDSYKSSLTYFSSGRDIAGEGTN
FT                   ELTSYALSLENSLFLGTSYYFDIVKFSTKEPKIENNNSGYVFLAGLKLSF"
FT   gene            170975..172018
FT                   /pseudo
FT                   /locus_tag="WRi_p01710"
FT                   /note="transposase, degenerate; ISWpi3"
FT   gene            complement(172110..173513)
FT                   /locus_tag="WRi_001740"
FT   CDS_pept        complement(172110..173513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001740"
FT                   /product="putative oxidoreductase, 2-nitropropane
FT                   dioxygenase family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001740"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95012"
FT                   /db_xref="GOA:C0R5H0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5H0"
FT                   /protein_id="ACN95012.1"
FT                   /translation="MKNKIKKIVISGKEVWPIIEGGKGIAVSDGRSSGAFAAADAVGTF
FT                   SGANAKLIDDNGELVPLIYKGKTRNEKHSELIEYSIEAGISQARIANEISKGHGRIHMN
FT                   VLWEMGAAERVLHGILEGAKGLIHGITCGAGMPYRLGEIAAKYQVYYYPIISSVRAFKA
FT                   LWKRAYQRISSYLLGGVVYEDPWLAGGHNGLSNSEDPELPQAPFERVAELRSFMNEIGL
FT                   SETPIVMAGGVWHLKDWEHWFDNLQIGPIAFQFGTRPLLTKESPISAEWKKKLLTLEEG
FT                   DVFLNKFSPTGFYSSAVRNNFIRELQERKLHQVNFSENASEEFNSEFAMGSRGRKIYLT
FT                   AKDKELANTWTKAGYTEAMKTPDSTVIFVTPDKFKQIREDQINCMGCLSHCLFSNWKDH
FT                   GDHSTGRKPDPRSFCIQKTLQNVIHDGDIENELMFSGHNVYKFKQDPFYENGYVPAVKE
FT                   LVERILTGY"
FT   gene            complement(173863..174450)
FT                   /locus_tag="WRi_001750"
FT   CDS_pept        complement(173863..174450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001750"
FT                   /product="dephospho-coa kinase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001750"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95013"
FT                   /db_xref="GOA:C0R5H1"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5H1"
FT                   /protein_id="ACN95013.1"
FT                   /translation="MIISLTGGIGVGKSFVANCFQEFGAVVFDADSVVHQLYKVDKSII
FT                   SYAEKNFPGVVVNGEIDRTVLSKYFLAYDENWKQFQSLVHSAVLRELEFFIAKEKKIDR
FT                   KLLVLDVPLLLETKFYLYCDLIVFVHADSVVQAQRLNERNIDKEKLNLISDVQLSIEEK
FT                   RKMSDFIIDTSVSKEYVFSQVKDIVDSLNLNT"
FT   gene            complement(174762..175940)
FT                   /locus_tag="WRi_001760"
FT   CDS_pept        complement(174762..175940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001760"
FT                   /product="Ribonuclease D"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001760"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95014"
FT                   /db_xref="GOA:C0R5H2"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5H2"
FT                   /protein_id="ACN95014.1"
FT                   /translation="MLINTTSELEDICEGLIAKKPKFIAVDTEFIRNNLIYYPKLSLIQ
FT                   ISYGEKSFIVDALVPEIDLSFIKKIMLNQGITKVFHSCRQDIESLLTVFKCIPTPIFDT
FT                   QVAAMFCHYYHDFIGYSKVVEQYQGIALDKIKAKNSDWLRRPLSEDQLDYAVNDVVHLY
FT                   DLYQILCNKLEENNRMGWFQEEMESIVDINKYLHSPKDAWKRIKFNYEVNPRLILTVKA
FT                   VSEWQETLAQRYNMNRNKIINNAVIADFIEKNVEHVDEILDDLKRNTKNIKDADLLEFV
FT                   NIFNENERNWMQQNNTLSSNYDKSVLDILSIILDSKCKESNISRKLVSSKDELTGSISG
FT                   QTDKLFKGWRYDFFGRSVESFLNTSSKFEISAVKSANNITKIQSNLVENNCC"
FT   gene            176074..176472
FT                   /locus_tag="WRi_001770"
FT   CDS_pept        176074..176472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001770"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95015"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5H3"
FT                   /protein_id="ACN95015.1"
FT                   /translation="MVDFIDLFQGSKDFTMCMHNGSGDAIYNRCISAVRMDPPCMHGES
FT                   IQGLFESSFEQGVVTVRVNLDLETLNVVVYKSPPTSDKLDAFSLAYQIDRYHIDENTIV
FT                   FDEKVNTIKFDISNPLKHKFITFEIFKR"
FT   gene            complement(177462..180026)
FT                   /gene="mutS"
FT                   /locus_tag="WRi_001780"
FT   CDS_pept        complement(177462..180026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="WRi_001780"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001780"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95016"
FT                   /db_xref="GOA:C0R5H4"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5H4"
FT                   /protein_id="ACN95016.1"
FT                   /translation="MCNIIYNNVYQYNILKNIMSFVKEKNTPVMEQYLNLKAQYKDHLL
FT                   FYRLGDFYELFFDDAIKAAKLLNIVLTKRGNSCGQDIPMCGVPAHSSESYLHKLIDLGF
FT                   KVAICDQLETADEAKKRGYKSIVKRDVVRVVTPGTIIEDSLLEDKSNNYLASIVEQNDE
FT                   YAISWLELSTGKFFHTLTSLKALDSDLLRISPRELLISEKFTEDEKIRSVLKNYKISIT
FT                   QHAQSFFEYSKSHRTLCEFYKIRELGSIGNFSKVEIMACGALLEYVRVTQRGSIPRLEF
FT                   PKTYKQQNFMLIDASARRNLELFSTQFGEKKGSLISVIDHTVTASGGRLLKQMLASPLA
FT                   CSKAINLRLSTAQFFVNNHEPRRKIREILSNIPDIERSLSRLILGRGSPKDMNLLKIGL
FT                   GKTLELSEFLSTLHNYCLSEKSEINSQMSFQCLTKEKEPVSTTQVISSDESELSTIHKS
FT                   LGNHKDLFELLNSAILDNNLSSVKEGGFIHSKYNSELSELSYILNNSNKLVTKLRESYR
FT                   DLTGIAALKILHNNILGYYVEVSANHKITSDIFIHRQSLANSMRYTTNELKELENKILT
FT                   ARDAAIGLEMKIFSELCSEVAKESEKIALAANALAKLDIRTAFAELAVQNNYVKPIIDD
FT                   SKEFNICSGRHPVVEVNNKFIANSINLAGIHLITGPNMAGKSTFLRQNALIAVLAHMGS
FT                   FVPAESAHIGVIDKIFSRVGATDNITAGYSTFMVEMIETATIVNQATDRSLVILDEIGR
FT                   GTGVYDGLSIAQAVIEHIHNVNKCRAIFATHYHELTKVSKYLKNVKCFCVKIREWNGEV
FT                   IFLHEVIEGIADESYGIHVAKLAGFPDSVLNRASEVFEELKA"
FT   gene            complement(180247..181053)
FT                   /locus_tag="WRi_001790"
FT   CDS_pept        complement(180247..181053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001790"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001790"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95017"
FT                   /db_xref="GOA:C0R5H5"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5H5"
FT                   /protein_id="ACN95017.1"
FT                   /translation="MINNLDSIILGIKDGEKAIEDLRVVLKKRKEEVITTQTFNYALRC
FT                   PKTTKEAIVHEILLHFIQNPGEQSLEQVIQCLDRAIQSGIYAKNNPIRNLDEEFRTHIN
FT                   FKDEEGNTLLHHAVIGNKTEEITTLLVAYSANPLIQNADNKIPSDLAQGKTKEVLIKSM
FT                   KKQAHTKKESAMIGSLVPGIMIGGFLGVVLGAGVYVAVSLSGGMILGVMIASSLVASIA
FT                   VGLAMYFLSQDYEQAKAIEKTISTVSSEISVDDTTVANGKKGPQLT"
FT   gene            complement(181239..181421)
FT                   /locus_tag="WRi_001800"
FT   CDS_pept        complement(181239..181421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001800"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95018"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5H6"
FT                   /protein_id="ACN95018.1"
FT                   /translation="MVENLGVVFTTAQRAIVKLEDLGIVSQTSQGKRDRVYCATDILNI
FT                   LEEPTKITENFDSTL"
FT   gene            181819..182532
FT                   /locus_tag="WRi_001810"
FT   CDS_pept        181819..182532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001810"
FT                   /product="membrane protein, TerC family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001810"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95019"
FT                   /db_xref="GOA:C0R5H7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5H7"
FT                   /protein_id="ACN95019.1"
FT                   /translation="MLTDAWTLLTLTLLETILSVDNLIFISLAIDKVPNALRERVRLMG
FT                   LGLALLMRFVILFFTSSILSMQKPIFHTASARDLLMIAGGLFLIVKSSMELRDDIFVCK
FT                   KNKKKANVKSKFFLVVLQIILIDLVFSVDSILTAIALTYNMVIIATAFTFSMLAMLFLS
FT                   SYTAQLIKSNPGLKIIAILFVLLVGVYLILHGFHIELPKGYLYSSFMFALLVEIISKIK
FT                   KINRHTAIHSRYLSR"
FT   gene            complement(182725..184287)
FT                   /gene="guaA"
FT                   /locus_tag="WRi_001820"
FT   CDS_pept        complement(182725..184287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="WRi_001820"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001820"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95020"
FT                   /db_xref="GOA:C0R5H8"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5H8"
FT                   /protein_id="ACN95020.1"
FT                   /translation="MSAIAIIDFGSQFTQLIARQVRGMGVYCEIFPSNISFETISKFNG
FT                   FILSGGPQSVNDDCSETSRVVHEIIKLNEATSVPILGICYGQQLICHYFGAKVKESFKQ
FT                   EFGRTKIKILKESPIVKDTWDVNSEVDVLMNHADSVDTIPQGFTVIASGVINQTIAMIV
FT                   NEQRKIYCTQFHPEVKPTTNGSKLLSNFLDIANCKRDWTMKSFIEEQKEKIKNVVGEKK
FT                   VIAAVSGGVDSSVAAALTHKAIGKQLNCIFIDTGLLRKNQTIAMLKEIPINYVDKSNLF
FT                   LSRLKGITDPEEKRKIIGNTFIEVFEEEAKKIGDVDFLMQGTIYSDVVESGHASDNTST
FT                   IKSHHNVGGLPEKMNLKLVEPLRYLFKDEVRLLGKEIGLSDEIIFQHPFPGPGLAVRII
FT                   SEVDKEKVQILQEVDEIYINTMKNYDLYDKIWQAFAVLLPIKTVGVMGDGRTYGYVCAL
FT                   RAVTSSDGMTADAFPFEDKDQHLLVFWDFLRNVGSIIVNNVPGVNRVVYDITSKPPATI
FT                   EWE"
FT   gene            complement(185274..187058)
FT                   /locus_tag="WRi_001830"
FT   CDS_pept        complement(185274..187058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001830"
FT                   /product="ribonucleotide-diphosphate reductase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001830"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95021"
FT                   /db_xref="GOA:C0R5H9"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5H9"
FT                   /protein_id="ACN95021.1"
FT                   /translation="MNNITINYAKDSKLTDFGKAVLSDRYLIENESYQDLFARIANYYS
FT                   DNKEHAQRLYDYMSNLWFMPSTPILSNGGTKRGLPISCFLNETEDSLQGIVDLWNENVW
FT                   LAARGGGIGSYWGNLRSIGESVKGSGKTSGIVPFIVVQNALTLAISQGSLRRGSSAVYL
FT                   PVSHPEIEEFLDLRKPTGGDPNRKALNIHHAVIVTDKFMQAVENDQEWNLISPHNNKVI
FT                   STVKARDIWIKILTARVETGEPYIIFLDATNNNKPESYKKLNLDIKMSNLCSEITLTTG
FT                   YDHLNKSRTAVCCLSSVNLEYYEEWKDNKLFIEDIMRFLDNVLEDFINKAPNEMQRAKY
FT                   SAARERSIGLGVMGFHSFLQSKMVPFESVTAQQWNKKIFKYLREQADIVSKKLAEEKGA
FT                   CSDAKEVDLMERFTHKLAIAPTASISIIAGNTSPGIEPYAANVFIQKTLTGSFVVRNKF
FT                   LQKLLAEKNQDNDKIWSSISTNEGSVQHLDFLSEHEKLTFKTAYELDQRWIIEHASDRT
FT                   SYICQSQSVNLFLPANVHKRYLHKIHMLAWKKGLKSLYYCRSQSMQRADKVSHDIFKKS
FT                   EILQQKTDIDYDECLSCQ"
FT   gene            complement(187117..188193)
FT                   /locus_tag="WRi_001840"
FT   CDS_pept        complement(187117..188193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001840"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001840"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95022"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5I0"
FT                   /protein_id="ACN95022.1"
FT                   /translation="MKSNLSFIKNVALNCMSKLIGVLNIKKVKHFIVNKYNTLHKEMTV
FT                   LLKKSKNLLNTNIEIGLYHFYKGSISDAKLRFWLISIFYPHLPIVWYNIGRCHFAVGNT
FT                   NKAYNYLTRALKLDNDHEEASYYIKKMTNSAPITELPKNLIRQYFDYTGEYFVEHWLIA
FT                   KQYRGHELVHMIITKIFNNSTSELNILDLGCGTGICGHFLKINSIGNHITGIDISSRML
FT                   NIARGCFIKGKPVYNELIHMEMKEFLKQEKNQQYDVIIFAEVLHYLHDFQEELELAKRS
FT                   TSKKGVIVCLIRRKEGEGIDFVNKGDYFRHSESYVQHVAKEINMQISYMSYCKIYGSQV
FT                   DGILFALQHQQENPKNLT"
FT   gene            188532..191277
FT                   /locus_tag="WRi_r01850"
FT   rRNA            188532..191277
FT                   /locus_tag="WRi_r01850"
FT                   /product="23S ribosomal RNA"
FT   gene            191362..191472
FT                   /locus_tag="WRi_r01860"
FT   rRNA            191362..191472
FT                   /locus_tag="WRi_r01860"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(191536..192918)
FT                   /locus_tag="WRi_001870"
FT   CDS_pept        complement(191536..192918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001870"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001870"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95023"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95023.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            complement(193043..193306)
FT                   /locus_tag="WRi_001880"
FT   CDS_pept        complement(193043..193306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001880"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95024"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5I2"
FT                   /protein_id="ACN95024.1"
FT                   /translation="MVEHIKEVNNTGFGQMYQFLFLPKGTGTDWRSAFRQQEELFKKVG
FT                   SNVILPEISNSPSKGNQLGEVGTMLNNVENDQEHIRKKRYRG"
FT   gene            complement(193392..193529)
FT                   /locus_tag="WRi_001890"
FT   CDS_pept        complement(193392..193529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001890"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95025"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5I3"
FT                   /protein_id="ACN95025.1"
FT                   /translation="MLAKISILNISNIGHYYIILTHRNIMQASYKNLQKDLTICLKKIK
FT                   "
FT   gene            complement(193735..193869)
FT                   /gene="rpmH"
FT                   /locus_tag="WRi_001900"
FT   CDS_pept        complement(193735..193869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="WRi_001900"
FT                   /product="ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001900"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95026"
FT                   /db_xref="GOA:C0R5I4"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5I4"
FT                   /protein_id="ACN95026.1"
FT                   /translation="MKRTFQPKNLIRKRRHGFRSRMATRAGRKILNRRRSLGCNKLCA"
FT   gene            193976..195064
FT                   /locus_tag="WRi_001910"
FT   CDS_pept        193976..195064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001910"
FT                   /product="phosphate ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001910"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95027"
FT                   /db_xref="GOA:C0R5I5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5I5"
FT                   /protein_id="ACN95027.1"
FT                   /translation="MNSVIVIPVLLILLFCFSRFQEVNKVKSYLYLSCVWMLTWLLVFY
FT                   NNCFVTFISIALLFFMLAFIFKNKRNKIIKLSLFVALAISFFITLFIMLSIFIQFISFF
FT                   NKVAISEFLFCLKWGHNVVTINEEKIGCFGIAPLLVGTLLITIIAMLVVVPLGLFSAIY
FT                   ISEYASEKVRYIVNTTLQVLSAIPTVVYGYFAVVFLSFFIKQVANFFGLSIHSESALVA
FT                   GLSIGIMILPFIISLLEDAIRSVPKSLRYGFMALGATPAETIWHITIPYAMPTILSAIL
FT                   LSISRVIGETMIVLMAVGINANLTFNPLNSVTTITVQIATLLTGDQDFNSVQTLAAYAL
FT                   SLVLFIITWLLNAFALFVMKRN"
FT   gene            195166..196593
FT                   /locus_tag="WRi_001920"
FT   CDS_pept        195166..196593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001920"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001920"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95028"
FT                   /db_xref="GOA:C0R5I6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5I6"
FT                   /protein_id="ACN95028.1"
FT                   /translation="MNIGRAIKVTQAVVDIKFEGELPKIFNALKSKLKYKDKELVLEVS
FT                   QHIGDNIVRCIAMDSTDGMSRGDEFVDTGAPISVPIGRSTLGRIFNVVGELIDECGPLK
FT                   GKYNLEPIHRAPPSFTEQRIQEEVLVTGIKVIDLLAPYLKGGKIGLFGGAGVGKTVLIM
FT                   ELINNIAKAHKGFSVFAGVGERTREGNDLYHEMITSNVININEHEKSQAVLVYGQMNEP
FT                   PGARARVALTALTMAEYFRDRENQDVLFFVDNIFRFTQAGSEISALLGRIPSAVGYQPT
FT                   LATDMGAMQERIASTTSGSITSVQAIYVPADDLTDPAPATTFSHLDATTVLSRQIAEMG
FT                   IYPAVDPLDSTSQSLSAEIIGEEHYKVASEVKRILQTYKSLQDIIAILGMDELSDEDKI
FT                   IVDRARKIQKFLSQPFHVAEIFTGMPGKFVSLSDTVSSFKGIVEGKYDHLPEAAFYMVG
FT                   NIDEAIKKAELIQAEAK"
FT   gene            196606..196950
FT                   /locus_tag="WRi_001930"
FT   CDS_pept        196606..196950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001930"
FT                   /product="ATP synthase F1, epsilon subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001930"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95029"
FT                   /db_xref="GOA:C0R5I7"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5I7"
FT                   /protein_id="ACN95029.1"
FT                   /translation="MNTFKVQFFSPDDQISFSGVVSLSVTGLEGELMILAHHASYLIYL
FT                   LPGMITVKMSNQTEKKVVIDSGVLEVASNNCSIITSQIQVFDRAIHDEKSFKNKRISIY
FT                   LSYLDEKFLS"
FT   gene            complement(197075..198019)
FT                   /pseudo
FT                   /locus_tag="WRi_p01940"
FT                   /note="transposase, degenerate; ISWpi8"
FT   gene            198377..199759
FT                   /locus_tag="WRi_001950"
FT   CDS_pept        198377..199759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001950"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001950"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95030"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95030.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            199996..200214
FT                   /locus_tag="WRi_001960"
FT   CDS_pept        199996..200214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_001960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_001960"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95031"
FT                   /db_xref="GOA:C0R5I9"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5I9"
FT                   /protein_id="ACN95031.1"
FT                   /translation="MISNIIRSIVKYLMRKIIKYISIIGIACLVLLFFISNVETRVKTQ
FT                   EEQLFLAVEDGNAQEVKLLLKNGADPN"
FT   gene            complement(200311..201276)
FT                   /pseudo
FT                   /locus_tag="WRi_p01970"
FT                   /note="transposase, degenerate; ISWpi3"
FT   gene            complement(201361..202068)
FT                   /locus_tag="WRi_002000"
FT   CDS_pept        complement(201361..202068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002000"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95032"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5J0"
FT                   /protein_id="ACN95032.1"
FT                   /translation="MLTKSRVKRDLVYAYQILSYLKFDDHTYTHLSVRSEDQKSFYIYP
FT                   FGMRFDEVDERSLMKVSFDGDVVEGKEYQYNRTGYIIHGFVYQARKDIQAIFHLHTPSI
FT                   VAVSSLKDGLLPISQWALHFYNKISYHNYNSLALSDTEGKRLIADLKENFVMLMRNHGS
FT                   IMCGRSIQEAMFYTYHLEQACKTQCLTLAMNKELSIPSEEICSKAVKDLLSFESNLGER
FT                   DWHAWVRLIKSKL"
FT   gene            202352..202975
FT                   /locus_tag="WRi_002010"
FT   CDS_pept        202352..202975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002010"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95033"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5J1"
FT                   /protein_id="ACN95033.1"
FT                   /translation="MVNINTKKQPAGFFIYLSGLSGSGKLSTAIELSNMINALIVNSKF
FT                   YNNVQACSIYDGVFERDQIPKEVQDRIYGIMQIMLQVIENYPIHSKNYIFIDELMENND
FT                   QNMRMYDSIVRLSKKMNTEILPVVLRCDLPTLQKRIALKRQRKNRKVINLNSIVEKFRT
FT                   DDLFIPPSAIEIENSDMSIKEVAQEIVNQMHKLSNIACTRKNSL"
FT   gene            complement(202970..203545)
FT                   /locus_tag="WRi_002020"
FT   CDS_pept        complement(202970..203545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002020"
FT                   /product="endopeptidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002020"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95034"
FT                   /db_xref="GOA:C0R5J2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5J2"
FT                   /protein_id="ACN95034.1"
FT                   /translation="MSILAIDTVGIGSSIAIVDYDGNCFVEHNSASNNHAESFFQILNT
FT                   LFDKHNYNYDKIDHLVVVVGPGSFTGIRVGISAAQGINLATNKPLYGVSALEVQAYAIS
FT                   LLCTNNKKNIRAIVKNAQGFYTQLFDFNLLPLSAPGSQCHATSSTHMDCNLNASHAGLL
FT                   VRYRLGNKQKLNEVEALYLNEPQYMKSL"
FT   gene            complement(203545..204690)
FT                   /locus_tag="WRi_002030"
FT   CDS_pept        complement(203545..204690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002030"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95035"
FT                   /db_xref="GOA:C0R5J3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5J3"
FT                   /protein_id="ACN95035.1"
FT                   /translation="MVYKNVLQLLILLTVITSAAFFGHLVPMEVKTFLYSTSLSIKEVL
FT                   LFIMPFIIFALIFSSVNNLKQSAIKFILLLIIMIFLSNLASSLIAYSVGHFIIQNTYSI
FT                   QDITYEETIVPLWSFRLPALLSNFYALACGFVSSIVVSTLLPKKSRELSNKMLDLTLFI
FT                   LKTFLTPIIPIFVLGLALKMQHDQVLSIIFKDYSIIFIIIASATYLYVFLLYGAANSFK
FT                   ITSWIASIGNMIPAFITAMSTMSSNATMPLTLEGSKKNVKQPDIASSVVPITASFHLVG
FT                   DCFFIIILSMIIASGYSLCTTDYVTFLLYFLLFKFAIVAVPAGGIMVMLPILEKYLKFS
FT                   PEMLSLITALYIVFDPIITSANVMGNGAFAIMFTKLYDKLK"
FT   gene            complement(204804..205793)
FT                   /locus_tag="WRi_002040"
FT   CDS_pept        complement(204804..205793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002040"
FT                   /product="ribonucleotide-diphosphate reductase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002040"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95036"
FT                   /db_xref="GOA:C0R5J4"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5J4"
FT                   /protein_id="ACN95036.1"
FT                   /translation="MSLLEADPIYKPFNYPWAYDAWLQQQRIHWIPEEVPLADDVKDWK
FT                   TKLSSVEKNLLTQIFRFFTQADIEVNNCYMRHYSNIFKPTEICMMLASFSNMETIHIAA
FT                   YSYLLDTIGMPESEYQAFLKYDAMRKKYEYMLEFEESKKHDKKHVAKTLAVFGAFTEGL
FT                   QLFASFAILLNFQRFGKMKGMGQIIAWSARDETLHTNSIIMLFNTFIKENNEIWDNEFK
FT                   EELYSACRTIVELEDEFIKLAFDLGDVEGLSAEEVRNYIRYVANRRLMQLGLESIYDVN
FT                   DNPIPWLDEILNGVEHTNFFENRVTEYSRAATQGTWEEAFTENDTNNK"
FT   gene            205925..206263
FT                   /gene="smpA"
FT                   /locus_tag="WRi_002050"
FT   CDS_pept        205925..206263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpA"
FT                   /locus_tag="WRi_002050"
FT                   /product="small protein A, tmRNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002050"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95037"
FT                   /db_xref="GOA:C0R5J5"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5J5"
FT                   /protein_id="ACN95037.1"
FT                   /translation="MRVLISFILLFTVSCTHTIHNHGAPGISVELWSKIKVGDDKEKVV
FT                   HTLGSPTLVSKFDDNVWYYVSYKIKQANFLGKRKYSSKSLQISFDQDGKVEDTKETDIL
FT                   ERSLAVSD"
FT   gene            complement(206626..207246)
FT                   /locus_tag="WRi_002060"
FT   CDS_pept        complement(206626..207246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002060"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95038"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5J6"
FT                   /protein_id="ACN95038.1"
FT                   /translation="MRFFYSNYILFLSLCCFLLFSLSSTKAQTNDTLAVPIPQRKKEIV
FT                   EHTVVAQPRQIIEMQEEVIINEGKEFIPIPKRKKSVEKKLRRDVRGAKNEIGNEKSVES
FT                   KKDELVVTEIINSIREKLTKCWSIPESIAYKENFNIKINLLLSSQGEIIMADVADSDSY
FT                   RNNPLFRSIADNAMRAVYKCSPLTGLPTQHHHIWREVTLDFIL"
FT   gene            207419..208442
FT                   /pseudo
FT                   /locus_tag="WRi_p02070"
FT                   /note="phage uncharacterized protein; disrupted by
FT                   frameshift"
FT   gene            208442..208582
FT                   /locus_tag="WRi_002080"
FT   CDS_pept        208442..208582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002080"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95039"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5J7"
FT                   /protein_id="ACN95039.1"
FT                   /translation="MLLKSFKQLFSKPKAQYEMHQAQEEEWQPITYSLIALKLWKQTVT
FT                   E"
FT   gene            208649..209371
FT                   /gene="recO"
FT                   /locus_tag="WRi_002090"
FT   CDS_pept        208649..209371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="WRi_002090"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002090"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95040"
FT                   /db_xref="GOA:C0R5J8"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5J8"
FT                   /protein_id="ACN95040.1"
FT                   /translation="MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK
FT                   FQISNLLHAEWSAKLPENLGFFKCELIESSFHHFFQDRLKSITIVSFSSILEKVLPESE
FT                   PCAVLYDNFRYFIDVIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFI
FT                   SPKTGRAVSKKAGDYYADKLLPFPQMLHDVYNNNLQNSYSFQEFQLGLKVTGYFLNKYL
FT                   FLQLNVKFPELRNLMLSL"
FT   gene            complement(209725..211101)
FT                   /locus_tag="WRi_002100"
FT   CDS_pept        complement(209725..211101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002100"
FT                   /product="response regulator PleD"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002100"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95041"
FT                   /db_xref="GOA:C0R5J9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5J9"
FT                   /protein_id="ACN95041.1"
FT                   /translation="MTAKILVVDDVLSNVKLLEARLKAEYYTVIVAHDGEEAIDLVAKQ
FT                   QPDIILLDIMMPKMNGFQVCKELKSDPLTTHIPIIMVTALHDTHDRVQGINAGADDFLT
FT                   KPINETALSARIKSLTRLKMIIDELRLRGETNAEIGGVAGNSIMDYSNQIFDANILVVD
FT                   EDVFQAEQIYNVLKQRFRSIKILSDPIEALKVGIKDNYDLIISDMQFSKTDGLRLCSGF
FT                   RSKVETRYTPILILSEDYDKNNLVKALDVGANDYLTVPLDEGELIARVNSQVKRKRYQD
FT                   ALRMNLFNNAEMSIKDPLTNCYNRRYFDAHLRNIVKDSVEKDRRLSLMILDIDYFKMVN
FT                   DNFGHSAGDELLKQIQRRISENIRVTDLLARFGGEEFVVVMPDTDTSDAYTIAERIRKI
FT                   IAKKPFILADKNTTHNVTVSIGIAEMQGSDLDNIKEFIVRADKYLYKAKNSGRNRVVTG
FT                   "
FT   gene            complement(211073..211369)
FT                   /locus_tag="WRi_002110"
FT   CDS_pept        complement(211073..211369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002110"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95042"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5K0"
FT                   /protein_id="ACN95042.1"
FT                   /translation="MFNIGLSEILVVALVSIIVLDKNKVPVFIDFIKTIYRYFTIVKSK
FT                   AKRLLKDAGIEDLYKECNTEKVNYIVGKNGKLYPTYDIDNTSKDNDSEDSGSR"
FT   gene            complement(211374..216107)
FT                   /locus_tag="WRi_002120"
FT   CDS_pept        complement(211374..216107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002120"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95043"
FT                   /db_xref="GOA:C0R5K1"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5K1"
FT                   /protein_id="ACN95043.1"
FT                   /translation="MCIDHNVDTESLFKLADQENQQDKEKIKKFIKYFYSFVYKSDLKA
FT                   NDKFLLYIVNDAYNFVSQKEKDESKLVVSNIDDIPGIEGDFTTIKITNDDMPFLVDSVI
FT                   ATIKSHDLTICYYSNSIINIKRKDGLIDEIYPLEESNGIKESVIYVIIKGISDSFVDTL
FT                   KESLQKTLKAVNCVVKDWHLMLKKLDEASLSVIPVLDTGIQEKDTWIPVSRTGMTPDRN
FT                   QEQKDFLVWLKNNNFVFLGYQEYIAGKDEKLVCDSKKDLGLMRVGQSTLIPSANLDSLY
FT                   ILRSDLISIVHRRTYMNCIGVKEFDDQGNVVKERRFFGLFTSVAEVQDIRTIPIIRDKV
FT                   KVIEKNAGFVTGGHNNKALIYILQVFSCDELFQSNEEELFQICTSIMSLAIRPRVKLCL
FT                   RSKGAFTSCIVLIPMRYASSRLMLKISNILKDEINAENSDIYNHHIINEYDLMKLHVVL
FT                   KAKNASVPDDEVLRIENKLRNITEKWEDRFIDNLYNTFSTVEDIFIRYCKAFPISYQES
FT                   FEPHDAYYDMKKLEIVRKKGVSEVDLRLTRDNLNYQLKVYTPNNGGLELSKILRITKNL
FT                   GAKILSHNGYYIEINGGIWIHHFVLSRVDELIDNITLKEQFEITLAKVFSKEIKNDYFN
FT                   SLIIIAGLKWKEVLLIRALSAYLKQTSFNYNPEYIQKVVSEYPKVVKYLIQLFHARFDP
FT                   NIDIDRAETTDIVREKIEELLKEISNVSHDYVLRSIFNLIMAILRTSYYQDNKPYLSIK
FT                   FDSSKVNGLPDPRPYRELYIYSNLFEGIHLRGGKLARGGLRWSDRTEDFRTEVLGLMKA
FT                   QMTKNAVIVPVGAKGGFVIKQAYKDKNILREKSVECYKSFIRGMLDITDNVVDGEIIPP
FT                   ENVIRYDEDDPYLVVAADKGTASFSDYANQIASEYNFWLGDAFASGGSAGYDHKKMGIT
FT                   ARGAWIAAQRHFWKMNKDIYQDATVIGIGDMAGDLFGNGMLLSKNIHLIGAFNHMHIFV
FT                   DPNPDAEKSFTERKRLFKLPFSTWMDYNKDLISKGGGVFERSSKQVNISQEIKKCFDIT
FT                   EDMLPPSDLIRYLLKAKVDFIWNGGIGTFVKAKSENHSMVGDKANDELRVNGKDIRASM
FT                   FIEGGNLGCTQLGRIEYAERGGYINADFVDNSAGVICSDLEVNIKIAFVSAMKAGGISL
FT                   EKRNEILASMVDEVASKVLENHNRIETKALLLECLQAKERLEQDHRLLLSLEKSGLLNR
FT                   SVEFLPADEEVARMLTGAEGFSSPQLSILISYARTAIKNKIIHSDLPEKDLISNDYLLG
FT                   YFPKKMLTEFKDFILKHQLRREIISTCIANDVVNRMGCIFINNLVENTGIKVHEAVNIY
FT                   IVVNHLYDLNNLWQKIDELDGKIDINSYLQIVRNVQKFIGRVSFWLVKNLSFVELDDVT
FT                   KFKDAIETLGHDVLDEHLLKVYNHGYTSLVELNIDKDLAKKIADLCVLTYALDIISVAE
FT                   QTSLSILDAGKIYFELKSLLRFDLIRTIAIKMKSRSSYWDRSLVNDLLDDLSNYHHKLA
FT                   VKVIKATDNPEDKVQTWACNDKDYIERYNSFLDEMVASKLDLSKLIFIIRRIKVLAS"
FT   gene            complement(216135..218735)
FT                   /locus_tag="WRi_002130"
FT   CDS_pept        complement(216135..218735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002130"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002130"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95044"
FT                   /db_xref="GOA:C0R5K2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5K2"
FT                   /protein_id="ACN95044.1"
FT                   /translation="MLYTSANTNLTGVMDLNKFTEKAKSLIQSAQMKALGAGHQIFMPE
FT                   HLLKVMLEDESGLVQDLINACGGSVQSISDAVDSAIKKLPVIEGPGSGGLQLSREIAKV
FT                   FEDSIGIARRNKDSFVAVERLLQGLTAQKDDTVGKILAENGVTLQKLNSVIAEMRQGSS
FT                   ADSPNSEEKLNAAKKYTKDVTELAMQGKLDPVIGRDEEIRRTMQVSLRRTKNNPVLIGE
FT                   PGVGKTAIVEGLANRIVANDVPLGLHDAKVLALDLGALIAGTKFRGEFEERLKAVINEI
FT                   SRAEGKIILFIDELHTLVGAGATSGAMDASNLLKPALARGEIRCIGATTLDEYRQHIEK
FT                   DPALARRFQPVFISQPTETDTISILRGLKERYEVHHGIRITDGAIIAAATLSNRYITDR
FT                   FSPDKAIDLIDEAASRVRIEMDSKPEVIDELERKVIQLKIEAEALKKESDENSKQRLKK
FT                   INEEIENLNSKFADLNSKWQMEKNKIARIQETAEKLDNARKELELAQRSGNLGKAGELM
FT                   YGVIPQLENELKNQEKVTDSFLKKEVTGDDIANIVSKWTGIPVDNMMHSEKEKLLNMEN
FT                   EIGRRVIGQKDAIEAISNAVRRSRSGVQDTNRPFGSFLFLGPTGVGKTELAKALAEFLF
FT                   DDQSALLRFDMSEYMEKHSVSKLIGAPPGYVGYEQGGRLTEAARRRPYQVILFDEIEKA
FT                   NPDIFNLLLQILDEGRLTDSHGKLIDFRNTILILTSNLGAEIMLKGNVDSVRNEVMQIV
FT                   KSTFRPEFLNRLDEIIIFHSLTRDDIYKIIDVQFSYLQKTLAKRKLSISLSQEAKELIA
FT                   QTGYDPEYGARPLKRVIQECIQNNLAKLVLSGEVVENDELIVYALDNEILVKKV"
FT   gene            219099..219377
FT                   /locus_tag="WRi_002140"
FT   CDS_pept        219099..219377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002140"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95045"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5K3"
FT                   /protein_id="ACN95045.1"
FT                   /translation="MEICSFSRELMLQILYISLQNGIRFLHYPLPAFSSAFLAVCLPYR
FT                   RKYRLTLFFLSYNSGLGDFSIPVICVHPEMKNVTLPFGRSLSASLAL"
FT   gene            complement(219468..219911)
FT                   /locus_tag="WRi_002150"
FT   CDS_pept        complement(219468..219911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002150"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95046"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5K4"
FT                   /protein_id="ACN95046.1"
FT                   /translation="MAFSKFLDPKNNFAFKRIFGTEKNKDILIHFLNDILGFAGKDEIE
FT                   EIEFLSTIMDAEIASKKQSIIDVFCTDSAGTQLIIEMVRPESLRSYCLKGEEFLQKETK
FT                   RVLKLIKPDVLPSESTHQCESGNRLVPSDADNEPPLEKEDAQS"
FT   gene            complement(219974..221803)
FT                   /locus_tag="WRi_002160"
FT   CDS_pept        complement(219974..221803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002160"
FT                   /product="GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002160"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95047"
FT                   /db_xref="GOA:C0R5K5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5K5"
FT                   /protein_id="ACN95047.1"
FT                   /translation="MNEFKSIRNIAIIAHVDHGKTTLLDNMLKQSGTFRENQEVQERVM
FT                   DSGDQERERGITILAKCTSIMWGDEKINIIDTPGHADFGGEVERVLCMADGVLLLVDAA
FT                   EGPMPQTKFVLSKALKANLKPIVIINKVDRPDSRIDEVLNEIYELFFNLDATNEQLDFP
FT                   VLYASGRNGWCAKELSDERKDLSPLFSTVIDYIKPSVYDQNAPFAMLVTLLESDKFLGR
FT                   ILTGKVYQGVAKVNSDLKVLDLDGKVIERGRLTKLLSFSGLKRIPVEQAVAGDIIAIAG
FT                   LEEASVSDTIAAPEVTTAVSSTPVDPPTMAITLSVNDSPFAGQEGTKLTSTAIKDRLYA
FT                   EAETNVAITVTLAPSGEAFEVGGRGELQLGVLIENMRREGFELSVSRPRVLFKEEDGKK
FT                   LEPIEEVVIDVDDEYSGIIMEKLSFRKGEVTDMRPSGNGRTRLTFLVPSRGLIGYQGEF
FT                   LTDSRGTGIINRLFHSYAPHKGPISGRRNGVLISTDKGEAVAYAIFNLQDRGIMFIKPQ
FT                   DKVYCGMVVGQHSRDNDLEINVLKGKQLTNVRASGSDEAIKLTPPKIMTLEDMIAYIDD
FT                   DELVEVTPKSIRLRKKFLDPNERKRAGRAKNKE"
FT   gene            complement(221901..222497)
FT                   /gene="pyrE"
FT                   /locus_tag="WRi_002170"
FT   CDS_pept        complement(221901..222497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="WRi_002170"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002170"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95048"
FT                   /db_xref="GOA:C0R5K6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5K6"
FT                   /protein_id="ACN95048.1"
FT                   /translation="MILDENNLIIKEFKEAEAILHGHFILSSGLHSNTYIQCAKIFENP
FT                   SRAMKVCALLADKIKKELNSSIDLILSPAIGGIIVGYEIGRQLGIRTMFCERVNGKFEL
FT                   RRGFEIKKGEKILLIEDVITTGKSSLEAVECAEGEGGKVVAEASLIKRNSETKLPFPVI
FT                   SLIELNIKNYSEEELPSELKQLPITKPGSREYLTK"
FT   gene            complement(222501..223685)
FT                   /locus_tag="WRi_002180"
FT   CDS_pept        complement(222501..223685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002180"
FT                   /product="Na+/H+-dicarboxylate symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002180"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95049"
FT                   /db_xref="GOA:C0R5K7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5K7"
FT                   /protein_id="ACN95049.1"
FT                   /translation="MHKFAILFSILLAIVAYYLNNEIIFEIAKLFSDIFISLLKLISLP
FT                   LVFLSIVSTISGLKDSIEIKVLVKKTLFYTLLTTIIAAFVALSFYLLIDPARKNFISNT
FT                   IGSINSNNHSYFSYLKSLIPSNFVQVFLENNMIGSILIAFLMGGAIVSLSKEKQDILYQ
FT                   VFSALFDTLLKIAQGLLKFIPLAVWSFITCFLHELKGGSEFYSLFWYFVCIMSANFVQA
FT                   FLILPLLMWYKGISPIQTLRGVMPALTLAFFSKSSSATLPTTIDCVQNKLKVPKKLSSF
FT                   ILPICTTINMNACAAFILITVMFVAEMNGYAFSLSEMLIWIFLATGAAIGNAGVPMGCY
FT                   FMATSYLVSMNVPLHIMGLILPIYTIIDMFETAINVWSDICITQIINKECNSET"
FT   gene            complement(223884..225209)
FT                   /gene="pyrC"
FT                   /locus_tag="WRi_002190"
FT   CDS_pept        complement(223884..225209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="WRi_002190"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002190"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95050"
FT                   /db_xref="GOA:C0R5K8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5K8"
FT                   /protein_id="ACN95050.1"
FT                   /translation="MTQTWNLLQTGQKEGYKIAYTNARIIDPETKLDIKGSLLTEGDKI
FT                   VDFGESLFSTSGVDETIDCKGLVLMPGLIDIHVHFREPGQEHKETIYTGSKSAAAGGVT
FT                   TVVCQPNTIPAIDSVVLAKYLKYRALETSHVNVEFYAKITTLEEKLTEMALLKEAGAVG
FT                   FTDDGMPVMNPMIMRQALLYSSMLGVPIAQHAEDLNLSAGGAINEGKISEELGVKGILS
FT                   ASESVMVNRDILLMKDMENVHYHILHVSSKDSLDAIKRAKDLGLNVTCEVTPHHFTLTE
FT                   DIVKQHGAIAKMNPPLRTEEDRLAMVEGLKTGVIDCIATDHAPHDRSSKDLPLENAAFG
FT                   IVGLETMLPLSLELYHSGQMGLLDVLAKLTYKPADIIHIPRGRIQKNLAADLILVDLNH
FT                   EWEIKTDNFASKSKNSPFDGRKVKGHVVRTVVSGKTIYSQKS"
FT   gene            complement(225324..226565)
FT                   /locus_tag="WRi_002200"
FT   CDS_pept        complement(225324..226565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002200"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95051"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5K9"
FT                   /protein_id="ACN95051.1"
FT                   /translation="MGTTKISKFPFNIKGKVAKQHAEPIIEKNLYTILGFKDIEDFENK
FT                   TSKLVNKKVWQSFVDCFAKEIDYAATEKVVKSIVCNIAKSDRGDAFTKAERLILNEKQG
FT                   DKKREKAIREAISILRKINPEKAFNELSVIKKQAEDFLQTDFYKAQSKPLQGFAPSGGQ
FT                   LFAEVLKYIETLEKLAEVKKEELVKDFLLNHVSSLNKKYPKSQSKREDAITILSNDELK
FT                   NFYNKGVKEGILQPMASYKECRNLYDKMNQIKNESKSIIKREEREENLKKIDKSIISAI
FT                   NDIKKHREAILNCKDFQSSYIKEKKEHPFRGNACQKMIDIYQERIVGYQEKIRQNLNQI
FT                   KAILKSAPQEMDDVEELEEIIDGIHEAKQFDEDFDSALICLSNMQNELDIQLENPPTEL
FT                   RVSHINVKTELTRL"
FT   gene            226877..228970
FT                   /locus_tag="WRi_002210"
FT   CDS_pept        226877..228970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002210"
FT                   /product="Cytochrome c biogenesis factor"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002210"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95052"
FT                   /db_xref="GOA:C0R5L0"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR014070"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5L0"
FT                   /protein_id="ACN95052.1"
FT                   /translation="MPELGNILLLLACLLSLTYLFLPLSSCRFITTAIFFCVSTSMAIL
FT                   IYCHITNDFSLENVYYHSHTTKPLIYKICGVWGNKEGSMLLWTLVLTMYLLLMDIYIPS
FT                   VIPVLDYLDPDNLIANEYIKWQYNKNWIPVSSTGMTPERTNGSKLKKISLITQGLICFC
FT                   FLLFTLLESSPFTKMPSVEKDGLGFNPILQDIGLAIHPPILYLGYLGFSVPFSLSIAGL
FT                   IAKVEGNVWAKIVRPWVLISWSLLTLGISLGSWWAYRELGWGGFWFWDPVENVSLMPWL
FT                   IAVALTHLLLVVRNFNVLRNFAILLTLTTFILSVTGTFLVRSGILTSVHTFADDPRYGL
FT                   YILALLGVITVSSLVVFIAFAKKNRSLTPPPVIPVLGTGIQEKNIEGPNYTPKQNFSVF
FT                   SRFTMMLMNNLLFITAFFIVFVGTLYPTVLEYLTGELISVGAPYYNSLFNPIALAILVL
FT                   TMIGQYCSWQGNSLLPIFREYRFSFCSAAAILPFIFHMELIIVLSITISIALLIFVLEA
FT                   YSKRIRLFKSESILLAKKVSKSYYAMMAAHAGVAILVLGIAYSVGWQEKKENYLKIGDS
FT                   ITVNKFKVTLRNIELIKEKNFHAVRGTMDIRNLLNNKILGEITPEYRFYLVEGQKNVES
FT                   SIYHNLLSDIYVVIGEIDKSKSKIAAKVHYKPGMSIIWLGSFLIAFGSLLAAFPFSKRA
FT                   KVV"
FT   gene            229144..231069
FT                   /locus_tag="WRi_002220"
FT   CDS_pept        229144..231069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002220"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95053"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5L1"
FT                   /protein_id="ACN95053.1"
FT                   /translation="MNGEVSGKEEVMHTPYSDLCQNLESNAQTPLQHSDDSCTSDNSNN
FT                   HRSGDSDSEEGDGHDSGISSDDEDNRTTDTEVQLTNDSLDSQRYTGICIPTPTDGWAGE
FT                   NNHQTGLSGDLPDVSNNPQIFESTDSVEHNSTCNDHVICDSGHNSDDEDQIPEDFPSRK
FT                   RVRSIEIDQFEPLYKKRKIEAQNNQKYTENVCNPTNGGLLGESDNQQISEDTEITSDCN
FT                   PDDSDPKGNEGYGSDGSCESKENLTKGAGGSNQTFEGEQKSSEFPKVNNWSDSDGNSED
FT                   SSDCGDDNVGHYDTDCGERYSHLSFHDENTNIIRKKDSFFLAQIELNKAEREKYENIWQ
FT                   EMDKILSSSHEVGLCEDDIEELKGRLDEVISQALEQRIMFTFPYRDGESFVDCIINTTQ
FT                   ELYWVDSTENSRLLEEKKILQVISEGATLNKFTKERYDDYVNCIYREKEILSQRNKNIL
FT                   GLNNLAYESIVNKSKQTQNVLGVDKDNRYFCIEYSQDSIVEVAEILNNEKAKDLNLRVG
FT                   ILKIGESIVRVENVEEIGEKRNYMDVSKGGIEMSFTTEVGKISVYLSPSEKGSNKIKVE
FT                   IDGENRARLNELKDKGKSLGENCLLGGKSVEEAIEHESFERYGSVPNTAMKEPSLDCVA
FT                   NITRGG"
FT   gene            231270..232148
FT                   /gene="secF"
FT                   /locus_tag="WRi_002230"
FT   CDS_pept        231270..232148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="WRi_002230"
FT                   /product="protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002230"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95054"
FT                   /db_xref="GOA:C0R5L2"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5L2"
FT                   /protein_id="ACN95054.1"
FT                   /translation="MALRLIPDNLNIKFSKYRNLTALVSIILIIFSMLIVVLRGVNLGI
FT                   DFAGGILIEIKSSDENHSILDALKENGFTVQSSKAGDNLVMRFKDEGDEDKIKKIKSIL
FT                   EEKLGSSISYRKIDYVGPQISSTQIFEGMLSMLIAIVGIFFYVWFRFNWQCGFSGITAL
FT                   IHDVILTVGFISLTGIEFNISSVAALLTVIGYSINNSVIIYDRIREYCKSGKSGRMSEI
FT                   VDASINATLFRTILTSGTTLLAALPLALICTDAVKDFSLIIFFGILIGTCSAIFISAPI
FT                   LTYRALDCRSV"
FT   gene            complement(join(232145..232357,233848..234138))
FT                   /pseudo
FT                   /locus_tag="WRi_p02240"
FT                   /note="hypothetical protein; disrupted by IS-insertion"
FT   gene            232436..233818
FT                   /locus_tag="WRi_002250"
FT   CDS_pept        232436..233818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002250"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002250"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95055"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5L3"
FT                   /protein_id="ACN95055.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHINETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            234564..236264
FT                   /locus_tag="WRi_002260"
FT   CDS_pept        234564..236264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002260"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002260"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95056"
FT                   /db_xref="GOA:C0R5L4"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5L4"
FT                   /protein_id="ACN95056.1"
FT                   /translation="MSEAKSLILAAILSMLIMVSWRIIYDNFFSTNQNQPLIEHIESFN
FT                   DLAPIIHQNRSEIINSTREQRVSLTNNMIKGSISLKGARFDDLILTNYHLEPSSSSPQV
FT                   VLLSPAESKDVYFAEFGWLDPSNKIKVPDSKAVWRADKLNQKEVNLSWDNENGILFRMK
FT                   INLDDNYMFKVEQVVENNTKDNVVLVPYGKINRKRDNINESYWISHEGVLGAFDNKLEE
FT                   WTYKDISKKHLIKANTSEKNWFGFADKYWLTVIIPEKSDKINVSIKHTNANDIDKFQVD
FT                   FVKSYKSILPGASTSNVNYFFAGAKKLNLLDSYKDTLNIPLFDKAVDFGVLYFITKPVF
FT                   LLLEYFNFVLKNFGLAILLLTLVIKLLMLPLSNRSYVSMFKVKSLQPELTRVKELYKND
FT                   SLKQHKETIALFKRNNVNPMSSIFPMLIQIPVFFALYKVLFVTIEMRHAPFFLWIKDLS
FT                   APDPTNIFTLFGLFNYNFPISIGILPIIFGATMIIQQKLSEKDQTSKDDIQVNVMKFLP
FT                   YISVFIFSSFPAGLVIYWIFSNIITLIQQSLIKLFLTKKVVVNVENTNS"
FT   gene            236242..236670
FT                   /gene="ribH"
FT                   /locus_tag="WRi_002270"
FT   CDS_pept        236242..236670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="WRi_002270"
FT                   /product="riboflavin synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002270"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95057"
FT                   /db_xref="GOA:C0R5L5"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5L5"
FT                   /protein_id="ACN95057.1"
FT                   /translation="MSRILIVNSIYYTEIANLLLEGAIDKLKGSNASYDVVEVPGTFEI
FT                   PATILFAVKSGHTNYDGYLALGCVIRGETDHYQYVCKGVIEGLNEVVMHYAIPLGMGVI
FT                   TADSKDKALVRADKNKKNVGGHAASTVLRMIDLHNKLK"
FT   gene            236670..237152
FT                   /locus_tag="WRi_002280"
FT   CDS_pept        236670..237152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002280"
FT                   /product="N utilization substance protein B, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002280"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95058"
FT                   /db_xref="GOA:C0R5L6"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5L6"
FT                   /protein_id="ACN95058.1"
FT                   /translation="MEEKPVDKKWRIKRSTARFLAVQIAYSNIFVGYNKSTFKLENCEL
FT                   KDYINKLKDIFECEEFEHQFLENLLYKVIKSSEEYDKIIESYLHPSWSLSRLNLISLSI
FT                   LRVAICELANCDTPVPVVINEYTNIASDLLDKPSEIGFINGLLDKAKDAVKLNKNP"
FT   gene            237446..238828
FT                   /locus_tag="WRi_002290"
FT   CDS_pept        237446..238828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002290"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002290"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95059"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95059.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            complement(239053..239682)
FT                   /locus_tag="WRi_002300"
FT   CDS_pept        complement(239053..239682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002300"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95060"
FT                   /db_xref="GOA:C0R5L8"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5L8"
FT                   /protein_id="ACN95060.1"
FT                   /translation="MKSFMLTFKNHCGQLHKANTVFVAFTAIYVIGGLAILSTPLWRPS
FT                   TCKLAAFAATPLGMGVLAFVAAALTYLAIYAISKNNEISELKALKVIKDGLLVTKDAFR
FT                   EIARNNQVKDEEGKVEKDKYYIDFSLEGKNYRIIVDINQLTSILGNTLLFKIGSLKEKN
FT                   DEGKFEAVNETKWNKTLGLDKDGAKEVNTYLGSPIVEQAAKGKVLD"
FT   gene            complement(239749..240210)
FT                   /gene="dut"
FT                   /locus_tag="WRi_002310"
FT   CDS_pept        complement(239749..240210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="WRi_002310"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002310"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95061"
FT                   /db_xref="GOA:C0R5L9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5L9"
FT                   /protein_id="ACN95061.1"
FT                   /translation="MQRSKIKVEIKRLSHGEDLSLPCYATVQSAGMDLYAALNDSAVLN
FT                   PLERLLVPTGIVIAIPNGFEGQVRPRSGLAAKHGITVLNSPGTIDSDYRGEVKICLINL
FT                   SNQPYEIKRGDRIAQILISPVSQVIWDDREEFCAEETGRNAGGFGSSGR"
FT   gene            complement(240913..241824)
FT                   /gene="argB"
FT                   /locus_tag="WRi_002320"
FT   CDS_pept        complement(240913..241824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="WRi_002320"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002320"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95062"
FT                   /db_xref="GOA:C0R5M0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5M0"
FT                   /protein_id="ACN95062.1"
FT                   /translation="MKSSEFLKGEVSFEQKAEILFEVLSNIPSFVGETFVIKCGGTIIL
FT                   DETLFNTFVHNVVLLKQLGINPVIIHDGEYEINSVLKVLGMDSKFVNGIRLTDRDTMKI
FT                   IEMALCGSVNKKIVQHINSAGGSAIGLCGKDGNLIKVEKITATLREDRSNNIEKILDMG
FT                   FIGRPTEINPDILFFIEESDFIPVIAPIGHGKDGETYHIDADSTASAIAIAVSASKMII
FT                   LSDTDEEIDKIGGRKISVKNLNASIDCGKIKGEKFIERLMAYVKMAEECAGVVHIVDGR
FT                   IPNIMLDLFTESNSSISIVSDL"
FT   gene            complement(241829..242422)
FT                   /locus_tag="WRi_002330"
FT   CDS_pept        complement(241829..242422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002330"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002330"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95063"
FT                   /db_xref="GOA:C0R5M1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5M1"
FT                   /protein_id="ACN95063.1"
FT                   /translation="MAKQITSNCNFIFGASDIKSLPNESAPEIAFAGRSNVGKSSLINL
FT                   LINSKKAARVSSKPGCTRQINFYSMYNDKFRLVDLPGYGYSHAGKEEIIQYLNLIEYYL
FT                   IQRRNLRRVFVLIDSKVGLKEIDKDFIYWLICNNINFNVVLTKIDKVSQKSLGAVIEDI
FT                   QRWINNENVSIHQMSIRVKHKITKVRDEFFKFTR"
FT   gene            242527..243600
FT                   /gene="prfA"
FT                   /locus_tag="WRi_002340"
FT   CDS_pept        242527..243600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="WRi_002340"
FT                   /product="peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002340"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95064"
FT                   /db_xref="GOA:C0R5M2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5M2"
FT                   /protein_id="ACN95064.1"
FT                   /translation="MENNLQDLKKKFNDIERNLENPTNLSQKEFITLSKEYSELRPIIK
FT                   IIDEYNTLKEEISDLEEIMKDENSEGDIKELAKEEFFEKHKVLLPKIKAKLKLALLPKD
FT                   EDDSRNAILEIRAGTGGEEAALFAAMLFRMYQKYAERRNWKFEPISISNTGIGGYKEAS
FT                   ALINGTEVFARLKFESGVHRVQRVPETESSGRLHTSAATVAILPEVEEVDFKIEEKDLR
FT                   IDVYRSSGPGGQSVNTTDSAVRVTHLPTGIVVIQQDEKSQHKNKAKALKVLRARLYEIE
FT                   RQKKEMERSTMRKSQIGSGDRSERIRTYNFPQSRITDHRINLTSHRLEQIIKEGELDEF
FT                   IEALISRNEAERLAGES"
FT   gene            complement(243628..244791)
FT                   /locus_tag="WRi_002350"
FT   CDS_pept        complement(243628..244791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002350"
FT                   /product="drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002350"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95065"
FT                   /db_xref="GOA:C0R5M3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5M3"
FT                   /protein_id="ACN95065.1"
FT                   /translation="MLLPFLLILSLIAKFIEIDISVPSFPDMVHYFNVSEGTIQLTIAY
FT                   NFLGFCIGGLFFGPLSECYGRRRIMIIGNTLLLIGAVGCVFAPSIFWLLISRFVQGIGV
FT                   STSVVVFAIVADSYKGDEAVKFIGIMNSVLTVVMAIAPVLGSFINEIVGWRGNYATVAI
FT                   LCLISWVLLLLALPETKKDRDIFSLKKMMKDYRKLLSSPRFVTLSLMSSLFSAAYMSFI
FT                   TCGPFLYMKTFGLSSTIYALHQGAIVGCFSLISLFAGKILQKLGAIKCVISGTSVGAIG
FT                   SLLLVIFSIIVPHSFYLVTLSMIIFSIGCAIFQPVIFNASINVFPEIKGTASSAVSFIR
FT                   AFIMAIFIGLTSYIYNGQTISVAVLVLSAIVLELVFTVYLLRLKDPM"
FT   gene            245256..246185
FT                   /locus_tag="WRi_002360"
FT   CDS_pept        245256..246185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002360"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95066"
FT                   /db_xref="GOA:C0R5M4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5M4"
FT                   /protein_id="ACN95066.1"
FT                   /translation="MFLTLFLKILPIYITIFIGYLAGKYLKIDRNTISQILFYIANPIV
FT                   ILYGVSHTEVNLKVISLPILIWFIGSTMSLSVYYLSSFLFKDNTRNILAFSSGSTSMGY
FT                   FGLPIAMALFDEDSVSVYVVCYIGMALFENSLGFYIAANGIYTAKECILKLFKLPSLYA
FT                   MVLGFFLSIYDIQIPTFLTDVMMNIRSTFVTLGMVLLGVSIANIASFKIDWKLALITIT
FT                   AKYVFWPLFVLGIVLLDKHVIGIYDESIYKALMLLAIIPVSGSSIILANILNYQPDKAT
FT                   LLLLISTAVGLFYVPLIISLFFTKLVPF"
FT   gene            246407..247375
FT                   /pseudo
FT                   /locus_tag="WRi_p02370"
FT                   /note="transposase, degenerate; ISWpi3"
FT   gene            247549..248880
FT                   /locus_tag="WRi_002400"
FT   CDS_pept        247549..248880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002400"
FT                   /product="DNA recombination protein rmuC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002400"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95067"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5M5"
FT                   /protein_id="ACN95067.1"
FT                   /translation="MLFNSIALVVSLLLFFYIIVKKLSEKKANLEGNLCKLEQELQETK
FT                   QTLLTKNEEIVDLRVKRAELEVTLQKEREEKKKEIELLTKAEERLTNTFKALSLDALQT
FT                   NNNNFLNLAKEVIDSKLKETESDFKKRQATINEVVTPIKEKLEKFDNEIRELEKERVGA
FT                   YEGLKEQIGALMNQTSNLANALRKPHIRGKWGEMQLKRVVEMAGMIEYCDFFTQPSVID
FT                   KNEDNLLRPDLIIKMPSGKQIIIDAKVPLDSYMDAISQNDLQIQKEKLKNHSLAIKKHI
FT                   NDLGKKEYWNQFENTPELVVLFLTGEGVFSAALEYEPALIEIGVEKKVIIATPITLIAL
FT                   LRAIAYGWKQEMIAENAKKISELGHILYERICTMGENFDNLRRSLKSAVDHYNKTAGSL
FT                   EARVFPAAREFNKLGIHAKNKSLSAAKELESLPRSLHTEGLKVD"
FT   gene            complement(249120..249863)
FT                   /pseudo
FT                   /locus_tag="WRi_p02410"
FT                   /note="transposase, truncated; disrupted by IS-insertion;
FT                   ISWpi6"
FT   gene            249956..251252
FT                   /pseudo
FT                   /locus_tag="WRi_p02420"
FT                   /note="transposase, degenerate; ISWpi6"
FT   gene            complement(251411..252880)
FT                   /gene="gatA"
FT                   /locus_tag="WRi_002430"
FT   CDS_pept        complement(251411..252880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="WRi_002430"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002430"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95068"
FT                   /db_xref="GOA:C0R5M6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5M6"
FT                   /protein_id="ACN95068.1"
FT                   /translation="MNELRKLSITQMHDGLKKKSFSAVELVEAHISAVENEKLNAFITK
FT                   TPEIAMKAAKAADEHFSRQKDDLISPLMGVPVGIKDLFCTKGIKTTACSKMLENFVPTY
FT                   ESTVSDLLLKSGAAMLGKLNMDEFAMGSANTNSYFGPVENVWIRKSDGEKVVPGGSSGG
FT                   SAASVAGFLCAGALGSDTGGSVRQPAAYCGVVGIKPTYGRCSRFGMIAFASSLDQAGVI
FT                   TRSVSDSALMLEAICGYDTKDSISSEKPVPKLSSFINGDVKGKCIGIPKEYRMDGISEE
FT                   IVHNWERVASYLKENGAEVVDITLPHTKYAIPVYYLICSAETSSNLARYDGVRYGLRVD
FT                   ADTLEEMYSLTRAEGFGKEVKRRILIGAYALSSGHYNEYYEKAQCIRALIRNDFIKAFE
FT                   KIDYILVPSAPTEAFGLNEKPDPLIMCINDVFTVPASLAGLPAISVPVGLSNEGLPLAL
FT                   QVIGNYYDEAGILNVASVIEQNCGRIIRPLA"
FT   gene            253270..254496
FT                   /locus_tag="WRi_002440"
FT   CDS_pept        253270..254496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002440"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002440"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95069"
FT                   /db_xref="GOA:C0R5M7"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5M7"
FT                   /protein_id="ACN95069.1"
FT                   /translation="MNEVITFGCRLNFYESELIKEALKKAKRENVVVVHSCAVTNEAER
FT                   QVKQKIRKIYKNDPNKEIIVVGCAVQLDPEVYSSIPGVSKVLGNQDKLKAENYLLNDDK
FT                   ILVSDNQVEPVLINGFEDKSRAFIEIQNGCNHSCTFCSITEARGNNRSVPINSIIEQIR
FT                   IFVENGYQEVVFTGVDITDFGTDLLGKPSLGSMIRRVLKDIPELKRLRLSSIDVAEVDD
FT                   ELMDLIANESRLMPHLHLSLQSGNNLILKRMKRRHNREQVIEFCHKMKSLRPNIAFGAD
FT                   IIAGFPTETDEMFQDTVDLLKKTNIVYLHAFPYSERKNTPAARMPQVPENVRKERVKNL
FT                   REVNKEIMSSFCQSLINTKQSVLVEQNNVGRAENFALIKLESKAQAKSIVKVNVKGVEN
FT                   NYLIGNIFS"
FT   gene            254563..255492
FT                   /locus_tag="WRi_002450"
FT   CDS_pept        254563..255492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002450"
FT                   /product="surface antigen-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002450"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95070"
FT                   /db_xref="GOA:C0R5M8"
FT                   /db_xref="InterPro:IPR002566"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5M8"
FT                   /protein_id="ACN95070.1"
FT                   /translation="MITRISITLFLIFISCVYFFITYISNDTHIEQVQPLKLETDNNES
FT                   VIRSEEVTEKEILINDLKYQELESSPIKQPSILQVANQKNMWSRIADQAEPTKEKSKKL
FT                   DFYVSANGGKVYHDNSETFVKGIQEIGKRVLTLVESHYGFIIKNIVANEIKSIQQFDGK
FT                   IDFQWLNSISLGYYAGENGRVDFETMYSRANIENSNSPLVFDKSASIFAFLLNFYYNPS
FT                   VQDIQFAPYIGLGIGPTVFRLKRISGSPQNSMPLNVPWFAYQMKLGVDYSIIPEVKTFL
FT                   GYRYFSVPIPVADDISTHNIEIGLIFNF"
FT   gene            complement(255500..257002)
FT                   /locus_tag="WRi_002460"
FT   CDS_pept        complement(255500..257002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002460"
FT                   /product="type II secretion system protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002460"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95071"
FT                   /db_xref="GOA:C0R5M9"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5M9"
FT                   /protein_id="ACN95071.1"
FT                   /translation="MYAVLMAIFKCLILLFIISCTHLPTKQYPINIDNYKHDYPLQQYN
FT                   TSLEINEPAIPEIMPLPIEFPDLTISNQLISINVSEEVSVKDLLIEIGKLSDVNLDMDP
FT                   KISGNIILKLKDKDINEVIQSIANSAKLRYSTSNGVIRIEQDLPYAQNYYVDFINIQHS
FT                   AQSSFVINNNITNSDGSNVDRDYNNVMKSQYSSDLWNSLEKGLNAIMDVNGVDDGEFLS
FT                   SNREAGVIILNARKDIHKAVEEYINKVKKLASSQVMIEAKIVEVVLDDKYLSGMNLNDL
FT                   RDGTKSIINQDNSIINLAMNFGANDLGDLVKNLDKFGTSTVISSPRVHAINNQQAMISF
FT                   TKNHIYFTSDIQKDTRNSNQTLITKMNSVPIGIVLIIHPSINIDTSEIFMDIHPTLSRI
FT                   NGYVKDPDIEYVAQQSKMKLNSDIPIVEIREMNSMLKIKSGEIMVIGGLIEHREDKQSL
FT                   LHQKSKRLANNIRTVETVIFLKATIVPTFGLLDRKDKNLYIY"
FT   gene            complement(257072..258454)
FT                   /locus_tag="WRi_002470"
FT   CDS_pept        complement(257072..258454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002470"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002470"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95072"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95072.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            complement(258612..259976)
FT                   /locus_tag="WRi_002480"
FT   CDS_pept        complement(258612..259976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002480"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002480"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95073"
FT                   /db_xref="GOA:C0R5N1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5N1"
FT                   /protein_id="ACN95073.1"
FT                   /translation="MAREEDINQLVENGFDINSKDASGITLLHKFTKEGDLVGVKSLLE
FT                   HEADFNVVDNENRNPLHYAIMHGHKKVAKLFVNQLTINSKDKNGFTPLHLAALQDDTEL
FT                   IDFLITKGAKINEKDAKEGYTPLHIASLYGSKKSVQILIDSGANLECEDNNFRTPLFLT
FT                   IYQCTAHYDSRAEIIEYLIKKGANIEAKDAENNTTLFLAAYNNKMQIVKLIAKKQQASN
FT                   DKIKLKEFFCTKNNHGFDALDCAIEHNNRKMVTFLVSKGIEANDQDFNGNARLHKASHN
FT                   GNTKTVKLLLKLKVNVNAVTKCNRTPLLLAVKKGHTQIVKMLLEVRANMNICEQQGFAP
FT                   LHLAVQKDYFDIAQLLTEKGADLNIKCNNGHTAIDMFISKAHSKKNIEENYKKFCRFLM
FT                   LYLKELHSKHKACCILSTLALSLTIIGLPFIFKPIIKYRERSTIYKKIRAMLVYI"
FT   gene            complement(260846..261520)
FT                   /locus_tag="WRi_002490"
FT   CDS_pept        complement(260846..261520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002490"
FT                   /product="rare lipoprotein A, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002490"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95074"
FT                   /db_xref="GOA:C0R5N2"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5N2"
FT                   /protein_id="ACN95074.1"
FT                   /translation="MIKNLAFLCLIFVLMSSCSFSNRFNCTAGHYKIGSSYTINGITYY
FT                   PKNCKHYEEIGIASWYGIEDHGTLTANGEAFNRHLISAAHKTLPLPCFVLVTNLENGRK
FT                   LVTRVNDRGPFIEGRIIDLSEKAAQVLGFHKSGLAKVKVQYLRKMSEQLIQNTPHYRKQ
FT                   YEKEMQKRHPKQDSAESKGYVAFFKSAQAAKSAASKLRNQGIKNVRLLFKNDQYCVKVS
FT                   YR"
FT   gene            261547..262971
FT                   /locus_tag="WRi_002500"
FT   CDS_pept        261547..262971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002500"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002500"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95075"
FT                   /db_xref="GOA:C0R5N3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5N3"
FT                   /protein_id="ACN95075.1"
FT                   /translation="MRILNYTIINLVMSKHLLLNINKTQKGIIHIIGIGGIGMSAIAEI
FT                   LHNSNYKVQGSDAQSNNNVDRLQKLGIEVYIGHNANNISQAQIVVHSSAIESDNVELVT
FT                   ARNNNKTILHRSDILAELLRDKYVIAVSGSSGKTTTTAMIASIFDHSNIDATVIVGGIL
FT                   NSYQSNSRLGKSDIFLIEADESDGTMLKIPANITVITSINDDHMDHYGTFDDIKHAFSQ
FT                   FINKADFAILPDSVGINYDASNSMMFGFESGNIRASNIKQHANSIEFDVLIDNNHRIKN
FT                   VVLSNTIGMHKVSNALAAISVAIKLGISDAEIKKGLLEFQGVARRFSLIADIKGVKLIE
FT                   DYAHHPNEIYATLTAARSITKGKVIGIIEPLRFARIRNFFDEFIRIFMMFDYVILTPVH
FT                   PPEDKPIPGCGIDDIQKALISNGFNNTKIMNDALLISHFISDSTSPSDIVLFIGAGSNI
FT                   AKLAKETAALIAEVKV"
FT   gene            262976..264250
FT                   /locus_tag="WRi_002510"
FT   CDS_pept        262976..264250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002510"
FT                   /product="Enolase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002510"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95076"
FT                   /db_xref="GOA:C0R5N4"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5N4"
FT                   /protein_id="ACN95076.1"
FT                   /translation="MNKIINNVFAREILDSRGYPTIEVEIELCDGAIGRASVPSGASTG
FT                   KLEALELRDQDEKRYCGKGVLKAVQAVNGIIADEIIGMNAADQNAIDKALIELDGTKNK
FT                   SKLGANATLGVSLAVAKAAANSFKMPLYRYLGGKQTSVMPVPLINIINGGVHADNKLDF
FT                   QEFMILPVGAETFSEAIRISAEVFHNLRSILKKKGYSTNVGDEGGFAPNIESTEEALDL
FT                   IIYAIESAGYSAQSDFALGLDVASSTFYEDGIYEFESKGLTSEELTEYYCNLVERYPII
FT                   SIEDAMSEDDYEGWKLLTAKLGNKIQLVGDDLFVTNCELICKGIEEKMANAVLIKPNQI
FT                   GTLTETFAAIEMAKSNGYKAVVSHRSGETEDTTISHIAVASNCGQIKTGSLSRSDRLAK
FT                   YNELMRIESTLGKDAKYYRGLAWVL"
FT   gene            264238..265260
FT                   /locus_tag="WRi_002520"
FT   CDS_pept        264238..265260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002520"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002520"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95077"
FT                   /db_xref="GOA:C0R5N5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5N5"
FT                   /protein_id="ACN95077.1"
FT                   /translation="MGFIDEVKLCLKAGDGGDGCASFRREKFVEFGGPNGGNGGKGGNI
FT                   VFISDANLNTLLHFRYRRHIKADSGKNGAGRDRSGTAGKDVILKVPVGAQIIDEESEEI
FT                   IVDLDKPGMEFQVAQGGKGGLGNTNFKSSTNKAPRHFTYGQPGEEKHVLLKLKVLSDVG
FT                   IIGMPNAGKSKFLTRCSNSDTKVGDYPFTTVRPHLGMVKVDDSEVVIADIPGIITDAHL
FT                   GVGLGHKFLKHIERCQILLHLIDVTHDDVVSAYSCIHNELELYNSDLVEKEEIVVLNKC
FT                   DLLREAEILEKKNHLANYLNKEVLCLSINGDLQPILRLLSEKLKKSNSKEIDVYDPFKA
FT                   "
FT   gene            265683..267071
FT                   /pseudo
FT                   /gene="fumC"
FT                   /locus_tag="WRi_p02530"
FT                   /note="fumarate hydratase, class II; disrupted by
FT                   IS-insertion"
FT   gene            267151..268534
FT                   /pseudo
FT                   /locus_tag="WRi_p02540"
FT                   /note="transposase, degenerate; disrupted by frameshift;
FT                   ISWpi5"
FT   gene            complement(268763..269086)
FT                   /locus_tag="WRi_002550"
FT   CDS_pept        complement(268763..269086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002550"
FT                   /product="glutaredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002550"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95078"
FT                   /db_xref="GOA:C0R5N6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5N6"
FT                   /protein_id="ACN95078.1"
FT                   /translation="MSNFEQIKKDITENDVVLYMKGTSDFPQCGFSGLVVSILKKLNVK
FT                   FKYINVLENDEIRESIKKFSDWPTIPQLYIKEEFIGGCDITREMYEKGELQSLLKEKKI
FT                   IAE"
FT   gene            complement(269102..269320)
FT                   /locus_tag="WRi_002560"
FT   CDS_pept        complement(269102..269320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002560"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95079"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5N7"
FT                   /protein_id="ACN95079.1"
FT                   /translation="MVIAIHELERIVKQSFPDADIKIHDLAGDDDHYHLKINSKCFLGK
FT                   TKIEQHKMVYKALEGQSIHALQLETNT"
FT   gene            complement(269399..270724)
FT                   /locus_tag="WRi_002570"
FT   CDS_pept        complement(269399..270724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002570"
FT                   /product="NADP-dependent malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002570"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95080"
FT                   /db_xref="GOA:C0R5N8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5N8"
FT                   /protein_id="ACN95080.1"
FT                   /translation="MMNDDLDSTTKQEALNYHSRGGKPGKISIMPTKPLSTQYDLSLAY
FT                   SPGVAAPCLEIAKNPEVVYDYTAKSNCVAVISNGTAVLGLGNIGPLAAKPVMEGKAVLF
FT                   KRFADIDAVDIEVGTENIEDFINAVRYLGPSWGGINLEDIRSPDCFIIEKRLNELMDIP
FT                   VFHDDQHGTAVVVAAGIENALDIVGKKLEDVKIIMNGAGAAGIACLEILKSMGAKNIVL
FT                   CDKQGVIYKGRNEDMNEWKEKYAIDTSERSLLDTIKGADVFIGLSAKDVLNEEMLKSMG
FT                   KDPIIFALANPDPEVRPEFAKSVRPDAIIATGRSDYNNQVNNVMGFPYIFRGALDVHAT
FT                   TINDEMKIAAADAIAKLAREPVPGEISAVYGGRKMGYGREYIIPTPFDPRLISIVAPAV
FT                   AKAAVDSGVARKAIQDWSKYENQLKSRLASALNMLKLLSSQC"
FT   gene            270856..271398
FT                   /gene="pgsA"
FT                   /locus_tag="WRi_002580"
FT   CDS_pept        270856..271398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="WRi_002580"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002580"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95081"
FT                   /db_xref="GOA:C0R5N9"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5N9"
FT                   /protein_id="ACN95081.1"
FT                   /translation="MLKKNVPNLLTISRALAVPAIILSFYIENKYAGLITISIFVFACI
FT                   TDFFDGYLARAWKVQSKFGKLFDPIADKLIVVSTIIMLVYKQKINDFTIVPSIIIICRE
FT                   ILVSGLREFLIATNVSLPVSKAGKIKTFLQMVAVVALIMNDYYMIQYTGAICLWVAAII
FT                   TMWSGYNYILAGIKQID"
FT   gene            join(271510..272145,273636..273941)
FT                   /pseudo
FT                   /locus_tag="WRi_p02590"
FT                   /note="hypothetical protein; disrupted by IS-insertion"
FT   gene            complement(272388..273410)
FT                   /locus_tag="WRi_002600"
FT   CDS_pept        complement(272388..273410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002600"
FT                   /product="transposase"
FT                   /note="ISWpi7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002600"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95082"
FT                   /db_xref="GOA:C0R2Q0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q0"
FT                   /protein_id="ACN95082.1"
FT                   /translation="MINNFLGIDVSKERFDVSLSFISKKGKRETRKRKFKNDDTGFQGL
FT                   LNFLQKHNVEEVKACMESTGCYSEALAEFLHNAGYFVSVVNPACIRFYAKSKLTRQKND
FT                   QTDAEIIADYCQRQEPSRWTPPSPEKKKLKHLYRCSNALKDELTLANNHLEKKERLPKE
FT                   VANAWEDLAMNIEQKIETIKNSIRELLKQHKELLEDFQLLLTIPGIGEETAIAILAEIP
FT                   GIKAFINARQLAAYAGTIPQNITSGSSVHAKPRLSKTGSRTLRKAMYFPAIAAKKHNPI
FT                   IMASCERLKEKGKHAMAIVGAAMRKLLHIVFGVLSSKKAFDPDHIKNYRAKRLTEGLVL
FT                   "
FT   gene            274002..274655
FT                   /locus_tag="WRi_002610"
FT   CDS_pept        274002..274655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002610"
FT                   /product="competence lipoprotein ComL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002610"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95083"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5P1"
FT                   /protein_id="ACN95083.1"
FT                   /translation="MYKTLITCFIFLICSFTQSYADDLEKTETELYEEAVELFDQKKYK
FT                   QAIRAFHKIEDLYPFSYWAMKAKLLSGVSHYNMGNYSSAASDMDDYIYVYSNGEDLPYV
FT                   YYLRVLSYYMQINKVQLGQQTAYKTLELATEYINLFPGSEYVDEIKERAKLITEHISTK
FT                   EYSIGKFYLRRGEYLAAIKRFQNMASYKDSKYFSKSINYLVAAHSALGLDLEAE"
FT   gene            274769..275509
FT                   /locus_tag="WRi_002620"
FT   CDS_pept        274769..275509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002620"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95084"
FT                   /db_xref="GOA:C0R5P2"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5P2"
FT                   /protein_id="ACN95084.1"
FT                   /translation="MAGHSQFSNIKHRKGAQDAKRSQKFTKLIREITVAAKQGLPDPEL
FT                   NPRLRSAIFAARKENLPKDKIETAIKNATGNVAGENYEEIQYEGHGPSGTALIVHALTN
FT                   NRNRTASEVRYIFSRKGGNLGETGSVSYLFDHVGLIVYKAEGVNFDDLFSHGIELEVLN
FT                   VEENDKEGLHVITCEIKDFGKVRDAFYAKFGEPELARLSWQPKDLIEISDKELIDKLSA
FT                   LVEELEDNDDVQYVEGNFTFVDKL"
FT   gene            275506..276444
FT                   /locus_tag="WRi_002630"
FT   CDS_pept        275506..276444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002630"
FT                   /product="M23/M37 peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002630"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95085"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5P3"
FT                   /protein_id="ACN95085.1"
FT                   /translation="MRLVIFVLLCILPAYATETSTDLAQPFQHGIRKKKATLTTESDRK
FT                   LLFISSTIKSSFFATEGLAPNTVVKLINIYKDFGVDFKKDIVPESKLEVLFERLPNNQK
FT                   TEEKILYASLTINKKAISLYHYKSQDGKERYFNKEGISLKNGEIFANPLNGDYRISSKF
FT                   GNRKHPVRGKIAFHKGVDYAAKLGTPIYAAAEGVIEYIGKNGGYGNYIKIKHKNEYSTC
FT                   YAHISRFSGDIKLGSKVKQGQIIAYVGSTGVATGPHLHYEVIYNGKHIDPLTIAHKTEV
FT                   KLPDHELREFKLFVNKINKTINRESSSEKEV"
FT   gene            276452..277297
FT                   /locus_tag="WRi_002640"
FT   CDS_pept        276452..277297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002640"
FT                   /product="SPFH domain/Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002640"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95086"
FT                   /db_xref="GOA:C0R5P4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5P4"
FT                   /protein_id="ACN95086.1"
FT                   /translation="MDKNTINDRNLSQIRAFPVLIALGLILSLLFLAYDSTIALGVAAV
FT                   SILTFLQGFFINDPNEARVIEFFGHYIGTYFKSGICVTLPFSSKYIVSLKFQNINTEKI
FT                   KVNDANGSPIEISAVIVWRVNSPAKAYYNVNNYHEFVFVQSDSVIRELASNYPYDSESN
FT                   EESLRKNSDKISDELRSMLQQRLDIAGIEITEARISHLAYSSEIAQAMLRRQQAHAITS
FT                   ARRHIVQNAIGIVEEVIAHFEKNKSLQLDGKQKVQLINNLLVALISEQDAQPTISLDNN
FT                   "
FT   gene            277465..277740
FT                   /locus_tag="WRi_002650"
FT   CDS_pept        277465..277740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002650"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95087"
FT                   /db_xref="GOA:C0R5P5"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5P5"
FT                   /protein_id="ACN95087.1"
FT                   /translation="MYINIEECFGFIALIASLIGLSPQVYKAYITKVTRDVSMLMLVNY
FT                   LICSLSWIGYGLYQSSIFVVLSNIAGLVISIISIIQKCYYDAKPAP"
FT   gene            277721..278413
FT                   /locus_tag="WRi_002660"
FT   CDS_pept        277721..278413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002660"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95088"
FT                   /db_xref="GOA:C0R5P6"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5P6"
FT                   /protein_id="ACN95088.1"
FT                   /translation="MQNLHHDHVLHCSTQQQYRSIVVLNGKIPSSSFFKRDIPIIAVDG
FT                   GANKLLSIGVKPDLVVGDLDSVNLDLRANLNTIYLPDQDYCDFSKAMAHLKTVKLLPSI
FT                   VTGITGGAIDHILQNINIFLSTGSIFYTPSPPMVGYTLQKGITHFFSLPKNTKISLLGI
FT                   PRAQISTKGLKWELHLSNLAFPGKNSCFNRSLGNKVSVEVHSGICLAMIYLETVDDAAR
FT                   HHVRQVKK"
FT   gene            complement(278694..279716)
FT                   /locus_tag="WRi_002670"
FT   CDS_pept        complement(278694..279716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002670"
FT                   /product="transposase"
FT                   /note="ISWpi7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002670"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95089"
FT                   /db_xref="GOA:C0R2Q0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q0"
FT                   /protein_id="ACN95089.1"
FT                   /translation="MINNFLGIDVSKERFDVSLSFISKKGKRETRKRKFKNDDTGFQGL
FT                   LNFLQKHNVEEVKACMESTGCYSEALAEFLHNAGYFVSVVNPACIRFYAKSKLTRQKND
FT                   QTDAEIIADYCQRQEPSRWTPPSPEKKKLKHLYRCSNALKDELTLANNHLEKKERLPKE
FT                   VANAWEDLAMNIEQKIETIKNSIRELLKQHKELLEDFQLLLTIPGIGEETAIAILAEIP
FT                   GIKAFINARQLAAYAGTIPQNITSGSSVHAKPRLSKTGSRTLRKAMYFPAIAAKKHNPI
FT                   IMASCERLKEKGKHAMAIVGAAMRKLLHIVFGVLSSKKAFDPDHIKNYRAKRLTEGLVL
FT                   "
FT   gene            complement(279943..280392)
FT                   /pseudo
FT                   /locus_tag="WRi_p02680"
FT                   /note="hypothetical protein; disrupted by IS-insertion"
FT   gene            280564..281550
FT                   /gene="gap"
FT                   /locus_tag="WRi_002690"
FT   CDS_pept        280564..281550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="WRi_002690"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002690"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95090"
FT                   /db_xref="GOA:C0R5P8"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5P8"
FT                   /protein_id="ACN95090.1"
FT                   /translation="MTVRVGINGLGRIGRGVLRAIFEIEEYSKQIEVVAVNGSLSAKQH
FT                   AHLIKYDSVHGKFSGDIDFNESQNWISINGKKFSLYRERNPENIPWNVDVILECTGAFN
FT                   KREEAIRHNAEKVIVSAPVPDADVTIVYGVNDDMLEKEHKVISAGSCTTNCLAPIVKVL
FT                   HSSLSIKSGFMTTIHAYTNDQNVLDGNHKDLRRARACGLSMVPTTTGAAKTIGSIIPEL
FT                   KGKLDGTAVRVPVSNVSMVDFKFTTDKKATVKEINEMFKDAASNVLSVCAEPLVSIDFV
FT                   HNPYSAIVDLTGTYVTGDICRVAAWYDNEWAFSLRMLDIALLSYSKV"
FT   gene            281547..282308
FT                   /locus_tag="WRi_002700"
FT   CDS_pept        281547..282308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002700"
FT                   /product="sec-independent protein translocase, tatc"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002700"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95091"
FT                   /db_xref="GOA:C0R5P9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5P9"
FT                   /protein_id="ACN95091.1"
FT                   /translation="MNWNSNKYASFYEHFAELRKRVIFCFLFFCVAFGFCYYFKENIYR
FT                   FLLAPLIEATKGSEGFSLIYTDLTEAFFVYLQVAIMSALLFSFPVFAWQFYMFLAPGLY
FT                   KSERAVLLPYLIATPVLFVTGATVVYYYIFPLAWKFFITFEHSGKSFGIPIEFMPSVSE
FT                   YLDLVLQFMFAFGTAFQIPVILTLMVRVGLLTTQSLSNKRRIAIVVIFIIAAILTPPDV
FT                   LSQVGLAIPMLILYELSILICRYIEKKKTKI"
FT   gene            complement(282362..282817)
FT                   /locus_tag="WRi_002710"
FT   CDS_pept        complement(282362..282817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002710"
FT                   /product="arginine repressor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002710"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95092"
FT                   /db_xref="GOA:C0R5Q0"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5Q0"
FT                   /protein_id="ACN95092.1"
FT                   /translation="MHDNTLGEHILNIIQNHEILEQSDLQTLLKERGHNIPQATLSRKL
FT                   KKLKIAKVAGVYKVIDINQYQLPLILNMQISDFGLIVLHTQPGQASSLAYFLDQKYVIY
FT                   SLNNSKNIGIIGTIAGDDTVLLIIKSKTELNKVLQSIYKTFPYLSLE"
FT   gene            282943..283677
FT                   /locus_tag="WRi_002720"
FT   CDS_pept        282943..283677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002720"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002720"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95093"
FT                   /db_xref="GOA:C0R5Q1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5Q1"
FT                   /protein_id="ACN95093.1"
FT                   /translation="MKKYILNAIIVISILLTGCKEDKHDNIIRFAISADYPPFEYYENG
FT                   KFTGFDIELAQLVAKELGKEAIFKDMQFSTIFAALQSNSVDAAISTIGSTEEREKNFDF
FT                   SNSYYTGEFGILYHKNKPIAGINNLTHKKIAVQLGTVMEIWLKEHVPTTAQIIAIDNNN
FT                   QAVETLKSGHVDGVLIDEFQGKVFSKKNPGLSWSAIAKSDNGYSIAVNKRSDLKDKINE
FT                   ALKSLESKGVIQKIAEKWLGDN"
FT   gene            283677..284324
FT                   /locus_tag="WRi_002730"
FT   CDS_pept        283677..284324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002730"
FT                   /product="amino acid ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002730"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95094"
FT                   /db_xref="GOA:C0R5Q2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5Q2"
FT                   /protein_id="ACN95094.1"
FT                   /translation="MQELISNFLFVGTGLAFTLKLLIGGLLLGMSLGGLFSVLRYNKIC
FT                   IPLINGIISVIRGTPLILQLSVVYFMTPTIAGIKLNIFSAGIIAFGLNSCAYIAEILRA
FT                   GIETISKNQFEAAKTLQIPSFYMWRDIILPQVIKNILPAMINEIIALLKETALISTIGG
FT                   VDIMRSAQMLAAEQFTYFIPLCLAGAYYYALVLLIEYIGKKIEQKGIYDKNA"
FT   gene            284308..284949
FT                   /locus_tag="WRi_002740"
FT   CDS_pept        284308..284949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002740"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002740"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95095"
FT                   /db_xref="GOA:C0R5Q3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5Q3"
FT                   /protein_id="ACN95095.1"
FT                   /translation="MIKMHNVCKLFNNIPVLNNINLIIEQSIVGLAGPSGSGKSTLLRC
FT                   IQKLEVLDSGSIECNDSTGFVFQDFQLFPHMTVWENLTYAPKLKNKTQDQSYSLLESLG
FT                   IASKKNDYPNNLSGGQKQRVALARSLMMNPKILLCDEPTSGLDVATIVDVVELLQSVRD
FT                   MGITMIIASHNLDFLTKISDRIILLKNGKIIVDINPKEIDEPTNYLKNNY"
FT   gene            complement(285476..286531)
FT                   /locus_tag="WRi_002750"
FT   CDS_pept        complement(285476..286531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002750"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002750"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95096"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5Q4"
FT                   /protein_id="ACN95096.1"
FT                   /translation="MSLTDIAHRINELASSWEQFKLINDRKLKEIESKGRADSATIEQL
FT                   CKVNNAIDGCKERLDLIETAAQRPEVNTDFSTSDKYFSDYIRKGMESGLSHKTLSGDDN
FT                   DIGGYLVTPHIVKRISKRVIDSSPMRQICSSQRISTETLDYIIEDFDRAGAGWSSETVD
FT                   DEDGGNKSKYDFAKDTDTPKIQKISITTYELYAQPQISQKLLDDAFVDVESWLVEKIAE
FT                   TFSKEESEAFIKGEGTFQPKGILAYENGNSYNKIEQVKTEKLDSDSIMMLYYSLDEYYS
FT                   KNASFLINRSTLKDIRLLKSQTGQYLWQPSLSLEAPDTLMGIPVYQSADMPPAPNNQLP
FT                   VIADGRFQTSL"
FT   gene            complement(287089..287886)
FT                   /locus_tag="WRi_002760"
FT   CDS_pept        complement(287089..287886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002760"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95097"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5Q5"
FT                   /protein_id="ACN95097.1"
FT                   /translation="MSNINRIIREVIKEFRSKLPDKEIEEYSGKLNKLHIYQCNKHIIE
FT                   NKKLYHYTINGKTHAMGQHGHNFVKSLEVILRNKPQISLEEVIDFMEKIINFGIDSCYG
FT                   AFEMIFESRSGVTIDDAVNFVKDSLSSKFYGFHGSGIFKVILELNPESSLEEIEKQFSK
FT                   VVDPYFLNAWSRESERAFAKICRLCREGHVENMQKFDFSNFNLDQDSAGALRALLQYCV
FT                   DVSNQKALGDSHELHREEMEGIYKFDDNYDLNLDSDHNDSIWH"
FT   gene            complement(287936..288610)
FT                   /gene="pyrF"
FT                   /locus_tag="WRi_002770"
FT   CDS_pept        complement(287936..288610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="WRi_002770"
FT                   /product="orotidine 5`-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002770"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95098"
FT                   /db_xref="GOA:C0R5Q6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5Q6"
FT                   /protein_id="ACN95098.1"
FT                   /translation="MNPIICALDTQDLNKAISLANALRGKVGMVKLGLEFFAAQGLSGV
FT                   QEVAKCNVPIFLDLKLHDIPNTVAKTVEVIKVLNIEMLTLHISGGTKMLEEALSVVQGT
FT                   KIKLIGVTVLTSMSNEDLNELGVAREAKSQVILLAKLAKKIGLHGVVCSALEAQEVRRE
FT                   CGEDFKIITPGIRIDPGHDDQKRTATPKEAINSGADYIVIGRPITKTTSSAELILKSMK
FT                   EF"
FT   gene            complement(288641..290044)
FT                   /locus_tag="WRi_002780"
FT   CDS_pept        complement(288641..290044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002780"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95099"
FT                   /db_xref="GOA:C0R5Q7"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5Q7"
FT                   /protein_id="ACN95099.1"
FT                   /translation="MSNLLSEANAFYFVASSLATLTLLTSLALIVTSNVPLPLILALAT
FT                   LSILVLALSCKIISNNKKIEVERNKFAQKEQELENKITLGKEAEKAANKEVEKLKHELT
FT                   REKQNLDKRAKKLNQKVNESEVERESLLEEKESLEKKLETAKNHTFEINNELDKTRKEI
FT                   GKLSEQEEKLKLEISCLKKQLEERSRFIAKLKMEVDDNKHLELENKGLNDRIETLREVQ
FT                   KALREKKHELSEKVEVLNKEKNKLSKEVKELREEQEKLYISLDKLQCKIKEVNKEKEDL
FT                   RQVLSCSYSWQEFSEEMERCSSREKRMRESCSNELKRLEDLILEKSSEIEQLEKDLLRE
FT                   KEEKMSYVARITEYMLCKLEESIKRSKVIKNDDKTVILQEIPVMKSVLEEVVQDLRGKT
FT                   SGKDSEYASLPDETSVPLHAGDPGYESEEDSGYNSRSSTPIKLPNSLLTESYERSQFNQ
FT                   SESICKTQQ"
FT   gene            complement(290203..291330)
FT                   /locus_tag="WRi_002790"
FT   CDS_pept        complement(290203..291330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002790"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95100"
FT                   /db_xref="GOA:C0R5Q8"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5Q8"
FT                   /protein_id="ACN95100.1"
FT                   /translation="MSNLLSEANAFYFVASSLATLTLLTSLALIVTSNVPLPLILALAT
FT                   LSVLVLALSYKIISNNVELEAKVKGQLEHKEEMLSLEHQELRDENTRLNERVDSLMEEL
FT                   CQCKLESEKNKLCLKSEYEDELRLRLEYEDELNLELEHKSREASSLRTQLTMLRKKVEV
FT                   EEVKQLKTLESEEQHESSESDIEELEKKLCQSEKEKKELEGKVSDERQKRTDLESKVDK
FT                   LCTKEKEYLSKIKELEKESLSLQKEEKESDNTLTTVNDDRDNKVKELNSSLLKQSSQIE
FT                   QLQKALLEKKKEEVLFLQRMIEYVTDEVEKLVRENEVIRDDDKKVILQVIQATKSVLVE
FT                   EAAQYLPGETSVPSFMEDPGYTSGCSTPTNSCHTF"
FT   gene            complement(291504..292904)
FT                   /pseudo
FT                   /locus_tag="WRi_p02800"
FT                   /note="ATPase, AAA family; contains in-frame stop codon"
FT   gene            complement(293042..295513)
FT                   /gene="valS"
FT                   /locus_tag="WRi_002810"
FT   CDS_pept        complement(293042..295513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="WRi_002810"
FT                   /product="valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002810"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95101"
FT                   /db_xref="GOA:C0R5Q9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5Q9"
FT                   /protein_id="ACN95101.1"
FT                   /translation="MLKEKYGFKEVEDKCNILWEGSKVYRWNGGKDNTFTIDTPPPTIS
FT                   GKLHIGHIFSYCHTDFIARFQRMLGKDVFYPIGFDDNGLPTERLVEQTYKTRAKEVGRE
FT                   KFIEMCHEVIEKSKQEFKELFKSVGISYDWDLEYHTISKETVTLSQMSFIDLYNKGYAY
FT                   RKMQPILWDPVDKTAIAQAEIEDKVFESSLNTIVFSTQENEQINIATTRPELLPACVAV
FT                   FCHPEDARYTHLIGKTAVVPITKEKVLIIADDKVKIDKGTGLVMCCTFGDELDIYWQQK
FT                   HNLPMKIIIDQDGRMNLDDVIPPHPGVMKVADTGIYDEINGLKVTAARKRMIEILSGKG
FT                   LLIESTSISHSVKCAERSGAPLEILPTYQWFIKTLEQKAQVLDKVKECNWHPATMRKRM
FT                   EVWIEGLNWDWCISRQRYFGVPFPAWYSKRKGEEGKIILAEVKDLPIDPLKDLPKGYSK
FT                   EEVIPDQDVMDTWATSSITPQLSALAVNSEFSLPNHRYDTIFPADLRSQSHEIIRTWAF
FT                   YTILKAHYHANSLPWKNIMISGWCLADDKKKMSKSKGNIITPHVILETYGADVVRYWAA
FT                   NSRLGVDTVYSENIFKIGQRLVTKLWNASKFVSMFMEKHQTVSINSISETMDKWILSKL
FT                   YKVIGRATNNLLQFEYCEALGAIEEFFWKDFCDNYLELVKKRAYGSSEATLSAKQSLAY
FT                   VLNVILRLFAPFLPYITEEIYHQLYSYNSVHNQSNWPSKEELIYDKYSEEMGDNVIQIL
FT                   NIIRKIKADNNVSVKHLIKKLVIKADLREDKLNQSAQNDLQAVCNAEMIEWMQSELETE
FT                   NGKYIVNIDLY"
FT   gene            295763..297034
FT                   /locus_tag="WRi_002820"
FT   CDS_pept        295763..297034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002820"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95102"
FT                   /db_xref="GOA:C0R5R0"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5R0"
FT                   /protein_id="ACN95102.1"
FT                   /translation="MLSLKNGTIQVADDKIVLVIKKDDYEEFKKYKNVDKSGAIIDDTF
FT                   YVGCTLNDQQLYITGSYPQEELGDNTIMNVKSVGKKGGKYFSRLEEMKNLLGLNDRKEE
FT                   IMVKALSCHPTVQLLEEKNVKTTELEAAEEQLKGKNEELEAAKKKAEEELRIKTQELQD
FT                   QLDTAQQEKQDLEAEVEKLKAIDSTALQQQLEEKNAKITELEALDAVALQQKLTEKENK
FT                   ITALKAQPDAAVTKLEGEKTTLTNKIKDLEAQLNNQPNAAQLKDKDEKIKDLEAQLSNR
FT                   PDAAQLKDKEDKIKELEAKINQPNAEVESLKKDLQARNARVHQLEKENKELEAKNKTTE
FT                   QPKQGNGGRYTATVGMGLAAGLIAFTALERTVRLDIWVMVGIAVVSTLAVGSITYAALP
FT                   STQVNGAEVQGVSGGKTRQLNTVC"
FT   gene            complement(297075..297590)
FT                   /locus_tag="WRi_002830"
FT   CDS_pept        complement(297075..297590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002830"
FT                   /product="hexapeptide transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002830"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95103"
FT                   /db_xref="GOA:C0R5R1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5R1"
FT                   /protein_id="ACN95103.1"
FT                   /translation="MYHILKYKDYEPKIDESAFIAGGSHIIGKVEIGRDASIWFNCVIR
FT                   GDVGSIKIGNGTNIQDGTVIHVDRNPGGDTIIGSMVTVGHFCVLHACTVHDKAFIGMGS
FT                   TVMDHAVVEPEAMVAAGSLVTHGKVIKSGEIWAGRPAKFFKKMSNEEIKHIAQSAQNYI
FT                   MLMKEYKN"
FT   gene            297735..298055
FT                   /locus_tag="WRi_002840"
FT   CDS_pept        297735..298055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002840"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002840"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95104"
FT                   /db_xref="GOA:C0R5R2"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5R2"
FT                   /protein_id="ACN95104.1"
FT                   /translation="MSVAVLSIFQIILVVVLVILVLLQPPGSSSLSGFSNTQQGVNSMI
FT                   PVKSSENPLSRITAIVAGLFIINTLLLSGLCSKDVHKKSIAEKIILEKKQESESTSVPF
FT                   EN"
FT   gene            298055..299659
FT                   /gene="pyrG"
FT                   /locus_tag="WRi_002850"
FT   CDS_pept        298055..299659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="WRi_002850"
FT                   /product="CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002850"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95105"
FT                   /db_xref="GOA:C0R5R3"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5R3"
FT                   /protein_id="ACN95105.1"
FT                   /translation="MKEAKFIFVTGGVVSSLGKGLVASSVGALLQAHGFKIRIRKLDPY
FT                   LNIDPGTMNPTQHGEVFVTEDGAETDLDLGHYERFTGIKATKDDNITTGKIYHELLKKE
FT                   RRGDYLGKTVQVIPHVTDLIKSFIFNGTEGLDFVICEIGGTVGDIESQPFLEAIRQVNY
FT                   TLGKQRVILIHLTLIPYLTAAQELKTKPTQHSVRELNSAGLQPDIILCRSEKEIFDNQR
FT                   EKIAKLCNVSLSNVIPAPDVSHIYELPVLYSQCGLDTQILEHFHLSKPKPSLTEWDQIV
FT                   HSIRHPTQEVTVSIVGKYTEFPDAYKSLVEALNHGAISNKVKVKINWVNSREKEEKPIN
FT                   EKLIGEKLQNSHAILVPGGFGDDGVEGKILAINYARTNNIPFFGICLGMQLAIIEFARN
FT                   VVKLEDAHSEEFRNCKHPIVKLAGDQDDDLGGTMRLGAYKCNINANSKMMDAYSNTTIS
FT                   ERHRHRYIINSDYKDDLEKNGLLCSGISEDGTCIEAVELESHPWFIGVQFHPEFQSKPF
FT                   SPHPLFVSFIEAAIDKK"
FT   gene            299685..300092
FT                   /locus_tag="WRi_002860"
FT   CDS_pept        299685..300092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002860"
FT                   /product="cytidine and deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002860"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95106"
FT                   /db_xref="GOA:C0R5R4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5R4"
FT                   /protein_id="ACN95106.1"
FT                   /translation="MELAIEQAKLAQKNDEVPIGAVIVSGDNIISSAHNISSDPTAHAE
FT                   MLAIRQAFSTSTLCDTDMYVTLEPCPMCAQAISFARIKRLYFGAYNPKGGGIENGAKIF
FT                   QFCSHIPEVYGGILETECSFLLKDFFEKLRT"
FT   gene            complement(300164..301423)
FT                   /locus_tag="WRi_002870"
FT   CDS_pept        complement(300164..301423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002870"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95107"
FT                   /db_xref="GOA:C0R5R5"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5R5"
FT                   /protein_id="ACN95107.1"
FT                   /translation="MFSLGMGAAATFTLIKMSPLVLVIVAVTFFLTAIASMSLFVLYKK
FT                   VKGERKHEVIVNNAVFNISLEEAANDLFSGLSTIAERGAEAGALYLEVKEKTESVAKKM
FT                   TSKKELIEARFQNIQENFINKLSNFEELQGARDSSTLKKFYAAVKDVLKIRSSIPISNL
FT                   HLLSLVYHLSLEVSYAIFQAITDPILGSTILTAISERKLPEDKQWAKVLKNTVPNLIRN
FT                   QEVVRNVIVPTLTDILKSLSESREERKFIIYTLVCLKEVIDEVYTTSVQESLYRILGVE
FT                   LANSLNGMVQAISNLLGCYGHKEVERARTANELDYRVGKLTPEETQQFVINLGERVGSL
FT                   REFEGRVTNKQSISKLIDYCLDPKLNDREAAATLLNYILTCTEDGRYLAAEAGTNNNLS
FT                   SNSNVVLITHVAANRSAQLD"
FT   gene            complement(301441..302916)
FT                   /locus_tag="WRi_002880"
FT   CDS_pept        complement(301441..302916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002880"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002880"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95108"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5R6"
FT                   /protein_id="ACN95108.1"
FT                   /translation="MTTNTENNNRINIVREQAGNAVHSDIAYSERIQKSVENEALCDAW
FT                   SNFEYFEDVLRIKNSTDRENRIKQLIKEDLDINATKNGKTILDVAIEKKCSSKVISSLI
FT                   SNGSRIDTINASDRTVLHRSVRNENRKVVELFLEANEKEVSQYLVARFLPLSMLYQKIE
FT                   VNAKDNDGCTALDYAQYGSEMYSLLQKYGAQHSEKFLYSRNLNIGELDLNKLVSDHNYC
FT                   FDVLTKALEIEDRCEKEEVIDWLLKNGANINVNKGDQALLSVAAEKGDVENAVLLLERG
FT                   AHEGVNSQDAEGRTLLLNAIIQDKLGHAKYLIKQRVNVNIPDNNGNSSLHYAVVNFIKQ
FT                   RLIECDETYTANATFYDFLKNGADLYIKNHDNLTAFEYAFHARIAPREAVYLFKLYIER
FT                   GDQSENMQLVKNFKLPSGETLLEYFFNNKLFDSAQSCIDLGANVSHNGSSLLIQALQNR
FT                   DIEGIGFLYETEQTFQITQTFQIIRKTVSCISK"
FT   gene            complement(303166..304371)
FT                   /locus_tag="WRi_002890"
FT   CDS_pept        complement(303166..304371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002890"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002890"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95109"
FT                   /db_xref="GOA:C0R5R7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5R7"
FT                   /protein_id="ACN95109.1"
FT                   /translation="MLFIDLVNIISREFCCAKDVYNRILQLFGIAGLGAMVRPLGAFIF
FT                   GHIGDRYGRRMALTIAILLISIPSSLVAFIPSYSKIGITSTILLLAIHVTQGIALGAEQ
FT                   GGSSVYLIEHLPNKKKLGMFFGIISFGRSIGILLSVIVVIICKKNTDFNAWGWRLPFTF
FT                   SFVLGLISAYSVYTLGETPAYEENRKQRNLSDLPIIELIKRYKRALILAILISVPVNVV
FT                   VGFTIFLRTIAKEIVSVETYVTTYVNEIVLIITSILMPVSSIALGMLADKVGKERTTIL
FT                   FTVITMVLCCPVLSTAYYYKSYLIIMLGVMALSIIERGINPIGIVAAELFPTNVRFSGV
FT                   SLSRNISYALHGGFTPMICTWFTITFPQVNFAAGLYVVFCLLVSLVAILQIKPQDKKFD
FT                   WS"
FT   gene            304561..305145
FT                   /locus_tag="WRi_002900"
FT   CDS_pept        304561..305145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002900"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95110"
FT                   /db_xref="GOA:C0R5R8"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5R8"
FT                   /protein_id="ACN95110.1"
FT                   /translation="MVGVIYLAMLGVAAIIGAIIGTLIGLLLSFTSLSPLIIGGTVGAI
FT                   YVVPLIAAFITILLYPIPYERHSGLTLKETACLAGLFIGSVAAGVGLVACGLTPIIKVD
FT                   SLSTTVSSLLAMGATIPVLLIATAIGVAIVIELAKQAKEYISGKIMQAEKEPVTDTHEE
FT                   PGSKMEEAKEEKTARNKQAVRECSKNSPQPG"
FT   gene            305479..306576
FT                   /locus_tag="WRi_002910"
FT   CDS_pept        305479..306576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002910"
FT                   /product="ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002910"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95111"
FT                   /db_xref="GOA:C0R5R9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5R9"
FT                   /protein_id="ACN95111.1"
FT                   /translation="MKKIEISELLKRISICLLCVATIISIAFLFAYMHTMLLSKGYELA
FT                   AHYVSEAMPCVLLVVFFFIAWFIYDQIFSKLKEVELPISIELANSDDKRITFADAIIDD
FT                   SLRQRLQMICCDQMTEEMRKLFGNKSINSLRGYILYGPPGNGKTLIARAIAGESNMNFI
FT                   SISGPELIGVYIGHGAHAVRELFKIAKKYSPCIVFIDEIDAVAQKRSTANNSAYHCRES
FT                   LTQLLTEIDGFKSRKDIIVIGATNLIGGIDPALIRPGRLGQKVYVPNPNIEVRQKILAL
FT                   YMRGTKTDEKLSLQDIADKTEGYSGAELEQLVNEAKISAGAQRRLIVSEEDFSYALHRL
FT                   SPEQERDRIRLVSNVKTPTEVSYSI"
FT   gene            306817..307815
FT                   /locus_tag="WRi_002920"
FT   CDS_pept        306817..307815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002920"
FT                   /product="pyruvate dehydrogenase complex, E1 component,
FT                   pyruvate dehydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002920"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95112"
FT                   /db_xref="GOA:C0R5S0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5S0"
FT                   /protein_id="ACN95112.1"
FT                   /translation="MATLSVREALCTAIREEMQNDSDVLIMGEEVAEYDGAYKVTKGLL
FT                   KEFGENRVVDTPITEHGFAGLAVGAAFAGLKPIVEFMTFNFSMQAIDQIVNSAAKTNYM
FT                   SGGQLGCPIVFRGPNGAAARVAAQHSQCFAAWYSHIPGLKVIAPYFASDCRGLLKAAIR
FT                   DPNPVIFLENEIAYGHEHEVSDSELSNKDYLLEIGKAAVIREGKDVTITAFSLKLMDAL
FT                   NAADLLSSEGIEAEVIDLRTLRPLDTQTVINSIQKTNRLVSVEEGWPFAGIGAELSAVV
FT                   MEQGFDYLDAPVVRVTGKDIPLPYAANLEKKALPQVEDIVEAVHQVCFRKK"
FT   gene            complement(307791..308165)
FT                   /locus_tag="WRi_002930"
FT   CDS_pept        complement(307791..308165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002930"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95113"
FT                   /db_xref="GOA:C0R5S1"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5S1"
FT                   /protein_id="ACN95113.1"
FT                   /translation="MNPRKVFNILFIVLFISFSHVGSAAADTNTDTTAQVICNIIGYVW
FT                   GIGGPLMTVVIIGAALLAIFGRMPWPALFALGIFCAVFFGAKTIVIKVMGGIGSTGNTS
FT                   LMDQCGTGDTKKNYFFLKQT"
FT   gene            complement(308553..309935)
FT                   /locus_tag="WRi_002940"
FT   CDS_pept        complement(308553..309935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002940"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002940"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95114"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95114.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            complement(310502..312298)
FT                   /locus_tag="WRi_002950"
FT   CDS_pept        complement(310502..312298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002950"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002950"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95115"
FT                   /db_xref="GOA:C0R5S3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5S3"
FT                   /protein_id="ACN95115.1"
FT                   /translation="MNNIRNFAIIAHIDHGKSTLADRLIEECNGLEAREMINQILDSMD
FT                   IERERGITIKAQTVKLNYTANDGNQYCLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDS
FT                   SQGVEAQTLANVYKAIDNNHEIIVVLNKVDLPAADPEKVKLQVEEVIGIDASESVLISA
FT                   KTGLGIKDVLEAIVAKLPAPQGDVNAPLQAILVDSWYDTYLGVVILVRVKNGVLKKGMK
FT                   IVMMSNNATYQIDNIGIFTPKKVMTGELSAGEVGFITASMKEVADCKVGDTITEEKRPC
FT                   SEALPGFKEVHPVVFCSIFPHKTDDFKYLREALEKLHLNDASFTFEAETSNALGYGFRC
FT                   GFLGMLHLEVIQERLEREFDLDLTATAPSVIYRVTTRSGEILNIHNPSDMPDPTKIEIV
FT                   EEPWITATIMVPDQYLGEILSLCEERRGEQEDLSYIGNTTTALLRYKLPLSEVVFDFYD
FT                   RLKSISKGYASLDWEISSYLVSQIDKLSFLINGEPVDALACIVHKSRAEKRGREICARL
FT                   KDLIPRQQYKIAIQAAVGGKIIARETINPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKR
FT                   LHSIGNVNIPQNAFIQALKISD"
FT   gene            complement(312378..313781)
FT                   /locus_tag="WRi_002960"
FT   CDS_pept        complement(312378..313781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002960"
FT                   /product="Malonyl-CoA decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002960"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95116"
FT                   /db_xref="GOA:C0R5S4"
FT                   /db_xref="InterPro:IPR007956"
FT                   /db_xref="InterPro:IPR035372"
FT                   /db_xref="InterPro:IPR038351"
FT                   /db_xref="InterPro:IPR038917"
FT                   /db_xref="InterPro:IPR042303"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5S4"
FT                   /protein_id="ACN95116.1"
FT                   /translation="MTKESLVKTDIVKVEDKKAVRSFFKILGGVADAVRSWIGNISPDL
FT                   SNSRDIDSLVLKMNECLNPKGGEVSARKNAVSLGNLYLSLSEKGKIKFLQTLAEKFNPN
FT                   KAEIDEKIKEYKKNQDPELNYKFEQDLIKILESPRSKILKQFISLPEGLKFIVDMRSDV
FT                   LKLKNQHRSLNPLENELKNILYTWVDVDLLDLRQITWDSPASLLEKLIKYEAVHKISSW
FT                   GDLKNRLDSDRLCFAFFHYKIPNEPLIFVEVALVDKIADSIQHLLDESVPSNDPSNAST
FT                   AIFYSISNTQAGLSGISLGNFLIKRVVEKLSQEFKSIKTYATLSPIPGFTKWLKNNLNQ
FT                   DVTLLGKLNIKQSSAEILESAEQLKTNVECTNETKQYMLKLCAYYLLKVNNSNGNTYDP
FT                   VAHFHLSNGASIKQLNWMADTSEKGISQSAGMMVNYLYELPKIDNNHENYMVNKVISCS
FT                   KKVSSMLKE"
FT   gene            314769..315146
FT                   /locus_tag="WRi_002970"
FT   CDS_pept        314769..315146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002970"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95117"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5S5"
FT                   /protein_id="ACN95117.1"
FT                   /translation="MIPFIVGCITSFVSLMAINAIKGNYYNGPGSLTCIPVFHANMSNF
FT                   SDFTTDRINTFASFIIGTIAYKAAQNISTLVRDVSSLLHNRLEVQKNESEIARYKKIQE
FT                   NVISILSEVKVGSNLSRDINC"
FT   gene            315398..315931
FT                   /locus_tag="WRi_002980"
FT   CDS_pept        315398..315931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_002980"
FT                   /product="phage prohead protease"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_002980"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95118"
FT                   /db_xref="GOA:C0R5S6"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5S6"
FT                   /protein_id="ACN95118.1"
FT                   /translation="MNKKFLYSPLSIKSIGENGVFSGYASVFNIVDKQNDLILPGAFKE
FT                   NLNRNKIKLLWQHNPDEPIGSIIDIYENDVGLYITAHLLLGIQKAEEVYLMLKTGAING
FT                   LSIGYIPIEYDVDHKSGARVLKQVELWEVSLVTFPANLAAQVINVKNQNNEQEVLARAI
FT                   EKANAVLADMYISA"
FT   gene            316067..317776
FT                   /pseudo
FT                   /locus_tag="WRi_p02990"
FT                   /note="hypothetical protein, truncated; disrupted by
FT                   IS-insertion"
FT   gene            317857..319237
FT                   /pseudo
FT                   /locus_tag="WRi_p03000"
FT                   /note="transposase, degenerate; ISWpi5"
FT   gene            complement(319263..320435)
FT                   /locus_tag="WRi_003010"
FT   CDS_pept        complement(319263..320435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003010"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003010"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95119"
FT                   /db_xref="GOA:C0R5S7"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5S7"
FT                   /protein_id="ACN95119.1"
FT                   /translation="MQVDQETSLIIDAIEEFGGEARLVGGCVRDSILQRDVHDIDLATN
FT                   LLPNQTIKALKLRNIKTIPTGLNHGTITAILNQRSFEITTLRHDVKCDGRHAKVEFTNN
FT                   WQADASRRDFTFNALYADKHGHIYDYFGGIEDLKVRRLNFIGNAEDRIKEDYLRILRAF
FT                   RFHAKICVGDLSDEILNVCKKHSHMIQNLSGERIRDEILKLLECNDPFPTLKSMQESDV
FT                   LQKIIPKEVKCEILSSSLLFGTDALVKLALLLRTTKNDRLSLGEYVSKFLRLSNKQKKK
FT                   LLFLLSNDIKTELSEKEQKKYISLFGRELYCDLVKICGVESGENVDEYISFANTFNIPK
FT                   FPLSGDDLISIGHQPGKSLGRNLELLKQHWEDSSYTLTKEELVLYAKSLF"
FT   gene            complement(320519..321463)
FT                   /locus_tag="WRi_003020"
FT   CDS_pept        complement(320519..321463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003020"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95120"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5S8"
FT                   /protein_id="ACN95120.1"
FT                   /translation="MAEPRKRKLPSDFHDVEVGIKRPRISGQEITLLNSNPYPDNFYVG
FT                   QAIGNGSCFFDSFRQSLEQQTGEQVTAEKLRNDCREFAQKNPPKWFTDAIANGYDNNGQ
FT                   HRSETVDDYTANIMRNDRWGDPDVEGRILCEKYKVKLHVIENQTVDNQDLFLHELIDNS
FT                   GSKSAGEYNKVNYDDSSVLHVINKGHAHFEPLLDRNKSLAKQEQEETKLKQEQEQEDCL
FT                   LAKKLQLDEILEYCNLSKDISERAEVEKRFDELLAENADGKICDVVEQCVSDIKQHIQR
FT                   SEKQKSLSPSCSMEEAKIERLSHQQQQQQIPAQ"
FT   gene            321582..322676
FT                   /locus_tag="WRi_003030"
FT   CDS_pept        321582..322676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003030"
FT                   /product="GTP-binding protein YchF"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003030"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95121"
FT                   /db_xref="GOA:C0R5S9"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5S9"
FT                   /protein_id="ACN95121.1"
FT                   /translation="MSFNCGIVGLPNIGKSTLFNALTESSAAEAANYPFCTIEPNIGKI
FT                   SIKDQRLKQIAAIAGSEKIIYNQLEVVDIAGLVKGASKGEGLGNKFLSHIREVDAIVHL
FT                   LRCFTDDDISHVHSKIDPISDAEVVEMELILADIDSIEKRLPQLEKKAKQGDKELKRQL
FT                   ELMQEVLATLKLGKPARSLENIDEDEMKSLQLLTTKPVMYVCNVEDTNVITGNELSKKV
FT                   ERMAEENKSKFYCISAKLEADIANLDSEEEKQSFLSEFGLQESGLDGVARIMYEVLSMI
FT                   TFFTVGPKEARAWPVKIGSTADKAAGVIHTDFEKGFIKAETISFADYIKYGSESACKDA
FT                   GKIRFEGRDYIMQDGDIMHFRFNV"
FT   gene            322779..323981
FT                   /locus_tag="WRi_003040"
FT   CDS_pept        322779..323981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003040"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003040"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95122"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5T0"
FT                   /protein_id="ACN95122.1"
FT                   /translation="MKNILYFILLAVVFGSLSLFAVEQFEEKKIESVHKNENVGVRKQD
FT                   STNQKDELKSNVDAKQTQEAESKRLDDTTDKEKLQHNENKASVVEKTTSEGERIDKGLP
FT                   NDQLEGSTDKFAQNLPNVVNKEVNKDLKPEPLPLSADLNENTANPQKNLQADQKIDIKD
FT                   NELSKSDASQLLEGKKEKVENQSEEKKVKETNSNSKDRNRVKPITKKDEEEQSEKKSLQ
FT                   KWTKLNREPIKEWGHKDIQSKSIYKRQYDSLNEHLPTTVFIDDYSKQFFYCIKKNNLTC
FT                   LRGVISKLEKIGLTIQEILRFRNKLGDTPLIYSVKQGEVDIVRFLLLQGADLRVVNNNF
FT                   QSPIDIAIERKQVKIINAIAEMMPHLLEDRKIDNKESSAMYDWAVKTKENNELQCDKQD
FT                   D"
FT   gene            323974..325779
FT                   /locus_tag="WRi_003050"
FT   CDS_pept        323974..325779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003050"
FT                   /product="pentapeptide repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003050"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95123"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5T1"
FT                   /protein_id="ACN95123.1"
FT                   /translation="MIRFLILILVGHLCYGNETNDEKNQISDFLNALHDVKYVSYSKKD
FT                   FAEFLVQCHKEGVPEDFKKGFGSNLNGANFNQLYLSKSVFDGVSLIGADFSNTDLSDVS
FT                   FIDVDLRGANFSNANLHGIKIKGTNLSFTKFVSANLTDIVFDQSNVSYADFISSDLKKV
FT                   SMHNVIGLHTNFSNVKMNFSNLSNSNVSHVNFSDSEINDTVMQKNNLNNASFFGVDAYK
FT                   LKIQFSSLKNANIYGAELKESDFTGSNLSDACLNSSIIIDSNFDETNLSNTQISYVNDD
FT                   NSSFVQSILNGSKIKHAYVSEANLHDADLSNIDFSFSELHQVNVSNADIRHGKFHNTKV
FT                   ANSNMNGSFFDHSLFTSAKIEDSDLSTTSMYKIKIQDSQVYNSTLSRHNIDSSEIENST
FT                   FFNLLADNSSWSNLKVTNSNFIESDFRSSLLHANAFRKTSFFLSNLSNSTISDMSFLSS
FT                   SIYKSSVVDAHLTGCKFDNSILIDNQGQEKLTGSENAITSIKDLQEKISQGEKFNVNYS
FT                   YFEFKDMNLENADFSNSTLSRAKFVNVNLNKANFEKTDLRYTVFDNSSLIGTNLSNSNL
FT                   EGSSFLNSDPKSTMLKNAKKNDRKK"
FT   gene            325763..326368
FT                   /gene="gmk"
FT                   /locus_tag="WRi_003060"
FT   CDS_pept        325763..326368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="WRi_003060"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003060"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95124"
FT                   /db_xref="GOA:C0R5T2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5T2"
FT                   /protein_id="ACN95124.1"
FT                   /translation="MTVKSEGVLLVLSSPSGAGKTTISAKLLERSTNLVRSVSMTTRKP
FT                   RPGEINGKDYFFVTEEKFHELCKAGQMLEYAKVFENFYGIPRNFIEQNLSNGISVLLSI
FT                   DWQGAFHLFKLMRKKVVSVFILPPSMEELRLRLQKRNSDDASEIERRLAEAQKEISKRD
FT                   KYDYVIINDDIDKSVEEISSILNKERLKKLKEKPSLED"
FT   gene            326655..329444
FT                   /locus_tag="WRi_003070"
FT   CDS_pept        326655..329444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003070"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003070"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95125"
FT                   /db_xref="GOA:C0R5T3"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5T3"
FT                   /protein_id="ACN95125.1"
FT                   /translation="MGIDITALTTNADKLGECIDKNKKQEQDRKDEQLYGIIERKVKKE
FT                   EHKREKPRGQDGTLKKCKRLFEKDASPEVLTKLEESLREQEKYYRYYVQCFLPVLDKAI
FT                   ERSKKISNETKKQVISKITDNSRYCFTHNRRDSETESGYGSDVGDDHEVNGTTDNDALL
FT                   LKAIKNGNNRKFRKYLKDCTDISSIKDEKGNNILHFIASLEKKQKCKFLGTLIKTVTKE
FT                   DLAQLINSENQTPFQVALINKVTKEKHESNTIRSNDNTLKFLTKLLEHGASSDNLELST
FT                   EELQNLKEEQKTYYRNFLEKLAEQGKKSKLKPEIRINTEAKIKEIIPHTINTPDSNDNY
FT                   LLHPVIKNSDKKLFKELLEKGADISLKDTDGNNALHLIVKPETKQKLKLLNILLETGQK
FT                   EQFIKAVNDKKEGQTPLHQILQRIQEKSENRSLKKFEKTKRYETLKLLLKNGADITVQD
FT                   KDGKNALHYIALLKGEQKVACLKLTLGKDEFSKAINAVNGKEQTPLHQVLQRIQEKSKE
FT                   PSLKNKIKNVVKKEFKDTGRYKTLELFLQNGADITVQDKDGKNALHYIALLKGEQKVTC
FT                   LELISNKDDAVNTTNKEGQTPLHQILQRIQEKSENRSLKKFEKTKRYETLELLLKNGAD
FT                   ITVQDKDEKNALHHIALLKGEQKVTCLELILNSVEKEKFSKAANATNEKERTPLQVALI
FT                   TKTTKDKHNLVNPKSRDNTIKFCVKLLQNGVDPKQLILPERLWSKEYYKTIKGIEKSMG
FT                   RALIPDDMRTELKCNFGRKLKARDIVKYINNVACKAVTTLVFAALACAAIFSASQGIIT
FT                   IATASSIIAVIGVCYLIYLNLENIYEGFGKIKGKFTEEKQLTLQDNAPKNDTQCNNSVK
FT                   DIENKSNDLEEQEVQKSPNQSEHTESPPDTKMSAISIYELVEKLCRDSVTSKPSSLAL"
FT   gene            complement(329416..331215)
FT                   /gene="sdhA"
FT                   /locus_tag="WRi_003080"
FT   CDS_pept        complement(329416..331215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="WRi_003080"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003080"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95126"
FT                   /db_xref="GOA:C0R5T4"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5T4"
FT                   /protein_id="ACN95126.1"
FT                   /translation="MDKSAYEIIEHEYDVVVVGAGGAGLRATLGMAATNFSVACISKIF
FT                   PTRSHTVAAQGGISAALGNIGEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIEL
FT                   ENFGVPFSRTEDGKIYQRSFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFN
FT                   AEFFVEYFVIDLIMDSETCCGVLAWSLCDGTLHRFRAHRVVLATGGYGRVYFSATSAHT
FT                   CTGDGNGMVVRAGLPLEDMEFVQFHPTGIYGSGCLMTEGCRGEGGYLVNSQGEKFMERY
FT                   APKAKDLASRDVVSRAITIEIREGRGVGPKKDYMYLTIAHLDPEVIKLRLPGISETART
FT                   FAGVDVTKDPIPVIPTVHYNMGGIPTNYYGEVITLKQGKEEVVDGLFAIGEAACVSVHG
FT                   ANRLGSNSLLDLVVFGRAAALRAKEKLKSGTPHKKLHSDCTDWIVDRFNKMRFASGGLK
FT                   VAKIRSEMQNTMQKYASVFRVAEVLEEGKKAIKKVAKMMPDISLEDHSMMWNSDLVEAL
FT                   ELANMIPQAVITMECAANREESRGAHAREDFPERDDKNWMKHTIAWLEEKKGQINVKID
FT                   YKKVAEKTLSGEIDFIAPEKRVY"
FT   gene            complement(331961..333391)
FT                   /locus_tag="WRi_003090"
FT   CDS_pept        complement(331961..333391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003090"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003090"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95127"
FT                   /db_xref="GOA:C0R5T5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5T5"
FT                   /protein_id="ACN95127.1"
FT                   /translation="MLDVVTRFAPSPTGFLHIGGARTALFNWLYAKHHGGRFLLRIEDT
FT                   DRKRSTKEAIDAIIEGLRWLGVSYDGEIVYQSKRIERHKEVANLLVEKGRAYHCYCPED
FT                   EVAEKKIKAREEGKIYKHKCTTKPPSCHPSSRHWDPEENMWSRAGMTSGVRSVIRFKVP
FT                   DSQEIVIDDKIYGQIKVNSNQLDDIVILRSDNTPTYIFAVVIDDHDAGITDIIRGSDHL
FT                   TNTFKHLLIYQALDFDIPRFAHVPLIHGEDGNKLSKRHGATSVCDYEKMGILPKAMRNY
FT                   LLRLGWSHGNDEIISDEQAIEWFNLESIGRSPARLDFKKLEHLNNHYISNMSNEDILTL
FT                   MLRENTLTDKKKGYLLQGLTELKKRANYLTELLDLAKFYIQDPPLDLSEEAEQIVKSNL
FT                   DIIKLLASFLSEIGDENWNKGFLSSQIKECAKLHDMKISDVYHSLRAPITGVMDAPGII
FT                   DIMVILGKDECIRRLQAI"
FT   gene            333542..334255
FT                   /locus_tag="WRi_003100"
FT   CDS_pept        333542..334255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003100"
FT                   /product="Ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003100"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95128"
FT                   /db_xref="GOA:C0R5T6"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5T6"
FT                   /protein_id="ACN95128.1"
FT                   /translation="MYELVDIAKLLSDNEANINWHYTGPFDKTKQRIRGDNLLHLAAKT
FT                   GKVDKFLSIFKKSVESNVHLLEYNKDHENPFHIAAEVGILPSVVKGIFKHLESEKTNPN
FT                   CDPKKLENVKNYVKEALCNRCALDQSKKTPLDWVSKTVKKEIKEIAGIKDSFICNQKFR
FT                   LCLYIVGAIACIAALCLSLYFLFLVSQSLALASMAGIISGGAAYLSGKVFSEIHDLHDV
FT                   STPVETFSNEDLARI"
FT   gene            334319..336394
FT                   /gene="pccA"
FT                   /locus_tag="WRi_003110"
FT   CDS_pept        334319..336394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccA"
FT                   /locus_tag="WRi_003110"
FT                   /product="propionyl-CoA carboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003110"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95129"
FT                   /db_xref="GOA:C0R5T7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR041265"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5T7"
FT                   /protein_id="ACN95129.1"
FT                   /translation="MTEKKYSKILIANRGEIACRIIRTAHKMGISCVCIYSDADVNSVH
FT                   VRQADESRYIGPSPSCLSYLNIEKICEVAVETGAEAVHPGYGFLAENPDFPRALQKHNI
FT                   DFIGPSAETIEVTANKITAKEAAKKAGVNVVPGYMGKISDAAHAAQVAEEIGFPVMLKA
FT                   ASGGGGKGMRIVNSKKEIELAFTSATNEAEKSFKDGSIFIEKYIELPRHIEIQIIADKY
FT                   GNIVCLGERECSIQRNNQKIIEETPSPFISEEVRQKMYVQCVSLAKQVGYFSAGTVEFV
FT                   VDKDQNFYFLEVNTRLQVEHPVTEFITGIDIVEEMIRTSCGEKLRFNQDDIKLTGSAIE
FT                   SRICAEDPSKKFFPSSGRIKYYDKPGENDYVRIDDGVAAGSEISMFYDSMIAKVITYGK
FT                   DRVEAISRMQKALSECYIEGVTNNIEFLESIFHHPNFIAAKLHTRFIPDHYPSGFHGDF
FT                   VTEEYIKIFIFTALYVHLENEERYHHKAVNETSQVSFQCVTLESSKKEGAPVSATRMAG
FT                   DRARDLFIVNINDNEYSVNAKYQDNILITVYNHNKYSVIGKWKSSYRLLYITINDDTNI
FT                   ALKIERQGSKYFIRHAGMKAECCILKPHVAELSKLMLNNETEGISADAVKSPISGLLVK
FT                   LHVNVGDQVEIGQPLFVVEAMKMENIICAEAAMVIKNIPVQEGKNVQIGDVVCFLK"
FT   gene            complement(336343..337371)
FT                   /locus_tag="WRi_003120"
FT   CDS_pept        complement(336343..337371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003120"
FT                   /product="cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003120"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95130"
FT                   /db_xref="GOA:C0R5T8"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5T8"
FT                   /protein_id="ACN95130.1"
FT                   /translation="MEAKPVAIWLFLCSVMVILMVGIGGFTRLSKAGLSITEWKPITGT
FT                   LPPLSEQDWLQEKLKYEATPEYKALNYGISMEEFRAIYLIEYIHRLVARLTGLVFVLPF
FT                   IYFILRRKISKKVVIKLFVALLFGALQAFAGWYMVKSGLVAKPHVSHYRLALHLLLALV
FT                   IFALLSYQFFDYQIRPQQTKLKVSGNTIYYARMILVLIVIQIIFGAFVAGLNAGLIYNT
FT                   FPLMDGQIVPEDLFFLQPIWLNIFENRATVQFIHRALALLILTLVVILTVKNASIKPVY
FT                   IMLLSVVIQIILGVITLLLHIPIAIAIAHQVFSFILFGSSLYFLCYLRKQTTSPICTFF
FT                   PS"
FT   gene            complement(337353..338951)
FT                   /locus_tag="WRi_003130"
FT   CDS_pept        complement(337353..338951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003130"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003130"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95131"
FT                   /db_xref="GOA:C0R5T9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5T9"
FT                   /protein_id="ACN95131.1"
FT                   /translation="MPILQADNVEKIKFDSSLCKEQEKLFYYKFNIIPWQKLNNTTFFM
FT                   VEDTSRDINRWVEAHYGIDYVLIKVDSEQILNLLNSHFGISEFASNYLYYKNPNFSAKS
FT                   IKLSSIFFASFFIVTSILTLTEKYTYFALMLIFIIGCSSYLFKFIATIFNLCETSNQKV
FT                   DYSKLNEEDFPIYTILLPAFKESAVIEQLIESIESLDYPKSKLDVKLQVESDDQETLAA
FT                   IEKYTLPQYFEVIKVPHSLPRTKAKSCNYAMSFARGKYAVIYDADDKPDPLQLKKALIE
FT                   FNKGDDKLACVQAKLNYYNCDCNFLTKSFSLEYMNWFQYLLPGFQKMNMPMPLGGSSNH
FT                   FSVKILRKMFFWDAYSVTEDADLGLRLAQMGYKTRMIDSETLEESPIAVFAWIKQRARW
FT                   IKGYMQTYIVHLKNIKSLYKHTGFKGILLLNLFVGSAAFLFFTTPFLLLSLILTKVLNE
FT                   LFLYYFVVVYVTNLILLVIAVKQQKMPFYFYIVSIFFPVYSLLHSVAAFLALWEFILYP
FT                   ERWNKTQHGLWKQNL"
FT   gene            complement(338957..339433)
FT                   /locus_tag="WRi_003140"
FT   CDS_pept        complement(338957..339433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003140"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95132"
FT                   /db_xref="GOA:C0R5U0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5U0"
FT                   /protein_id="ACN95132.1"
FT                   /translation="MSTSLIIGLAFLVGFVLSYKLLKKVIKNALNNKRNKSKFSSEETE
FT                   KFRKDMLEYYKKSSEKYKKLDAEVNEMMNEALDKANSIIKHNRQQLDQTLDDNAHSNLK
FT                   KVTDQVEKALGDLQANTASIAADAVKKIMHERKDDKRSSEVISSFSRDLNKKLH"
FT   gene            complement(339442..339921)
FT                   /locus_tag="WRi_003150"
FT   CDS_pept        complement(339442..339921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003150"
FT                   /product="ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003150"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95133"
FT                   /db_xref="GOA:C0R5U1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5U1"
FT                   /protein_id="ACN95133.1"
FT                   /translation="MPQLDVSTFFSQVFWFLIFFSSLFFVVSCLFLPKLDKIISTRSKE
FT                   VLGSFNSSVHLLRLTEEQIAKYNAALNQARIQAKKIIDDALAQVEEMRANVKNILEEED
FT                   KKMSKLIEEKVAEFKSEYTDQLKQMATSIALIYYTKLTNSEIEEEFIADLVSKEF"
FT   gene            complement(339925..340152)
FT                   /gene="atpE"
FT                   /locus_tag="WRi_003160"
FT   CDS_pept        complement(339925..340152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="WRi_003160"
FT                   /product="ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003160"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95134"
FT                   /db_xref="GOA:C0R5U2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5U2"
FT                   /protein_id="ACN95134.1"
FT                   /translation="MDLVALKFIAIGLAVFGMLGAGLGIANIFSAMLNGIARNPESEGK
FT                   MKSYVYIGAAMVEIMGLLAFVLAMLLIFAA"
FT   gene            complement(340212..340937)
FT                   /gene="atpB"
FT                   /locus_tag="WRi_003170"
FT   CDS_pept        complement(340212..340937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="WRi_003170"
FT                   /product="ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003170"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95135"
FT                   /db_xref="GOA:C0R5U3"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R5U3"
FT                   /protein_id="ACN95135.1"
FT                   /translation="MALNPLEQFKVYTVIELPRLFGYDVSFTNSSLFMMISVILVILFL
FT                   LFGIKKGAVIPGYLQAAVEYVYDFVISIIENNTGSKGLQHIPLIFTVFIFILSCNLVGV
FT                   LPYSFTVTSHVIVTFALSMVVFIYITIVGFKERGVEFLRILLPKGTPSWLAPIIIIIKL
FT                   FAYLVRPVSLSIRLAANMIAGHTIIKVIAGFIVNMNIFFTPAPFLFIIALIGFEVFVAI
FT                   LQAYIFTILTCVYLSDAVK"
FT   gene            341167..341430
FT                   /locus_tag="WRi_003180"
FT   CDS_pept        341167..341430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003180"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95136"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5U4"
FT                   /protein_id="ACN95136.1"
FT                   /translation="MNEIDFINTNHPLNLEQEFGNGYIESVDCFLDEDTRDYYIGLNNA
FT                   IIHFFFDGNIDEDAWDYESLKFFLEIDLKGDIEKILSLRKKI"
FT   gene            341543..343882
FT                   /gene="pheT"
FT                   /locus_tag="WRi_003190"
FT   CDS_pept        341543..343882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="WRi_003190"
FT                   /product="Phenylalanyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003190"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95137"
FT                   /db_xref="GOA:C0R5U5"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5U5"
FT                   /protein_id="ACN95137.1"
FT                   /translation="MKFTLSWLLEYLETNASLEEITDKLTHIGLEVEDVIDNTKLAGFI
FT                   VAEVLEVIQHPNADKLKLCKVDDGSKILQIVCGANNVREGMKTVLASLGSTLPESDFTI
FT                   KPTKIRGVLSEGMLCSASELALVQEESEGIIELSDDYKVGDKFFNCDPVIDINVTPNRG
FT                   DCLGIYGIARDLAATGIGTLKTLSIPQLTSFINSPIDVEVTDGESFISGIYIANVKNQE
FT                   SPKWLKDRLESIGMRSISAIVDITNYIMISFSRPMHAYDAKKIEGELTVRKANDGEKFA
FT                   GLNGKEYLLNKDISVIAGDKNIHGIAGIIGGKCSECTLETTDIFLESAWFDPISITKSS
FT                   RQLGISTDASYRFARSVDPGFTFDGLNLAAKMILDLCGGETSSVVSAGSLDSVDTKVSF
FT                   DYQDVNKFGSVSVSPDEVLDILTKLGFSIDKKTEGNWNVQVPSWRPDVTIPADLIEEVT
FT                   RIYGYDKIKEEPLPNNVEEVDSTYDNLRILMTNRGFHEVLTWSFMSESTAEKFGYSNKL
FT                   FIIDNPFNNNFNIMRPSIMPNLLQVTADNIAHGISDLAIFEIGPIYDGEARSKHVLSGI
FT                   RTGNNLPRNHYNTDRKVDVFDAKADCIAALEFFNVNCDNLTIEKAEKEHYHPGKSGTLS
FT                   FKNKVAGYFGELHPNILDLFDIKQKVVGFEVILENIENLPVSRKKFIDYKYQSVKRDFA
FT                   FIVNKDVEVGNIINVIKKSSELITEVLIFDVYHGNNIEPNKMSIALSVTFCSPIHTLTE
FT                   KEIQKESSAIVNLVCENTGGTLRTYR"
FT   gene            complement(343873..346362)
FT                   /locus_tag="WRi_003200"
FT   CDS_pept        complement(343873..346362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003200"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95138"
FT                   /db_xref="GOA:C0R5U6"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5U6"
FT                   /protein_id="ACN95138.1"
FT                   /translation="MNKAVADDYEEVVNNSGGLGKAESVVTLEEEEEFFDAMEAVSNVE
FT                   EGNNLGLATSEEEEEFFDAVEEQEPLANFNVPLSIFHYKDYNSDFFTSWYNISSEIFKE
FT                   INRTCPEKKILNLALSVLMLPYIAFTALGLVVCSRFQANSKTQDSVGEDKTKKSETGVP
FT                   KRLAYGVLAAIAIFVNMAVLVALVVPATIALATFYLLNRDLSHSLVTALKISMGRYSNK
FT                   HQNIEVSFHEKEVTGPNIAWDMEIEFPPQFKRLLRDLYENENNKWFDVTRNSEHSIVLK
FT                   LSTNINLKNGLKPLRNEIKDVLATSIQEFAKTMEELIKLEKKEITYDKLKELLNEFKSK
FT                   VVDSIGPNLTSHLIQSAYQVAFIQAIKFQRDRRGEDFSLEDEIKNSLVRQELESLRGIG
FT                   QTRCNDIYKKLKEIHENSSLTNDTLKRGLEDLFKFEYDDQEIERRLIKSVMKKVQGKLS
FT                   QSDIPDKEKQSLRKQLEDLEKKVKVPSDKEASAKINDFIEKMYLEIKKYKVQRLLREQK
FT                   KGVLRLCKKLRKYGESGLAEIIEAFRVQDEGHLEKSTLEQTLKDQNKRLQAEQNNREKG
FT                   HPGTRSIEVLLKRNEEILKALKQLELGKKELLINEETKNDYKEELTSREKIKFAVIEDD
FT                   LLKVFKLETFDEKEIKKLLERAELEYCLAEKRIKYPVIKTKDNIKHFSQNLLSPLIDNL
FT                   TKNIINNIPGNSEGCIQKVKNWSKVMFGAIKIGASNAYKETTERKALNVAHNTYKEGET
FT                   FLQCFQSNYEGIGAFLGNLFSDDGVTFKNDVWPKIEEHLHGMWDRFFKDIEFNIGNKLD
FT                   EVSVTQQRQETMIVTQR"
FT   gene            complement(346431..349742)
FT                   /locus_tag="WRi_003210"
FT   CDS_pept        complement(346431..349742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003210"
FT                   /product="Isoleucyl-tRNA synthetase, class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003210"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95139"
FT                   /db_xref="GOA:C0R5U7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5U7"
FT                   /protein_id="ACN95139.1"
FT                   /translation="MKSKHYPDTVSNPDFSSLEKEIIKFWQENKVFEQSVEERSKDNCF
FT                   VFYDGPPFANGLPHYGHLLTGFIKDAFARYQTMLQKRVERRFGWDCHGLPAEMGAEKEL
FT                   GISGRTEIEKFGIEKFNNHCRTSVMKFSSEWEKYVNRQARWVDFHNDYKTMDKSFMESV
FT                   MWAFKQLYDKGLVYESVRVVPYSWACETPLSNFETRLDNAYREKTSKAVTVAFELLENP
FT                   QQFKNIEQKCKLLAWTTTPWTLPSNLALAIGKDIKYCAVSVHSLAAREAGIQEGNKCLH
FT                   AEVTSNQPNEIYIFAESYLEKFISHSEQNNIPYENCNIKLKANDLAGLSYKPLFDYFKD
FT                   TKNAFRVFIADYVTGEDGTGVVHTAPGFGEEDFYLCQSHDIPVICPIDNSGKFTAEVSD
FT                   LAGVHVFDANDTVIKKLKGQGSWFKTEQYIHNYPHCWRTDTPLIYRTMPSWYVAVTKFK
FT                   SRMVELNKRVNWIPNHIRDGQFGKWLEGAHDWSISRNRFWGTPIPVWKSDDARYPRVDV
FT                   YGSIEELERDFNVKIDDLHRPFIDTLTRPNPDDPTGKSVMRRVPDVFDCWFESGSMPFA
FT                   QIHYPFENKEWFESADFITEYIAQTRGWFYTLFVLSTALFDREPFKNCICHGVVLDVKG
FT                   QKLSKRLNNYADPMEVFDRYGSDALRFLMLSGSIVCGGNLLLDKEGNSIRDVLKNVIKP
FT                   IWNSYHFFTMYANADGIKAEVCKDYQSTIDRYMISKCFEAVEGIQASMNNYNSQEACKI
FT                   LMNFFEVLNNWYIRRSRERFWKSDLDQDKTDAYNVLYTVFYYILRAAAPLLPLITENIW
FT                   QGLKYEETSVHLANFPQLEKFDSQLIAKMDLVREICNSALSIRNTFNIRIRQPLGSMII
FT                   YHQSSCSFLEGEPFSVIPEFSPVIQVADTGIQCAADSNEYQEMIKDEVNVKKLELVNRL
FT                   EDIASLELKLSFPLLGKRIPDKIKKLVQYVKEGKWKQVENEQVFLGNESENYIIEKGEY
FT                   ELLLKANSGYSAVFDNNKGVVILNTELNDELILEGLARDVVRLIQETRKQADFHISDRI
FT                   RVIIKTEDEKIKEAINTWFEYIKEQTLALSLDINTEIGTNFYSKEYQDLSVSIER"
FT   gene            349919..351385
FT                   /locus_tag="WRi_003220"
FT   CDS_pept        349919..351385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003220"
FT                   /product="putative amino acid/peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003220"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95140"
FT                   /db_xref="GOA:C0R5U8"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5U8"
FT                   /protein_id="ACN95140.1"
FT                   /translation="MDQKTDKFPQFLKMLCFVEMWERFSYYGMRALLVLFLTSHLGFTD
FT                   ERAFTIYSLFAATGYAIPILGGFLADKLMGFRNMVLLGGIVMIAGHACMSLVKFEPGLL
FT                   YLGLSLIAIGTGMFKGNVTNLLSSCYGKDDPERSRGFTLFYVGVNIGAILASISCGYVA
FT                   HLFGWHYGFGLAGIGMSIGLIFFLKFQNLLGDSGLSPYPELMNKRILGIKIFGIVLIGS
FT                   FLSSSIIAKMLIHSEFFTNMLIFIGITALGIFIYIISKLSAEQRRKLVALSILVVFFLC
FT                   FFALEMQLGSLVNLFTERNVINNVLGITIPASVSQAINPLSIIIFGFLFGTYMKFKQKY
FT                   ATSMFTLGLLTMAMCFFTLYIGCLNSNIEGKVEYLYLIIAISFMGLGELCIAPLVQEQA
FT                   TTLAPKNLRGVVMGIVMLSLAFSNLAGVAISKFMSVPSVNGKINYLESLEIYKEGFLKV
FT                   GIFNLMLVIVFLFFFNFIHKVVTNSSCTKN"
FT   gene            complement(351525..352844)
FT                   /gene="miaB"
FT                   /locus_tag="WRi_003230"
FT   CDS_pept        complement(351525..352844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="WRi_003230"
FT                   /product="tRNA-i(6)A37 modification enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003230"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95141"
FT                   /db_xref="GOA:C0R5U9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5U9"
FT                   /protein_id="ACN95141.1"
FT                   /translation="MKGLYIKTYGCQMNVYDSVLMENVIKPLGFNVVSDAGKADLVILN
FT                   TCHIREKAAEKLYSELGKIHSLRKEMTIVVAGCVAQAEGEEVFRRAPFVDIVVGPQSIA
FT                   TLPELIVKASRSKGHVINTDFPEVAKFDKLPDECYGNSQGSSAFLAIQEGCDKFCTFCV
FT                   VPYTRGAEYSRPVNEIFREALKLVANGANEINLLGQNVNAYHGECEGEVWDLGKLISHI
FT                   AKIEKLERIRYTTSHPRDMHESLYLAHAEEPKLMPFVHLPVQSGSNKILHAMNRKHTAE
FT                   EYLEIIDRFRKLKPEIEFSSDFIVGFPGETEKDFEETMKLVEKVRYAQAYSFKYSPRPG
FT                   TPGAERKDQVPEEVKTERLLRLQKLISKQQLEFNQSMVGKTIPVLFSDKKGKHQNQIIG
FT                   KSPYMQSVCIDDSEDKYRDKIVNVKVLEARQSSLLGCAFH"
FT   gene            complement(353456..353884)
FT                   /locus_tag="WRi_003240"
FT   CDS_pept        complement(353456..353884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003240"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95142"
FT                   /db_xref="GOA:C0R5V0"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:C0R5V0"
FT                   /protein_id="ACN95142.1"
FT                   /translation="MNYYHWLEAFHVISVIMWMAGMLYLPRLYVYHATVKPGSENDSLL
FT                   QTMEKRLLRYIINPAMLFSLGLGITLMVIREAYREGWFHVKAFAILLMLIIHMLLAKYR
FT                   KNFAMGSNKKSHIYFRVLNEAVTVLIIVIVIMVVVKPF"
FT   gene            353940..354920
FT                   /gene="pdhA"
FT                   /locus_tag="WRi_003250"
FT   CDS_pept        353940..354920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="WRi_003250"
FT                   /product="pyruvate dehydrogenase complex, E1 component,
FT                   pyruvate dehydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003250"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95143"
FT                   /db_xref="GOA:C0R2K1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2K1"
FT                   /protein_id="ACN95143.1"
FT                   /translation="MKAENFTKEQIIGFYRKMLLIRRFEEKAGQLYGMGLIGGFCHLSI
FT                   GQEAVAVGTQAASKLGDAFITSYRDHGLMLACDSDPNVVMAELTGKETGCSKGKGGSMH
FT                   VFDVEKKFFGGHGIVGAQVPIGTGIAFANKYKKKDNVVFTYFGDGAANQGQVYESFNMA
FT                   SLWELPVVYIIENNEYAMGTSVQRSTLVTELYKRGESFGIPGKQVDGMDFFSVYEATSE
FT                   AAEHTRSGKGPILLEMKTYRYRGHSMSDPATYRLKEEVEDMKQNHDPISTLKKYMTDNK
FT                   MASEEECKIIDKEIRDLVKKSEDFAKNSKEPSVDELYTDVYKFVS"
FT   gene            355329..356252
FT                   /locus_tag="WRi_003260"
FT   CDS_pept        355329..356252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003260"
FT                   /product="ribosomal large subunit pseudouridine synthase C,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003260"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95144"
FT                   /db_xref="GOA:C0R2K2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2K2"
FT                   /protein_id="ACN95144.1"
FT                   /translation="MLQSIKTILIEDDNVRLDRYIRRIFPDLKQSVIEKSLRKGLIKVD
FT                   DCKAKSSDRVNSGQTITLKHLNYIENANSDRKYNEKLVNLLRENILYEDEYILAINKPA
FT                   GVIVQGGVKVKISMSDLLDQIREGETFKIVHRLDRDTSGVIIFARNANVARYLMEEFKG
FT                   RRVKKTYLALTSGIPSKDSGTIDYPLVKKYVSGQEKVVVDENSPQNATTHFSIIAKSKH
FT                   NVAYLKLQPITGRTHQLRAHLAHINCPILGDGKYGGKKAFIDGIANKIHLHSHSLSLKL
FT                   PNNKEITITAPITKHIEKSIEALFFD"
FT   gene            complement(356260..357522)
FT                   /locus_tag="WRi_003270"
FT   CDS_pept        complement(356260..357522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003270"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003270"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95145"
FT                   /db_xref="GOA:C0R2K3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2K3"
FT                   /protein_id="ACN95145.1"
FT                   /translation="MNNIQKAILSGMICNMIVWYELTLFGVLTDTIINVFFPSEDHYLS
FT                   TLKFLGVFAIGFAFRPIGAVIFGYMGDKYGRRKTLLTSVILISISSTIMGIIPGYKEIG
FT                   LLSPVLLVFCRIVQGITAGGETSINTAFTIEHSKDKKNLGFLGSMKPFSGALGTLLCIT
FT                   MIFICKRVTGENYEIWGWKLLFYFCFFLGTIGFLTRYILKESLAYKTNKYANNLAHSPL
FT                   LELVRNYKRPLIISINLGIAQNAIVYAAIMFYNISIKELVILSISVKDLMRIVIQVVFA
FT                   ASAVLFAILSDKVGRKRVMIPVLIMLSLIGTCVLPLLSSVNHYVVIITYLLITIPVGAS
FT                   FGIYGSVICELFPTKVRCTGVSLANNISAGIFGGLSPYICMWLIEKTETKLAAGIYLTA
FT                   CALISLISVLQIKAKDRKVDW"
FT   gene            complement(357584..359386)
FT                   /gene="aspS"
FT                   /locus_tag="WRi_003280"
FT   CDS_pept        complement(357584..359386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="WRi_003280"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003280"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95146"
FT                   /db_xref="GOA:C0R2K4"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2K4"
FT                   /protein_id="ACN95146.1"
FT                   /translation="MNCYKTHTCNELRKNDVEKEVTLSGWLYRKRDHGNLIFVDLRDFY
FT                   GITQLVFNNDKDFFDEISNLKLESVITVTGIVEARTEDTVNSSISTGEIEVIVNNLRVE
FT                   SEVEFHFDEEIAKEERSILASITGEQEYPENMRFKYRFLDLRREKVRNNIILRSQIIAE
FT                   LRKLMIERGFLEIQTPILTASSPEGARDYLVPSRLNPGKFYALPQAPQIFKQLLMVSGF
FT                   DKYFQIAPCFRDEDARADRSPGEFYQLDLEMSFVTQEDIFQIIESTLYRVFAKFSRKSV
FT                   DKDFPRITYKEAMLKYGSDKPDLRNPLLISDVTEIFRDSGFNIFKSNIERGMVVRAIPA
FT                   PKTAEEPRSFFDKKIEHAQKEFGAKGLGYITFDKDGTAKGPIAKFLDENRLNHIREATN
FT                   IEPGDSVFFASDKENEAANIAGKVRTLLGSELSLIDDNIFKFCWIIDFPYFVYDDKSKK
FT                   IDFFHNPFSMPHGGLKDLEDKNPLDILAYQYDLVCNGIELSSGAIRNNKLDIMYKAFAI
FT                   AGYSRGEVDTRFGALVRAFRFGVPPHGGIAPGVDRIVMLLADEPNIREVICFPMNQQGE
FT                   DVLMGAPSKVEDKHLRELSLKVIE"
FT   gene            359583..360013
FT                   /pseudo
FT                   /locus_tag="WRi_p03290"
FT                   /note="hypothetical protein; disrupted by frameshift"
FT   gene            360017..360640
FT                   /gene="ccmA"
FT                   /locus_tag="WRi_003300"
FT   CDS_pept        360017..360640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="WRi_003300"
FT                   /product="heme exporter protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003300"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95147"
FT                   /db_xref="GOA:C0R2K5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2K5"
FT                   /protein_id="ACN95147.1"
FT                   /translation="MLECENLSCTRNNKVLFKNLSFKAELKSKILITGPNGSGKTSLIR
FT                   SLSGLLPPVSGNIRHCGKDIYDDPKSYISSMVYIGHKNACKDSLTVAQNVEFWAGIRNT
FT                   RELIVAAICCLQLQPVLNIRYGELSAGWKRRVALARLLISNANVWLIDEPFCNLDSATC
FT                   ELVLNLISIRSEQNGIVIITGHSSTEQLCDFTTIDIRNFNRLLV"
FT   gene            361667..362962
FT                   /locus_tag="WRi_003310"
FT   CDS_pept        361667..362962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003310"
FT                   /product="Na+/H+ antiporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003310"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95148"
FT                   /db_xref="GOA:C0R2K6"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2K6"
FT                   /protein_id="ACN95148.1"
FT                   /translation="MTAFVPLIIFLILYLGSGAYFSFIGTDNPLHQVSPVICLLPALFF
FT                   AVSRGTNKIQHNIDTVIKGMGDKNTLTMCLIFLFSGAFSAVTQSIGSADTVANLILNFL
FT                   PARLLLPGVFLASAFISTAIGTSMGVVALMVPIAVNLAKSGAFGLEIGTATVVGGAVFG
FT                   DNLSMISDTTIASVSSQEASAKDKLKMNSKVALIASIITLIYLAVASNSTKIISISNLD
FT                   YYSIIKIIPYISLIIMGLLEVATLVTITINIIIAGVLGITFFDYAIIQFPHDVYDGFKK
FT                   VNEIVIFALFIGGLSHIMYKQGQKALHKLIDESNITKTKAEFVIAGIASMFTTLVANNT
FT                   IAILLSGGIAKRLAQKHSIAPHRSAYLLDVFACATKGILPYGSQLLLAGSIASVSPISL
FT                   LTQVYYCFILAAVTIGEIIINSRKEKHCAAAT"
FT   gene            complement(363017..363538)
FT                   /pseudo
FT                   /locus_tag="WRi_p03320"
FT                   /note="Putative DNA recombinase, truncated; disrupted by
FT                   IS-insertion, contains in-frame stop codon"
FT   gene            363612..364651
FT                   /pseudo
FT                   /locus_tag="WRi_p03330"
FT                   /note="transposase, degenerate; ISWpi3"
FT   gene            complement(364743..364949)
FT                   /pseudo
FT                   /locus_tag="WRi_p03360"
FT                   /note="hypothetical protein, truncated; disrupted by
FT                   IS-insertion"
FT   gene            complement(365152..366015)
FT                   /locus_tag="WRi_003370"
FT   CDS_pept        complement(365152..366015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003370"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95149"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2K7"
FT                   /protein_id="ACN95149.1"
FT                   /translation="MTAENTVNNDVVVGLLKTEEAHELGLSQNIYEMFNNFVVKTVLID
FT                   YNKIISLKKIQTESLNLAKQDKTLAKKLTLDRIKVEVAQFIKEHKINRIFIPDNLHSAP
FT                   TPYRQLVTEAIVKIVDDNPAIHLLGICEGIMNAKGIEVVSVVSDEEKQRSHLKSAPNPQ
FT                   KEDVPLQQIKIVPNSRLAEVIAKFLIPNENGWFSTYFPDAHSGAVSNTPENRRKLESLG
FT                   YKVAAFSSEGVIEAIEDKHGNIYFQCYPEALVVKSYKNLYLSNYKERQVSTLVAIAIIN
FT                   DFLYRA"
FT   gene            complement(366234..366306)
FT                   /locus_tag="WRi_t03380"
FT   tRNA            complement(366234..366306)
FT                   /locus_tag="WRi_t03380"
FT                   /product="tRNA-Phe"
FT                   /note="codon recognized: UUC"
FT   gene            366386..366892
FT                   /gene="coaD"
FT                   /locus_tag="WRi_003390"
FT   CDS_pept        366386..366892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="WRi_003390"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003390"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95150"
FT                   /db_xref="GOA:C0R2K8"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2K8"
FT                   /protein_id="ACN95150.1"
FT                   /translation="MNINDKIGIYPGTFDPITFGHLDIIKRACKLVDKLIIGVAENVNK
FT                   HTAFDTKLRTSMAENEIKGLGIDADVISFNGLLVKFAKEQNASVIIRGLRAVSDFDYEF
FT                   QMSWVNYKLLPEIETIFLPASEDTQFISSGFVKEIARLGEDVSKFVSKGVQNELINLNR
FT                   IKNGE"
FT   gene            366961..367152
FT                   /locus_tag="WRi_003400"
FT   CDS_pept        366961..367152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003400"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95151"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2K9"
FT                   /protein_id="ACN95151.1"
FT                   /translation="MSKVRVNNRKVCCHGDENDEGSGHPLIYLDMGEEEEIACPYCEKT
FT                   FVHDCTVEAVGELTRDEL"
FT   gene            complement(367169..367795)
FT                   /gene="cdsA"
FT                   /locus_tag="WRi_003410"
FT   CDS_pept        complement(367169..367795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="WRi_003410"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003410"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95152"
FT                   /db_xref="GOA:C0R2L0"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2L0"
FT                   /protein_id="ACN95152.1"
FT                   /translation="MVDNNFIVRMLSSIVILFIFSFATYFSDLSFYLLIFSIAVLSSFE
FT                   WYNLTQGNKILYVFALLLIALPSASLIYLYNLPQGKYALVWFVLTIWGIDITAYLFGKN
FT                   FGGAKICPILSPGKTWTGLLGAILAGVVCTIFGSIFFGLFSIFYSPIIGLAIAILAQLG
FT                   DFTESLVKRAYGVKDSGNMIPGHGGVLDRMDSFIFTAPLIAIYIS"
FT   gene            complement(367785..368480)
FT                   /gene="uppS"
FT                   /locus_tag="WRi_003420"
FT   CDS_pept        complement(367785..368480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="WRi_003420"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003420"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95153"
FT                   /db_xref="GOA:C0R2L1"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2L1"
FT                   /protein_id="ACN95153.1"
FT                   /translation="MLNQESLPKHLAIIMDGNGRWANNQGRVKIDGYKKGSEVAYDIAK
FT                   YCTDLTIPYLTLYAFSMENWLRPKNETDCLFDLFYSVLTNEDKVNFICNCNIKLNFIGN
FT                   LSLLPSKILDQIKKAEEMTHKNDGLLLTVAVSYGAKQEITQAISNIIKENIAYVSEEEF
FT                   EKFLYTKDLPKLDLLIRTGGEKRLSNFLLWQAAYAELYFCDTLWPDFSCQDLSKALEDY
FT                   TKREKKYGR"
FT   gene            complement(368756..369313)
FT                   /gene="frr"
FT                   /locus_tag="WRi_003430"
FT   CDS_pept        complement(368756..369313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="WRi_003430"
FT                   /product="ribosome releasing factor"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003430"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95154"
FT                   /db_xref="GOA:C0R2L2"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2L2"
FT                   /protein_id="ACN95154.1"
FT                   /translation="MLNEIKAKTKERMLKTIQSFHDDIKGVRTGRASASLLDGIVVNIY
FT                   GGHQKLNQVAGVSVIDNKTLSIKIWDINVVGEVKNAILNANLNLNPVVEGNTIRIALPD
FT                   LTQETREKLVKLLHQFAENARIAIRNIRRDIMEETEKMKENKEISEDDFHGAKKEIQNI
FT                   TDNNIKKIDGELSIKEKDILNH"
FT   gene            complement(369321..370064)
FT                   /gene="pyrH"
FT                   /locus_tag="WRi_003440"
FT   CDS_pept        complement(369321..370064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="WRi_003440"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003440"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95155"
FT                   /db_xref="GOA:C0R2L3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2L3"
FT                   /protein_id="ACN95155.1"
FT                   /translation="MFPSINEKSEIKYSRVLFKISGEALMGSQSFGYDMGIISQLCKDI
FT                   ADINRLGVQVCIVVGGGNIFRGTSASLSGCERASSDYIGMLATIINALILQNFLEKNLI
FT                   ASRVLSAIPMATVCEPYIRRKAIRHLEKGRVVIFAAGTGNPFFTTDTAAALRAVEMNCD
FT                   VILKGTQVNGVYSADPKKNEDAVMYDRLSYTDLLTRDLKVMDASAISLARENSIPIIVF
FT                   SLKGEKIVNIIKGQGTYTIVSDCKH"
FT   gene            complement(370075..370935)
FT                   /gene="tsf"
FT                   /locus_tag="WRi_003450"
FT   CDS_pept        complement(370075..370935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="WRi_003450"
FT                   /product="elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003450"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95156"
FT                   /db_xref="GOA:C0R2L4"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2L4"
FT                   /protein_id="ACN95156.1"
FT                   /translation="MKMNPDDIRELRDRTGLGLSDCKKALEECDGDIKKAVDKLRTIGL
FT                   AKADKKSDRVASDGLVAMCLTENCGVLIELNCETDFVARNEKFIELVLNLASIAHQERC
FT                   TSVDELKNAKYESIGTVQEAIMNGTSVLGEKLELSKLCYLEAKDGVIAGYVHGDVCGLG
FT                   KIGALIALQSPGDKAKLQEIGKQIAMHIVAMKPEALSIDDLDQMKLKNERSIIEEQVRS
FT                   LNKPEEVAKKIVDGRMAKYYEEVVLLEQKFIKDDKMKVSDFIKSSEVSAVKLSNYKLLV
FT                   LGGAN"
FT   gene            complement(370916..371764)
FT                   /gene="rpsB"
FT                   /locus_tag="WRi_003460"
FT   CDS_pept        complement(370916..371764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="WRi_003460"
FT                   /product="ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003460"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95157"
FT                   /db_xref="GOA:C0R2L5"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2L5"
FT                   /protein_id="ACN95157.1"
FT                   /translation="MTNLPKVTVRDLAESGVHFGHKISRWNAKIAPYIYGVHQENRIHI
FT                   IDLRKTLPLLQVAMKVLYDVAFQGGRILFVGTKFQAFDIIASEAIRCGQYYVNHRWLGG
FT                   MLTNWGTVSSSIKTLMQYEKILNDEDSILTKKELGNIEKKKQKLDKALGGIREMGAIPD
FT                   ILFIIDTNKEHIAVKEAKKLGIPIVAILDTNSDPDGITYLIPGNDDSRKSIELYCKLAT
FT                   DSILAGIESSLAKSGVKIDDIRGDEFIQEKEDGIVQTKRRRSKVYKEEEREVVTNEDES
FT                   R"
FT   gene            371956..372029
FT                   /locus_tag="WRi_t03470"
FT   tRNA            371956..372029
FT                   /locus_tag="WRi_t03470"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            372170..372541
FT                   /locus_tag="WRi_003480"
FT   CDS_pept        372170..372541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003480"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003480"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95158"
FT                   /db_xref="GOA:C0R2L6"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2L6"
FT                   /protein_id="ACN95158.1"
FT                   /translation="MLISEVFAADATSNTSSIGASFASFTPLILIFVVFYFLIIRPQQK
FT                   KLKEHRRMIDQIKRGDTVITSGGIIGEVNKVDEANAQFIIEIAPKVEIKVLKSAISEVL
FT                   SKETQKVAAKPIKKVKSKE"
FT   gene            372622..374433
FT                   /gene="glmS"
FT                   /locus_tag="WRi_003490"
FT   CDS_pept        372622..374433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="WRi_003490"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003490"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95159"
FT                   /db_xref="GOA:C0R2L7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2L7"
FT                   /protein_id="ACN95159.1"
FT                   /translation="MCGIFGVVSSGDSVIPTLLTGLQKLEYRGYDSSGIAIINNEGKIE
FT                   VKKSEGKVERLCEVVDDSKMSHSTVGIAHTRWATHGVPGLKNAHPIRTNNVVVAHNGII
FT                   ENYNLLKKGLEERGMPFHTDTDTEIIPNMLTLYLDEGLSPIDSLFKCLNNLHGSFALVL
FT                   LFAEYPDALFVAKRNLPLAIGYNCNTVFAASDSNALSAFVERISHLEDDDIAVIKSSGV
FT                   SIYNNGTQVKRSIENSSPSDFLISKNGYPSFMLKEIFEQPCALNKTINQFYKQYKEVNK
FT                   KLFSELNHITIVGCGSSYFAGLIAKYWLESVAQVRVYLEISSEFRYSNVKLEEGSIGLF
FT                   ISQSGETADTIEALRYAKSQKQTIISITNTFSSSIEKISDIVLHTLAGPEIGVASTKTF
FT                   SAQLATLACFVVELGKIKGVLGGERIKQLSNAINSIPKHVEHVLNVMKIQHISGSILEH
FT                   NNVILIGRGSSYGVAMEGALKIKELSYINTIGIAAGEMKHGSIALIDSTVLVIAIIPYD
FT                   SLFFKTLSNIQEIIARKGKVIAFSDKQGAPFLREVCADVVQLPDADNFISPIIYSVAMQ
FT                   FLAYFTAAKKGLDVDCPRNLAKSVTVE"
FT   gene            374740..375183
FT                   /locus_tag="WRi_003500"
FT   CDS_pept        374740..375183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003500"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95160"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2L8"
FT                   /protein_id="ACN95160.1"
FT                   /translation="MALSKFLDPKLDLTFKKIFGTEKNKNILIHFLNDILGFTEINTIQ
FT                   EVEFLSTIMDPEIASDKQSIVDVLCRDSSGARYVIEMVRPESLRSYCLKGEEFIQKETE
FT                   RILKLIEPDVLPSESTHQCELGNQLVPSDADNEPPLDKEDAQS"
FT   gene            375621..377168
FT                   /locus_tag="WRi_003510"
FT   CDS_pept        375621..377168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003510"
FT                   /product="reverse transcriptase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003510"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95161"
FT                   /db_xref="GOA:C0R2L9"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2L9"
FT                   /protein_id="ACN95161.1"
FT                   /translation="MITSTTVSAPTNNSEAWNQLPWKKCQKVVMRLQRRIVKAVQQGRW
FT                   GKVKTLQHLLTRSFSGKALAVKRVTENQGKNTAGVDRQIWSTCNTKFQGIKLLKQRGYK
FT                   PSPLKRIYISKSNGKRRPLGIPTIKDRAMQALYLFALEPIAETISDRHSYGFRPKRSCA
FT                   DATVACHLLLASRNQLQWILEGDIKGCFDNINHEWLMKHIPMEKKILHSWLKAGFLESK
FT                   TLYSTTAGTPQGSIISPILANLALNGLEKSLESQFGKLGSKRRSKIRSGVNVIRYADDF
FT                   IISGITREVLENEVKPLVSSFLQERGLILSEEKTKITSITTGFDFLGCNVRRYNKKLII
FT                   KPSKESIKKLLNKARTLIKANIANTQAVLIKLLNSLLRGWGNYYSHVCAKRAFNKIDHE
FT                   IMCALWKWAKKRHPRKGLRWIKNRYFKVMKQRQWVFAAPICKNKPKEIRYLRLLRLIDI
FT                   PIRRHVKIRADANPLDLKWKKYFDERVKQTKMLASSFSREGSLLLVSPLRMMFSEES"
FT   gene            377165..377974
FT                   /locus_tag="WRi_003520"
FT   CDS_pept        377165..377974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003520"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95162"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M0"
FT                   /protein_id="ACN95162.1"
FT                   /translation="MKDKPVREKKDLDKGLKRSVGKPACCVSKGGSSSNTTSLPNQLTR
FT                   DKGFEKRAQLYAAKAYSRQADKSGKYIDLKKVFFIAISNCNLFPDKLDYISSHTIRDEK
FT                   TNEHDLKDFQFVFIELPKFPKNKEEQLESIVDRWLFFFKYADETTEEDLRKIAEKAPII
FT                   KLAYDELDRFSWNEKDLVAYEERIMDLRKEEAILEYRLDLATEKGIQIGEERGIKIGKE
FT                   EGKIEGKIEGKIEVAKAMLANNVDVNTIVKFTGLSISEIEELSVNGY"
FT   gene            378152..378984
FT                   /locus_tag="WRi_003530"
FT   CDS_pept        join(378152..378526,378526..378984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="WRi_003530"
FT                   /product="transposase"
FT                   /note="ISWpi1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003530"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95163"
FT                   /db_xref="GOA:C0R2M1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M1"
FT                   /protein_id="ACN95163.1"
FT                   /translation="MRKKYPTDLSEREWARIEKHFRVSYKKGGRPPKYNKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKKVKGRKRHIITDTQGFILGCYVGAANENDRDGIKIALN
FT                   NMRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFWVHKDTPPELLPTR
FT                   EQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMSRVMLKREYA"
FT   gene            complement(379159..380046)
FT                   /gene="murB"
FT                   /locus_tag="WRi_003550"
FT   CDS_pept        complement(379159..380046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="WRi_003550"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003550"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95164"
FT                   /db_xref="GOA:C0R2M2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2M2"
FT                   /protein_id="ACN95164.1"
FT                   /translation="MLISLPKVRGIYRYDILMSKATWLNVGGRADILFKPRDIEDLTCL
FT                   IKNTELPVSVIGATSNIIVRDSGIRGITVKLGKEFAYIKSKGNNSIVAGGAVLLSNLAH
FT                   FAGNQQISGLEFLVGIPGTVGGGIEMNAGAYGSDIASVVQSIKAVNLEDGNLYEFSSEE
FT                   MGYFYRGHSLKGNWIFVEAEFKGVNSEYELILQRLKEVIERKNKSQPIRGKTAGCIFKN
FT                   PKNYRAWELIDKSGCLGLNIGGARISKKHCNFLLNYDNATASDLENLGNKVKDAVKDKF
FT                   NVELEWEIRVLGSY"
FT   gene            complement(380037..380915)
FT                   /gene="hemC"
FT                   /locus_tag="WRi_003560"
FT   CDS_pept        complement(380037..380915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="WRi_003560"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003560"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95165"
FT                   /db_xref="GOA:C0R2M3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2M3"
FT                   /protein_id="ACN95165.1"
FT                   /translation="MLVKIGTRGSKLAVVQALEAKQKLLDSFPNLSIEIVKIKTSGDKY
FT                   ANANLAEIGGKGLFIKEIEAELLENNIDMAVHSLKDVPAFFSWGLTIPCVLERLSPCDA
FT                   FISHKHNSLESLPQQATIATSAIRRKVQLLNFRPDLNIVPLRGNVTTRLQNQSFDGIIL
FT                   AEAGLIRLEKHHLITEVLPPKVMLSAVGQGAICIQCRRNDVKIIDLLEKINNNMSFIGV
FT                   KSERSFMKTVNGSCFTPLAALAEYVSENMLYLRCMLADGKNIYFTERTSFIEDAEKMGM
FT                   DAGLELKSKCL"
FT   gene            381869..383041
FT                   /gene="sucB"
FT                   /locus_tag="WRi_003570"
FT   CDS_pept        381869..383041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="WRi_003570"
FT                   /product="2-oxoglutarate dehydrogenase, E2 component,
FT                   dihydrolipoamide succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003570"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95166"
FT                   /db_xref="GOA:C0R2M4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M4"
FT                   /protein_id="ACN95166.1"
FT                   /translation="MSKIIEIRAPKTLGGESVTEGIVKIKKGIGEAVKVDDLIFEIETD
FT                   KTALELTAEASGQITEFLVKEDDVISPDQLLAKLSVGEVKEEAKKEDKSESAAKKDAPS
FT                   ARKIMEENAISAESVKGTGMGGRITKADVIGHMNKAEQPAIKQYELPKSVVNGEQREER
FT                   VKMSKIRQVIAARLKASQNTAAILTTFNEIDMKNVMDLRTKYKDAFEKKYGIKLGFMSF
FT                   FIKAAVQALKEIPEINAEISGDEIIYKHYYDIGVAVGTDKGLVVPVIRSADQMSFAEIE
FT                   LTLVALGKKAREGKLQVSEMEGATFTISNGGVYGSLLSTPIINPPQSGILGMHSIQNRP
FT                   VAVGNAVEIRPMMYIALSYDHRIVDGKGAVTFLVKIKNYIEDPNRLVLEV"
FT   gene            complement(join(383080..386094,388103..388717))
FT                   /pseudo
FT                   /locus_tag="WRi_p03580"
FT                   /note="TPR repeat domain protein; disrupted by
FT                   IS-insertion"
FT   gene            386178..387166
FT                   /pseudo
FT                   /locus_tag="WRi_p03590"
FT                   /note="transposase, degenerate; ISWpi10"
FT   gene            387244..388076
FT                   /locus_tag="WRi_003610"
FT   CDS_pept        join(387244..387618,387618..388076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="WRi_003610"
FT                   /product="transposase"
FT                   /note="ISWpi1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003610"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95167"
FT                   /db_xref="GOA:C0R2M5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M5"
FT                   /protein_id="ACN95167.1"
FT                   /translation="MRKKYPTDLSEREWARIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKKVKGRKRHIITDTQGFILGCYVGAANENDRDGIKITLN
FT                   NMRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFWVHKDTPPELLPTR
FT                   EQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMSRVMLKREYA"
FT   gene            388959..391619
FT                   /gene="secA"
FT                   /locus_tag="WRi_003630"
FT   CDS_pept        388959..391619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="WRi_003630"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003630"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95168"
FT                   /db_xref="GOA:C0R2M6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M6"
FT                   /protein_id="ACN95168.1"
FT                   /translation="MLDSPLILTAILIFFIFTLSFFFIRKIFGSTNKKIIKSFRKIVQQ
FT                   INALETEMQSLSDEELAGKTEEFKRELKNGKTLNDLLVPAFAVVREASRRFLNMRHFDV
FT                   QLIGGMVLHNGMISEMKTGEGKTLVATLAAYLNSLEGKGVHVVTVNDYLAKRDTEWMSK
FT                   LYNSLGVSVAFITNNLTDEERKEAYSADIVYSTNNELAFDYLRDNMKFSQEDMVQRGFH
FT                   YGIVDEVDSILIDEARTPLIISGQIEENNQIYKHINKIVTKLVDYDYEVDEKGRTVFLT
FT                   EDGISRVEELLRSYNLIPENSSLYDTDSMIMTHYIDQALRAHKLFTADKDYIVKDGKVV
FT                   IIDEFTGRMMEGRRYSDGLHQALEAKENLEIQHENQTLASVTFQNYFRMYNKLSGMTGT
FT                   AATEAEEFSDIYRLNVVKIPTNVSVKRVDIDDEIYGTGKEKFNAVLKFIEECHKRLQPV
FT                   LVGTVSIENSEKLSALLQSHSLKHSVLNARYHEQEAYIIAQAGVPGSVTIATNMAGRGT
FT                   DIQLGGNAEMIAKVELKKIKNADEREKKYQEIVERVKKDKEIAIKAGGLCVVGTERHES
FT                   RRIDDQLRGRSGRQGDPGLSKFFLSLEDDLMRIFGSDRMRSFLQKVGLKNNEAIHHPWI
FT                   NKALEKAQKKVEARNYDVRKSLLKFDDVINNQRKVIFKQRNNILGNEINDIFEVYSEVN
FT                   ESVVEGIIQSGYYEDYIENIVKEFHTRYGITLDKEDLAKFLNKQEALNYINDKIQEFFT
FT                   EKEKYFNSQHTTDLWNTIVKQMMIMTLDHLWREHLSVLESLRQSISLRAMGQKDPLNEF
FT                   KREAFLMFESMLEKWKELTIHRLAHFKLADNQEIGNRLHSARNSRLPKVSRNDKCPCNS
FT                   GKKYKHCHGAVTVVS"
FT   gene            complement(join(391629..391664,393155..394228))
FT                   /pseudo
FT                   /locus_tag="WRi_p03640"
FT                   /note="ankyrin repeat domain protein; disrupted by
FT                   IS-insertion"
FT   gene            complement(391688..393070)
FT                   /locus_tag="WRi_003650"
FT   CDS_pept        complement(391688..393070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003650"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003650"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95169"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95169.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            complement(394565..395206)
FT                   /locus_tag="WRi_003660"
FT   CDS_pept        complement(394565..395206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003660"
FT                   /product="transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003660"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95170"
FT                   /db_xref="GOA:C0R2M8"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M8"
FT                   /protein_id="ACN95170.1"
FT                   /translation="MEIFLDSVDLNEIKGLKEFIDGITTNPSLIAKSGRKDKYEDLVRE
FT                   ICSIIKGPVSVEVVADSHEEMITEGLNLAKIADNVVIKLPLTHEGLISCKKLWTEHKIP
FT                   VNITLCFSPGQALLAAKVGACFISPFVGRLDDISYDGLSLIEDICTIYSNYGFDTKVLV
FT                   ASVRSPAHVIEAARLGADSITVPAKVLRQLINHPLTDQGLAIFEKDWGVK"
FT   gene            complement(395332..396348)
FT                   /locus_tag="WRi_003670"
FT   CDS_pept        complement(395332..396348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003670"
FT                   /product="transposase"
FT                   /note="ISWpi2"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003670"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95171"
FT                   /db_xref="GOA:C0R2M9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M9"
FT                   /protein_id="ACN95171.1"
FT                   /translation="MSQACKVMGYSRDTFYRFKELYENGGEEALHEISKKKPLLANRVS
FT                   DDIERAVIGIATEFPAYGQERAANELRKRGIIISQGGVRSVWLRNDLETLKKRLKALET
FT                   KVAQDGIILTEEQLAALEKVKEQREAHGEIETQHPGYLGSQDTYYVGNIKGIGRIYQQT
FT                   FVDTYSRVAMVKLYTDRTAITAADLLNDRVIPFFDEQKIPLLRILTDRGTEYCGKPENH
FT                   AYQLYLGIENIDHSRTKANSPQTNGICERFHRTMQDECYNIIFRKKIYSSLEDLQIDVD
FT                   HWLRSYNETRPHSGKYCYGKTPMQTFLDSKYIAFQKNISSITQEPDISFDYLNSSVS"
FT   gene            complement(396577..397122)
FT                   /locus_tag="WRi_003680"
FT   CDS_pept        complement(396577..397122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003680"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95172"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2N0"
FT                   /protein_id="ACN95172.1"
FT                   /translation="MNIFVLDENPVIAAQMLCDKHIVKMPLETAQLLSNVFSIALKAPN
FT                   PFVSTTDQNIAVPYKLTHSNHPCSLWARQSKGNFCWLIEYGKELCKEYTWRYKRKHKSE
FT                   EVIDWCDSNKDLLIFRSTDMQAFIQALPDRYKCTNPVKAYREYYLQEKMRFAKWENGRE
FT                   APGWIVGNPATHFFHIFS"
FT   gene            complement(397143..397976)
FT                   /locus_tag="WRi_003690"
FT   CDS_pept        complement(397143..397976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003690"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95173"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2N1"
FT                   /protein_id="ACN95173.1"
FT                   /translation="MKDKPVREKKDLDKGLKRSVGKPACCVSKGGSSSNTTSLPNQVAK
FT                   TKGFEKRAQYYAAKAYSRQADKGDQYHNLKEIIFIAIADCVLFPNKSEYKSKHTIRDED
FT                   TNEHDLKDFYFIFIELPKFPKNKEDQLENIVEKWVYFFRYADETSEEELEKIIGSDVII
FT                   KKAYEELNRFNWSEKEFIAYEQEIKRILDEQAVLAQKLDDATEKGREEGKEEGKEEGIQ
FT                   IGHEKGRAEGIQIGAEKGEKQAKITVAKNLLKAGVSIDIIAQTTGLTVDEVKDLS"
FT   gene            complement(397973..399520)
FT                   /locus_tag="WRi_003700"
FT   CDS_pept        complement(397973..399520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003700"
FT                   /product="reverse transcriptase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003700"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95174"
FT                   /db_xref="GOA:C0R2L9"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2L9"
FT                   /protein_id="ACN95174.1"
FT                   /translation="MITSTTVSAPTNNSEAWNQLPWKKCQKVVMRLQRRIVKAVQQGRW
FT                   GKVKTLQHLLTRSFSGKALAVKRVTENQGKNTAGVDRQIWSTCNTKFQGIKLLKQRGYK
FT                   PSPLKRIYISKSNGKRRPLGIPTIKDRAMQALYLFALEPIAETISDRHSYGFRPKRSCA
FT                   DATVACHLLLASRNQLQWILEGDIKGCFDNINHEWLMKHIPMEKKILHSWLKAGFLESK
FT                   TLYSTTAGTPQGSIISPILANLALNGLEKSLESQFGKLGSKRRSKIRSGVNVIRYADDF
FT                   IISGITREVLENEVKPLVSSFLQERGLILSEEKTKITSITTGFDFLGCNVRRYNKKLII
FT                   KPSKESIKKLLNKARTLIKANIANTQAVLIKLLNSLLRGWGNYYSHVCAKRAFNKIDHE
FT                   IMCALWKWAKKRHPRKGLRWIKNRYFKVMKQRQWVFAAPICKNKPKEIRYLRLLRLIDI
FT                   PIRRHVKIRADANPLDLKWKKYFDERVKQTKMLASSFSREGSLLLVSPLRMMFSEES"
FT   gene            399572..399805
FT                   /locus_tag="WRi_003710"
FT   CDS_pept        399572..399805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003710"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95175"
FT                   /db_xref="GOA:C0R2N3"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2N3"
FT                   /protein_id="ACN95175.1"
FT                   /translation="MEVCSFSRELMLQILSISLQNGIRFLHYPLPAHPSAFLAGCLPYR
FT                   RKYRLILFLLSYNSGLGGFSIPVELLFAYIQK"
FT   gene            complement(399958..400401)
FT                   /locus_tag="WRi_003720"
FT   CDS_pept        complement(399958..400401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003720"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95176"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2N4"
FT                   /protein_id="ACN95176.1"
FT                   /translation="MALSKFLDVRNDVAFKKIFGTEKNKDILIHFLNDIIGFTGKNQIK
FT                   DIEFLSTIQDPDIAAKKQSIVDVLCRDENGVQVIVEMVRPESLRSYCLKGEEFIQKETE
FT                   RILKLIEPDVLPSESTHQCELGNQLVPSDADNEPPLDKEDAQS"
FT   gene            400865..401338
FT                   /locus_tag="WRi_003730"
FT   CDS_pept        400865..401338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003730"
FT                   /product="DNA repair protein RadC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003730"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95177"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2N5"
FT                   /protein_id="ACN95177.1"
FT                   /translation="MNNQNKSKEENKRKKEIEFRILASKGNALLDHEIIETFLSAVHDR
FT                   AQARAIAKNLVTTCTGIGRILGREIDELKSVEGVTDSTVSMIFCVKETLTRVFKEGLKK
FT                   GPILDNLDKLIEYLRVSIGYSDKENITIMYLNQGCHLIGEEVFAGRRLSIQGK"
FT   gene            401518..402534
FT                   /locus_tag="WRi_003740"
FT   CDS_pept        401518..402534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003740"
FT                   /product="transposase"
FT                   /note="ISWpi2"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003740"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95178"
FT                   /db_xref="GOA:C0R2M9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M9"
FT                   /protein_id="ACN95178.1"
FT                   /translation="MSQACKVMGYSRDTFYRFKELYENGGEEALHEISKKKPLLANRVS
FT                   DDIERAVIGIATEFPAYGQERAANELRKRGIIISQGGVRSVWLRNDLETLKKRLKALET
FT                   KVAQDGIILTEEQLAALEKVKEQREAHGEIETQHPGYLGSQDTYYVGNIKGIGRIYQQT
FT                   FVDTYSRVAMVKLYTDRTAITAADLLNDRVIPFFDEQKIPLLRILTDRGTEYCGKPENH
FT                   AYQLYLGIENIDHSRTKANSPQTNGICERFHRTMQDECYNIIFRKKIYSSLEDLQIDVD
FT                   HWLRSYNETRPHSGKYCYGKTPMQTFLDSKYIAFQKNISSITQEPDISFDYLNSSVS"
FT   gene            complement(402571..402696)
FT                   /pseudo
FT                   /locus_tag="WRi_p03745"
FT                   /note="transposase, truncated; disrupted by IS-insertion"
FT   gene            402836..402934
FT                   /pseudo
FT                   /locus_tag="WRi_p03746"
FT                   /note="transposase, truncated; disrupted by IS-insertion"
FT   gene            complement(403045..403923)
FT                   /gene="folD"
FT                   /locus_tag="WRi_003750"
FT   CDS_pept        complement(403045..403923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="WRi_003750"
FT                   /product="methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003750"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95179"
FT                   /db_xref="GOA:C0R2N7"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2N7"
FT                   /protein_id="ACN95179.1"
FT                   /translation="MTIIIDGKKIANDLCERLSQKIDILKREYNIFPCLKVILVGSNPA
FT                   SQVYVRNKQKKAESIGISSETIVLPDNISEDELIEKINELNEDPSVHGILVQLPLPNHI
FT                   SASRVINTVSVEKDVDGFHDENVGKLVKGEKNCLIPCTPKGSLHLIKSIEENLSGKNAV
FT                   VIGRSNIVGKPMFYLLLQENCTVTILHSQSKDLAEYCSKADIVVAAVGKPNFVQADWIK
FT                   KGAIVIDVGINSVNVGKLVGDVDFEGIKGKAKAMTPVPGGVGPMTIAFLMMNTVIAACL
FT                   QKGVDASNFIS"
FT   gene            complement(403907..404482)
FT                   /gene="ubiX"
FT                   /locus_tag="WRi_003760"
FT   CDS_pept        complement(403907..404482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="WRi_003760"
FT                   /product="phenylacrylic acid decarboxylase,
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003760"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95180"
FT                   /db_xref="GOA:C0R2N8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2N8"
FT                   /protein_id="ACN95180.1"
FT                   /translation="MNSRIVIGISGASGSIYGVRILEALKDVDYETHLVISRAGKITLA
FT                   HEIKEKLEDITSLADFYYSEEKIGEKIASGSFKTSGMIVAPCSMKTMSEIASGVTSNLL
FT                   TRAADVTLKERRKLVLMVRESPLHLGHLQNMLKLTEMGAIIAPPVPAFYIKPKSLDDII
FT                   NHSVGKVLDLFDIKLPDFKEWQGSDNYY"
FT   gene            complement(404475..404741)
FT                   /locus_tag="WRi_003770"
FT   CDS_pept        complement(404475..404741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003770"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95181"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2N9"
FT                   /protein_id="ACN95181.1"
FT                   /translation="MEDTVKITAEELKGYIERIEKLEQEKRDVQDHIRDVYAKATDEGW
FT                   DIKVMKQIIRLRKMDDDDREEQEILLDTYKRALGMSYEEELSE"
FT   gene            complement(404755..406038)
FT                   /locus_tag="WRi_003780"
FT   CDS_pept        complement(404755..406038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003780"
FT                   /product="Putative Mg2+ and Co2+ transporter CorB"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003780"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95182"
FT                   /db_xref="GOA:C0R2P0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2P0"
FT                   /protein_id="ACN95182.1"
FT                   /translation="MDWLLVLVSSAIFVLLVLSFLFSGAEIGLTSISRSRVNKLKLDGN
FT                   KKARVIDRLLNRKELTIGTVLLGNTIINITCSALFTAIFINLFGNEGILLSTIIMTFCI
FT                   LLFCEVLPKTYAIQNPEKFASFSAYFVLFFVKIFSPLTLGIQFIVNLILKLCGLHKDKE
FT                   VISAADAMRNMITLHRSEGTMLQQDLDMLSSILDLAETEISQIMTHRRNLFSLDIDRNK
FT                   EELIREILTSSHSRVPLWQKEPDNIVGVIHVKALINALREKNNKAEEVDITQVMSRPWF
FT                   IPESTPLSVQLHNFRKNRKHLAFVIDEYGALQGIVTLEDILEEIVGEISDEHDLITENF
FT                   IKKISDNMYHIEGKSTIRDINRQLYWNLPDEEATTLAGMIVNEIERIPDEGEEFSMYGF
FT                   RFKILKKDKNIITVVEVQVKTGNISGSN"
FT   gene            complement(406127..407305)
FT                   /gene="argD"
FT                   /locus_tag="WRi_003790"
FT   CDS_pept        complement(406127..407305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="WRi_003790"
FT                   /product="acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003790"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95183"
FT                   /db_xref="GOA:C0R2P1"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2P1"
FT                   /protein_id="ACN95183.1"
FT                   /translation="MDHVVNAYNRLDTPIVRGEGAYLFDKDGKKYLDFAAGISTTSLGH
FT                   CHPYITDKLKEQSSSLWHCSNIFTIPEQERLAERLTTLTFADKVFFCSSGLEATEAAIK
FT                   FIRRYFYSKGQAKRNRIITIEGGFHGRSIAAISAGGNEKSREGFAPLLSGFDKVPRNDI
FT                   KALEEKINNEIAAVFLEPIQSEGGVYPLDVEYLQKVREITKAQGIILCFDEVQCGYGRI
FT                   GSLFHYQNVGIEPDMLTCAKAMGNGFPVAACLVKDYIAEAITPGTHGSTYGGNPLAMTV
FT                   GNAVLDIMLKEGFFDHVKRISKYLKEKLLLLAKEFPEMILEVRGEGLLMGIELATLVAD
FT                   KIISRSLDKGLIITRVLNNKVVRVTPPLIIEDEHVNAACNMLYDLFFKIKGI"
FT   gene            407581..408753
FT                   /gene="nuoD"
FT                   /locus_tag="WRi_003800"
FT   CDS_pept        407581..408753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="WRi_003800"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003800"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95184"
FT                   /db_xref="GOA:C0R2P2"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2P2"
FT                   /protein_id="ACN95184.1"
FT                   /translation="MPDLKTMMLNFGPQHPAAHGVLRLVLEMDGEVIERADPHIGLLHR
FT                   GTEKLIEHKTYLQALPYFDRLDYVSPMSQEHAYSLCVEKLLQCEVPIRAKYLRVLFCEL
FT                   TRILNHLLNVSSQALDVGAMTPLLWLFEEREKILEFYERASGARFHAAYIRPGGIAADV
FT                   PEDLIEDIAKFIEQFPKYIDDVDELLTENRIWKQRTVGISEISIKQALDWGFSGPMLRA
FT                   AGLAWDLRKSQPYEIYDQLDFDIPIGQNGDCYDRYLVRMAEIRQSISLVKQCIEKMPEG
FT                   QIKTEDRKISPPSRAEMKKSMEALIHHFKLYSEGYHVPEGEAYAVVEAPKGEFGVYIVS
FT                   DGTNRPYRCRIRAPGFAHLQALDFMAKGHMLADVAAIIGSLDIVFGEIDR"
FT   gene            409123..410173
FT                   /pseudo
FT                   /locus_tag="WRi_p03810"
FT                   /note="transposase, degenerate; ISWpi3"
FT   gene            complement(410332..412038)
FT                   /gene="argS"
FT                   /locus_tag="WRi_003840"
FT   CDS_pept        complement(410332..412038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="WRi_003840"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003840"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95185"
FT                   /db_xref="GOA:C0R2P3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2P3"
FT                   /protein_id="ACN95185.1"
FT                   /translation="MNIFKRASSLILSKLNELKQRGIINTDTTNFIVEPPSNRAHGDIY
FT                   TNVAMVLAKHEKKNPIEIAEVLAKEFELFDEVAKVEIAGPGFINIHLKIKVWHGILKQI
FT                   NELKTEFGTLDIGNNQAINVEFVSANPTGPLHIGHARGAVFGDVLANLLKKVGYKVTKE
FT                   YYINDAGAQIDTLIKSVYLRYKEALGEKISIEKGLYPGEYLKPIGEGLAKKYGKEFLKK
FT                   QDNQIIREYTLSFILELIKEDMNLLGVNHDVFTSEYELQKSGKIEESIKILSDKGLVYE
FT                   GYLEKPKGKESENWTSRKEMLFRSTKFGDDVDRALKKDGGSWTYFASDIAYHFDKISRG
FT                   FNNMIVELGSDHGGYVKRLKAVVSALSDDQAKIEVKLHNIVNFFENGKPVKMSKRSGNF
FT                   LTARDVVEEVGRDITRFIMLTRKNDMVLDFDFAKVKEQSKDNPIFYVQYAHARAHSLMR
FT                   NAPKELPTADPSLLRTGGELFLIKTLAKWPDVVEIAARLCEPHRITFYLLEVAEAFHVL
FT                   WGYGKSDLNMRFILEDNLNLTAARMFLVQALAHVIASGLSIFNIEPLKEMS"
FT   gene            complement(412172..412867)
FT                   /locus_tag="WRi_003850"
FT   CDS_pept        complement(412172..412867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003850"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95186"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2P4"
FT                   /protein_id="ACN95186.1"
FT                   /translation="MPTNTFSCPNQKNANHVRILPLDTCYVSDMLKINLFTKLDDCKVN
FT                   KSKLIYDKCGKDLKCKIDDKTMNELKKCFKFEIDDKTMNELKENIKNELEKGLKFEIDD
FT                   KTMNELKENIKNELEKSLKFEIGDKTKNELKENIKNELEKGLKCEIDDKTKNELKENIK
FT                   NELEKSLKFEIDDKTMNELKENIKNELKKEKEPDDVKEPDGVKEPDAGNDGYSEGMAFS
FT                   YHDYDNVLI"
FT   gene            complement(412954..413547)
FT                   /locus_tag="WRi_003860"
FT   CDS_pept        complement(412954..413547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003860"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95187"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2P5"
FT                   /protein_id="ACN95187.1"
FT                   /translation="MTYNFSSYPRMDSCTPVRTACITDPRYHHNFDPRCHNRFDSRHDG
FT                   LELNIQLPEFDLNIPPCPACPDTVCPPAPACPPAPACPACPPCPQVKPEPESKTIVDFS
FT                   KLAITVNPITDDILDIETKEPTGYKFKECAKTIQNAKNNLQVIDGKLVGSCENNSECDK
FT                   CVEVINSSILDAKSAEAFFSTHNMSVLEGTVHII"
FT   gene            complement(414445..416424)
FT                   /locus_tag="WRi_003880"
FT   CDS_pept        complement(414445..416424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003880"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95188"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2P6"
FT                   /protein_id="ACN95188.1"
FT                   /translation="MLKHNYSDKINNRYSYTNKFSYSDEGVDETIKDKITTEDQVVTDD
FT                   KVVTDDEVTTEDQVTDPRDQIEKEKKDDEFTRETLEECKNRAQKAEDDAKKAVKRAEDD
FT                   AARAIKRAKDDAEEEIGRAKDDAKQARERAEEDAKAKKAAEEVAKQAQGEAEEAKEQFT
FT                   KCEENAERIKDDAKQAIERAEEDAKAKKAAEEVAKQAQGEAEEAKEQFTKCEENAERIK
FT                   DDAKQAIERAKDDAKAKAAEAVKQAHGEAKEAKEQFAKCEKDAERIKDDAKQAIERAKD
FT                   DAKAKADLAIKQAQDEIEKVKAEAKQAKADAGKAKEEAEGIKEAFVQCEKKVEKAKEEV
FT                   VKCKIGMAKAEVEWYKKEAEECKKEKGIGTGKPDTGKKGDETGTGKPDTGEKGDETGTN
FT                   KPDTDEKEDETGKASVITSQEITLDCSQAENCGAHASWYTAYNKIGHQGFNTSDLLKEL
FT                   YPEMYSNPKIATYIEKGIEGYYGVVNFKFAFTELFDSAHYFSNMSCKKCMDNPQEIACQ
FT                   DDEIKSFCYPAGYHNNKEYNKSFFMRESCPDLIRESDRTIVAKAKQIAPLILVNTLGQM
FT                   IDKEGNNTQILYSSLKPYLKANGKIKDCGVDKKCEDFAKIMKKVAWDSDKEVLLKTVFD
FT                   STEKTNPYYYDNEDSLVSVDTNFI"
FT   gene            complement(416626..418335)
FT                   /locus_tag="WRi_003890"
FT   CDS_pept        complement(416626..418335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003890"
FT                   /product="ABC transportet, permease/ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003890"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95189"
FT                   /db_xref="GOA:C0R2P7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2P7"
FT                   /protein_id="ACN95189.1"
FT                   /translation="MRSNIRQLFYYIKPNLSYFVIAFIAVLFSALTILLFGRGLSNIID
FT                   SGTEHDFTTKLLVAILIVLAISLTAFTRLYFIGIGSEKVIARIRYDLYSSITDLQPSFF
FT                   ENTGVQDVISALITDTSVLQSIINSSLLTILRNFVILIGSVAMLLYTNIQLTAYAAAII
FT                   PILLIIVTSLGKKVRSHARFAQDKLSELASFSEENFRSIVTIKSFVLEENEKTRFKEYL
FT                   NSVSKSYVKLVLLRAILVTLVITCVIGSLVVLLFFGIKEVLSNNITIGELSSFVVYSAL
FT                   AAGAINNLSDNISDLQRGLGIVERLFEFKNMKSSIVDPDDPIKICSVQKGISFNGVTFF
FT                   YESQSDKPALNNVSFSIEAGQAVSIVGPSGSGKSTILKLLLRFHDPNKGSITIDGHNIK
FT                   SIALNDLRSLFGLVPQDHMIFSCSIIENILYGKPGAEYEEVRQAAIGAYAMEFIDKLPD
FT                   KFDTFVGKRGLKLSEGQKQRIIIARAILKNPQVLILDEATSALDYKSENLVQKALSELM
FT                   QNRTTIVITHRLSTALKTDKIIVINHGKVEEVGTHDSLISKDGLYAKLAKIQ"
FT   gene            419477..419920
FT                   /locus_tag="WRi_003900"
FT   CDS_pept        419477..419920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003900"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95190"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2P8"
FT                   /protein_id="ACN95190.1"
FT                   /translation="MALSKFLDPKLDLTFKKIFGTERNKNILIHFLNDILGFTEINTIQ
FT                   EVEFLSTIMDPEIASDKQSIVDVLCRDSSGARYVIEMVRPESLRSYCLKGEEFIQKETE
FT                   RILKLIEPDVLPSESTHQCELGNQLVPSDADNEPPLDKEDAQS"
FT   gene            complement(420073..420306)
FT                   /locus_tag="WRi_003910"
FT   CDS_pept        complement(420073..420306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003910"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95191"
FT                   /db_xref="GOA:C0R2N3"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2N3"
FT                   /protein_id="ACN95191.1"
FT                   /translation="MEVCSFSRELMLQILSISLQNGIRFLHYPLPAHPSAFLAGCLPYR
FT                   RKYRLILFLLSYNSGLGGFSIPVELLFAYIQK"
FT   gene            join(420358..421590,423080..423394)
FT                   /pseudo
FT                   /locus_tag="WRi_p03920"
FT                   /note="reverse transcriptase, putative; disrupted by
FT                   IS-insertion"
FT   gene            complement(421832..422854)
FT                   /locus_tag="WRi_003930"
FT   CDS_pept        complement(421832..422854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003930"
FT                   /product="transposase"
FT                   /note="ISWpi7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003930"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95192"
FT                   /db_xref="GOA:C0R2Q0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q0"
FT                   /protein_id="ACN95192.1"
FT                   /translation="MINNFLGIDVSKERFDVSLSFISKKGKRETRKRKFKNDDTGFQGL
FT                   LNFLQKHNVEEVKACMESTGCYSEALAEFLHNAGYFVSVVNPACIRFYAKSKLTRQKND
FT                   QTDAEIIADYCQRQEPSRWTPPSPEKKKLKHLYRCSNALKDELTLANNHLEKKERLPKE
FT                   VANAWEDLAMNIEQKIETIKNSIRELLKQHKELLEDFQLLLTIPGIGEETAIAILAEIP
FT                   GIKAFINARQLAAYAGTIPQNITSGSSVHAKPRLSKTGSRTLRKAMYFPAIAAKKHNPI
FT                   IMASCERLKEKGKHAMAIVGAAMRKLLHIVFGVLSSKKAFDPDHIKNYRAKRLTEGLVL
FT                   "
FT   gene            423391..424131
FT                   /locus_tag="WRi_003940"
FT   CDS_pept        423391..424131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003940"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95193"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q1"
FT                   /protein_id="ACN95193.1"
FT                   /translation="MKDKPVREKKDLDKGLKRSVGKPACCVSKGGSSSNTTSLPNQLTR
FT                   DKGFEKRAQLYAAKAYSRQADKSGKYVDLKKIFFIAISNCTLFPDKLDYISSHTIRDEK
FT                   TNEHDLKDFQFIFIELPKFPKSRAEQLESVVDRWLFFFKYADETTDEDLRKIAEKSPII
FT                   KLAYDELDKFHWNEKDLVAYEERIMDLRKEEAILEYRLDLAKEEGRKEREIEVAKNLLK
FT                   AGVSFNIIAQTTGLSMSEIKELQN"
FT   gene            complement(424326..425441)
FT                   /locus_tag="WRi_003950"
FT   CDS_pept        complement(424326..425441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003950"
FT                   /product="cell division protein FtsW, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003950"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95194"
FT                   /db_xref="GOA:C0R2Q2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q2"
FT                   /protein_id="ACN95194.1"
FT                   /translation="MNIKLWYRTLDYYLILPVFFLLTISFILVYSASPVIAQRLSLPQD
FT                   YFIRRHTIYIVLSLITLVTFSFLNTRTILNLSFAGFILFTILIAIAIILGIEVKGAKRW
FT                   LHIVKISVQPSEFVRPFFSVVIASILASEMRFKMHISIIIFLLVFVLLLLQPDFSMSML
FT                   LTYSFIGQMFIACIPFLYFLCIIGMAATGTTIAYLCLPHIKQRIYNFVFFTQRDNFQVT
FT                   KSLEAFKRGQLTGVGPGEGSVKASLPDCHTDFVFSVLAEEFGLITCLATLMLFGIISAR
FT                   LLYIAYRENELFNLLVILGISIQFITQFIINIGVTLSVFPTTGITLPLLSYGGSSLLSS
FT                   SIALGIMLSFSRNQAIALKFRERVMLGRYMD"
FT   gene            complement(425438..426154)
FT                   /gene="ubiE"
FT                   /locus_tag="WRi_003960"
FT   CDS_pept        complement(425438..426154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="WRi_003960"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003960"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95195"
FT                   /db_xref="GOA:C0R2Q3"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Q3"
FT                   /protein_id="ACN95195.1"
FT                   /translation="MSTIKIEKKSQLVKEVFDSVASRYDTMNDIMSLGMHRLWKDRMVN
FT                   SVHFTKNSKVLDVAGGTGDIAIRIVRKEPSAKVTVCDINQNMLSRGRDKAINSNQINFD
FT                   WVCANAESLPFEDSEFDYCTIAFGIRNVSDRKKALNEAHRVLKPHGKFICLEFAPMHYQ
FT                   NEIFTKLYDLYSFKVIPKIGSIVAKDKSSYEYLVKSIREFPTQADFKMEIEEVGFKNVE
FT                   FHNMSYGIVALHIGTK"
FT   gene            complement(426208..427071)
FT                   /gene="lipA"
FT                   /locus_tag="WRi_003970"
FT   CDS_pept        complement(426208..427071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="WRi_003970"
FT                   /product="lipoyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003970"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95196"
FT                   /db_xref="GOA:C0R2Q4"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Q4"
FT                   /protein_id="ACN95196.1"
FT                   /translation="MHSKPQWLRAKAPTGEVFNETLNIVKLHNLHTVCEEAACPNIGEC
FT                   WNKRHATVMILGSVCTRACAFCNVATGIPDKLDPHEPENLAKAIKKLNLKHVVITSVDR
FT                   DDLPDGGANQFIQCIEEIRKITSETTIEILTPDFLNKKGAFEAIAVASPDVYNHNIETV
FT                   PRLYAKIRPRARYFHSLYLLKMVKQINPKVFTKSGLMVGLGETKEEIFQVMDDLRSAEV
FT                   DFITIGQYLQPTPKHAKLDRYVTPEEFEHYKYIAYSKGFLVVASSPLTRSSYHAEEDFN
FT                   RLKACR"
FT   gene            complement(427064..427378)
FT                   /gene="rpmB"
FT                   /locus_tag="WRi_003980"
FT   CDS_pept        complement(427064..427378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="WRi_003980"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003980"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95197"
FT                   /db_xref="GOA:C0R2Q5"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q5"
FT                   /protein_id="ACN95197.1"
FT                   /translation="MSRVCELTNRKKSFGNKVSHSNRKTKRTFLLNLHKVTLTSDILNK
FT                   KFRFRVATRTLRTIDYKGDLDAFLLNTRTIKLSEKAQKIKRRLKKVLVKQEVELAVSDA
FT                   "
FT   gene            complement(427416..427757)
FT                   /locus_tag="WRi_003990"
FT   CDS_pept        complement(427416..427757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_003990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_003990"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95198"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q6"
FT                   /protein_id="ACN95198.1"
FT                   /translation="MLKRSGPKKLKSIIENYALKCMKNKISKNEIRLILNWRNIVGKEI
FT                   AECTKPKKISYAQNINSGVLHLVVTNGSKALEIQHMISLIIEKITIFFGYKAVYGIKIK
FT                   QESIDYLTI"
FT   gene            complement(428096..428296)
FT                   /locus_tag="WRi_004000"
FT   CDS_pept        complement(428096..428296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004000"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95199"
FT                   /db_xref="GOA:C0R2Q7"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q7"
FT                   /protein_id="ACN95199.1"
FT                   /translation="MKWLDIEDIVEALEEKFPNENIISIRFTELKKKVLSLEEFDDDEK
FT                   RCNEKILEAIQAAWIEERLTA"
FT   gene            complement(428330..428413)
FT                   /locus_tag="WRi_t04010"
FT   tRNA            complement(428330..428413)
FT                   /locus_tag="WRi_t04010"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUA"
FT   gene            complement(428423..429037)
FT                   /gene="rpsD"
FT                   /locus_tag="WRi_004020"
FT   CDS_pept        complement(428423..429037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="WRi_004020"
FT                   /product="ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004020"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95200"
FT                   /db_xref="GOA:C0R2Q8"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Q8"
FT                   /protein_id="ACN95200.1"
FT                   /translation="MTTVITRKYRISRRLGVNLWGRAKDPVNKRKYPPGQHGILGFKKL
FT                   SDFGKQFAAHKKFKFYYAISSKQLRRTFLDAYNRKGYTADNFIGILESRLSSVLYHSGL
FT                   VPTIYSAKQLISHKHVTVNDKVVNISSYRVKPGDIIKIRERAAKIPVVVEAEQKQERKA
FT                   PDYLEADSKEHSVKYLRSPQYSEVPYSADMEVNLVVEFYSR"
FT   gene            429151..431223
FT                   /locus_tag="WRi_004030"
FT   CDS_pept        429151..431223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004030"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004030"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95201"
FT                   /db_xref="GOA:C0R2Q9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q9"
FT                   /protein_id="ACN95201.1"
FT                   /translation="MNHSHLESMANAIRFLSIDAVQKANSGHPGMPLGMADVATVLFAK
FT                   YLNHNPDDSKWFNRDRFVLSNGHGSMLLYSILYLTGYISIDELKNFRQMGSKTPGHPEF
FT                   GLTSGVEATTGPLGQGFATAVGMALAESILKEQFGDSLINHYTYVMLGDGCLMEGISHE
FT                   AASLAGHLKLNKLIALFDDNDISIDGATCLSCSDDVEKRFLAYGWNVDKIDGHDFDAIS
FT                   LAIEQAKKSDKPTMICCKTIIGKFSSRAGTSSVHSGAFSEEDIKQMREKLNWNYEPFHV
FT                   PEDVKNAWKKTVERAKQNYTMSFQRVTRKEEKEWIPVSSTGMTRESTGMTEENAGMTGY
FT                   HVELQRRLDKHLPDNIAGVLADLKKQICELMPNEATRSSFGKVMELLTKSMPELIGGSA
FT                   DLTGSNCTKYEHMQVIDSNNYSGSYVHYGVREHAMAACMNGMALHGAILPYGGTFLVFS
FT                   DYCRPAIRLSALMKQQVMYVMTHDSIGVGEDGPTHQPIEHLASLRAIPNLYVFRPADAV
FT                   ETLECVSIALEKKESPALFALSRQNVSYMRKFYSDIDQSANLSKFGAYILCECSKELKV
FT                   TIFATGSEVEIAVEAREKLQEKGIGTRIVSMPCWRLFDEQSDEYKAAILNNDSIKVAIE
FT                   AGSEMGWHKYIGSNGIFIGMKSFGESAPYKTLYEHFNISADHVVKCVCEKLVYIQ"
FT   gene            complement(join(431239..432693,437111..437494))
FT                   /pseudo
FT                   /locus_tag="WRi_p04040"
FT                   /note="ankyrin repeat domain protein; disrupted by
FT                   IS-insertion"
FT   gene            432769..433601
FT                   /locus_tag="WRi_004050"
FT   CDS_pept        join(432769..433143,433143..433601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="WRi_004050"
FT                   /product="transposase, IS5 family"
FT                   /note="ISWpi1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004050"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95202"
FT                   /db_xref="GOA:C0R2R0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R0"
FT                   /protein_id="ACN95202.1"
FT                   /translation="MRKKYPTDLSEREWARIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKKVKGRKRHIITDTQGFILGCYVGAANENDRDGIKIALN
FT                   NMRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFWVHKDTPPELLPTR
FT                   EQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMSRVMLKREYA"
FT   gene            433711..434699
FT                   /pseudo
FT                   /locus_tag="WRi_p04060"
FT                   /note="transposase, degenerate"
FT   gene            434777..435609
FT                   /locus_tag="WRi_004065"
FT   CDS_pept        join(434777..435151,435151..435609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="WRi_004065"
FT                   /product="transposase, IS5 family"
FT                   /note="ISWpi1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004065"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95203"
FT                   /db_xref="GOA:C0R2R0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R0"
FT                   /protein_id="ACN95203.1"
FT                   /translation="MRKKYPTDLSEREWARIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKKVKGRKRHIITDTQGFILGCYVGAANENDRDGIKIALN
FT                   NMRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFWVHKDTPPELLPTR
FT                   EQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMSRVMLKREYA"
FT   gene            complement(435865..436899)
FT                   /locus_tag="WRi_004070"
FT   CDS_pept        complement(435865..436899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004070"
FT                   /product="transposase"
FT                   /note="ISWpi7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004070"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95204"
FT                   /db_xref="GOA:C0R2R2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R2"
FT                   /protein_id="ACN95204.1"
FT                   /translation="MELYMINNFLGIDVSKERFDVSLSFISKKGKRETRKRKFKNDDTG
FT                   FQGLLNFLQKHNVEEVKACMESTGCYSEALAEFLHNAGYFVSVVNPACIRFYAKSKLTR
FT                   QKNDQTDAEIIADYCQRQEPSRWTPPSPEKKKLKHLYRCSNALKDELTLANNHLEKKER
FT                   LPKEVANAWEDLAMNIEQKIETIKNSIRELLKQHKELLEDFQLLLTIPGIGEETAIAIL
FT                   AEIPGIKAFINARQLAAYAGTIPQNITSGSSVHAKPRLSKTGSRTLRKAMYFPAIAAKK
FT                   HNPIIMASCERLKEKGKHAMAIVGAAMRKLLHIVFGVLSSKKAFDPDHIKNYRAKRLTE
FT                   GLVL"
FT   gene            complement(437627..438790)
FT                   /locus_tag="WRi_004080"
FT   CDS_pept        complement(437627..438790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004080"
FT                   /product="bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004080"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95205"
FT                   /db_xref="GOA:C0R2R3"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R3"
FT                   /protein_id="ACN95205.1"
FT                   /translation="MILSVAIVDMATDLYSVALPSIANYFKVEGSVVQLTISLNLVGFA
FT                   VSGLIYGPLSDHYGRRPMMLIGMTIFTLASVMCYIADSIALLILIRFIQGTGAGVAGVV
FT                   GYAAIRDMYSGSEYSRVISKLNMVVALSPGIAPVVGSYIISHGYSWKFLFFIISLAAIA
FT                   ILIFIYFKLQETLTVNKNETSITNITTNIFKQYISIFRNYRFLGFSAIHGLTFMWLWAY
FT                   IANYPFIFESMGIEVQYFGYLISIIVIFYIIGTLINRRYVPKVGVSKMLIIGLVLPIIS
FT                   DSLLVYFYFADKLNIFILQTAWIPANIGLALIISNNVTSALETIKGIGLGSAVLSFCNM
FT                   MFGAIGIYIVGKFFRYGILPNLLLTIACSTIAILMYSQLKCTEKHRE"
FT   gene            complement(439016..442213)
FT                   /locus_tag="WRi_004090"
FT   CDS_pept        complement(439016..442213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004090"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95206"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025195"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R4"
FT                   /protein_id="ACN95206.1"
FT                   /translation="MSTIILSSIFGQAGSIFGPIGRIIGSELGALLGAQLDGAMFSLDA
FT                   EQKVTHGARLKNLQVQTSTYGRTIPIIYGTARVAGNIIWSQPIKEEAITTKSKIGRGMN
FT                   VTYNYYATLAIAICKGKVEKLNRIWADTTSLSFDEIDYTFYSGREDQNPDPFISSIEGE
FT                   GNVPAYRGISYIVIKNFPLADYNNRVPVFTFEVQTALKPVGFSIAENIRNINIIPGSGE
FT                   FVYDTKIQKKIEQEKISSNQYIPYGLAQRVNHNNHTKKSDAVLSLDQLKGDLPNVEWVS
FT                   VVVNWFVNDLNIKDCKIYPAVEFQDDSAILPDDWQVGGVTRDNAQLISKDASGNPRYGG
FT                   TVSDSALIRYIEELHSRGYKVMLYPMPLLDTKNKEWRGKLSGTPGDISDFFENQYNKFI
FT                   EHYASIAKQTKVEGFIIGSEFAQLTKIRDEQGNYPAVIELVKLAKQIKLNLGKEVTVTY
FT                   AADWSEYHSYDGWYNMDELWSSEYIDVVGIDAYFPLTDGPEPPFGYSAEDVMGGWSSGV
FT                   GYDYFYDYSKSEPEKVKYNDSRYAWKNIEKWWSETHINPGGSKTKWQPKMKKIWFTEYG
FT                   FPSMNGCTNEPNVFVDKGSIESKYPRYSNGEVSFLSQKIAIEGTLKKWQSSEMVEKMFL
FT                   WAWDARPFPYFPNLCDMWTDCHNWQTGHWIQGKLSQLNISDVLSDLLQKAGLKSDQFDT
FT                   SNVKGLLSGYVINDQQPVRSIIKMLQSCYFFDVVEQDSKLKFVQKGRGVTTVMPIGETV
FT                   FSNNSKLANISQLDLNNKVNVVYFNRNFGYPIDVKYAELPKQGAAITVEIPLIMEEGEA
FT                   QNIAEVLLYSSWQERNIYNFKLPIKYAWLVPSDVITILDSEKKHTVRIIKTKFESMSIQ
FT                   VIGVGYDHSIYKLSFPSTRSLMLKEYPPSHISKTIVEMIDLPDIKGNSASFTLISEEKN
FT                   WKGATLFISYNDKDYKPIASTNKQSTYGYVMESTDEGLIVVLRFGNITSIADSNLALVG
FT                   KEIVKFQNAELIDKNKYKLSNLIRGQEGTKETAGEKFVLLDDSIISFEVQRGKKFYLKA
FT                   VTYGDSLDNTEAKVLNN"
FT   gene            complement(442972..443529)
FT                   /locus_tag="WRi_004100"
FT   CDS_pept        complement(442972..443529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004100"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004100"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95207"
FT                   /db_xref="GOA:C0R2R5"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2R5"
FT                   /protein_id="ACN95207.1"
FT                   /translation="MAVMPDKWIREKAENFGMIEPFVNHKSSKGVISFGLSSYGYDARV
FT                   DNKFKIFTNVNSAIVDPKNFSENSFIDKETDVCIIPPNSFVLASTVEYFRIPRNVLVIC
FT                   VGKSTYARCGIIVNVTPLEPGWEGHVTLEFSNTTPLPAKIYANEGACQFVFLSGESECE
FT                   KSYDDMKGKYMNQHGITLPLVK"
FT   gene            443671..444687
FT                   /locus_tag="WRi_004110"
FT   CDS_pept        443671..444687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004110"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004110"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95208"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R6"
FT                   /protein_id="ACN95208.1"
FT                   /translation="MLRNLLLIFVFVLFTPLSNADARKYIRIVGSSTVFPFISFIAEEF
FT                   NRVFSFKTPVVESIGSGSGFKMFCSGIGEDTPDITTSSRPMKEVERELCKRNKINEVIE
FT                   IIIGYDGIVIANSNQSHRFDFTKKDLFETLSAYSQENDKLVKNNKKFWSDVNQALPKTE
FT                   IEIYGPHQNTGTYETLVNSIMLDQYSCMNSRIFKENYKDQEERKQACGNIRDDGRYIEV
FT                   GINENIIIQKLKSNKNALGIFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPL
FT                   YLYIKKEHLDTVDGLREFVKEIIDSIGIEGGYLSRLGLIPLSSEDIKKASAKVYDIT"
FT   gene            complement(444767..445693)
FT                   /locus_tag="WRi_004120"
FT   CDS_pept        complement(444767..445693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004120"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95209"
FT                   /db_xref="GOA:C0R2R7"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R7"
FT                   /protein_id="ACN95209.1"
FT                   /translation="MNHEGIGAGYKDNFLDFAIIGLDAGVKVQGEIGENVEIIKQIWKV
FT                   ANQKTRDFVCCRAIESFRGFGLYNIPALKTVIQEIEEHKRVMDLDMALRRAIRSLNVDQ
FT                   VKTALENCGEDVESVLTRNVYWSDATDIDCLLIYPLMVDYERNLGKEEFEKIKEITKLL
FT                   WDKASPDVRNFWLEDHMVNREGQNTEDNYIIGSLEKQQKEYANIAGEGWLEDFIQEVKG
FT                   YKKDREIKLNEYKGKIALGVVGLCVVGAIAAYVLAYPVVALVLEVLAVSALAVLAYIGG
FT                   VCEKSESPNTKSSDPVVSGVLQQRRTV"
FT   gene            445961..447421
FT                   /locus_tag="WRi_004130"
FT   CDS_pept        445961..447421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004130"
FT                   /product="Trk system potassium uptake protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004130"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95210"
FT                   /db_xref="GOA:C0R2R8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R8"
FT                   /protein_id="ACN95210.1"
FT                   /translation="MKNHQRLQNLRSIVFIVGIFLLLFSLAMLIPAITNKCLSYKWKNF
FT                   LAGFIITCTSGAIFILLGKLSRLHGMPAIFAITSCTWIALSLFAAIPFYFDNLSYVDAL
FT                   FETISGITTTGATIFNDIEKQSPGILLWRAMLHGMGGFGVITLGIAVFPMFKVLSLNNL
FT                   LYSEYSDATKRKLPNTRSVVIHVTAIYYGLILLCIFSYYLAGMPLFDAICHGMSAVSTG
FT                   GFANYNDSIGHYNNPILEAITIVFMILGSLPFLSYLKIIRRLDICYDEQVSYFVKIATI
FT                   SSLFACFWLYKNVDLGVSLSFRCSTFTITSLITSTGYAICNHIDWSFISVLAFFLTFVG
FT                   GCSGSSSGGVKIFRLIIFLRSIENHFRLLLNPGAGDRVKFNGKTLENDEVHSVFIFFAI
FT                   FMLTFTISSIVMSYLSNADFITSISSVSATLTNSGPGFSNLIGPSGNYSSFSNEVKLFL
FT                   SFLMLLGRLEILPIYFCIGNLFLFNRKK"
FT   gene            complement(447669..449039)
FT                   /locus_tag="WRi_004140"
FT   CDS_pept        complement(447669..449039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004140"
FT                   /product="Mg/Co/Ni transporter MgtE"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004140"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95211"
FT                   /db_xref="GOA:C0R2R9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R9"
FT                   /protein_id="ACN95211.1"
FT                   /translation="MNIEISSHYGLDKKAIDDLIESLDNEELENVRNIVKTIDSVQLAY
FT                   FLSTSISDHREKLVNILDQHLLSDALVHVVPDLQIEIIETLGIENTAKLLMLLDVEDIV
FT                   TIVKDLDRKSVENILYYLPSKTQKSVEELLSYPEESAGRLIHKDMVIAPYYWTINQLTE
FT                   FVCNYKKIPEKFHQIFIINSKLEPIGSVNLNKVISHSGDTIIKEIMDHDIKIIKTGIDQ
FT                   EEVARIFKDYSLLSAPVVNKNGKIIGVILIEDVIKVVQQETEEDVLKISGVSSKADINA
FT                   PIHKTIIKRLPWLLFNLLAATMCSIVVGFFDDVIKSFIVLPIIMPIIASMSGNAGSQTV
FT                   TLTIRAIATKYLTEQNAKRILMKEFLIGLINGVILSTISLVVLAIRFHNFKVEMIFVVS
FT                   MIMMSIIATFIGTFIPIMLHRLKSDPAVSSSILTSATTDILSAFIFLGLATIFLLNS"
FT   gene            449287..450297
FT                   /locus_tag="WRi_004150"
FT   CDS_pept        449287..450297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004150"
FT                   /product="Protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004150"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95212"
FT                   /db_xref="GOA:C0R2S0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2S0"
FT                   /protein_id="ACN95212.1"
FT                   /translation="MRLEELDSQASNDNLWQDNQKAQEILKERSKIKNDVESFLKLESD
FT                   YNDAISLMKSAIDENDEEFFSEVENELAKLEKLIKYKETESLFTGEADNNNCFLEIHSG
FT                   AGGTESNDWAEMLMRMYVRWAEIYHNFKVEVVEKLEGESVGIKSAMIKIVGEKAYGWAK
FT                   SESGIHRLVRISPFDANGKRHTSFASVGVTPVIEDSIDIAVDEKDLKIDTYRASGAGGQ
FT                   HVNKTESAVRITHIPTGVVVQCQNGRSQHRNKDEALKLLKGRLYQIELEKKEQKMAEEY
FT                   GKKCDIGWGNQIRSYVMHPYQMVKDLRTGHEVGNINSVFDGNIDCFIVSVLTKQN"
FT   gene            complement(450477..451511)
FT                   /pseudo
FT                   /locus_tag="WRi_p04160"
FT                   /note="transposase, degenerate; ISWpi3"
FT   gene            complement(451590..452348)
FT                   /gene="pstB"
FT                   /locus_tag="WRi_004190"
FT   CDS_pept        complement(451590..452348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="WRi_004190"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004190"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95213"
FT                   /db_xref="GOA:C0R2S1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2S1"
FT                   /protein_id="ACN95213.1"
FT                   /translation="MSNTRASVKDLNLWYGSKQVLFDINLNIYKRKVTTFIGPSGCGKS
FT                   TFLRCFNRMNDYVPGCKTVGELDIDGLGDIYSRDMDVVLLRAKVGMVFQKPNPFPKSIY
FT                   DNVACGPKLHGMAKDKQKLNEMVENSLTKVGLWEELKDRLQDSALNLSGGQQQRLCIAR
FT                   AIAVKPTILLMDEPCSALDPMATNAIENLIQELKLRFTIIMVTHSMKQAKKLSDSVIFF
FT                   HNGRIVESGSTQEIFENAQSPLTKEYILDH"
FT   gene            complement(452345..453130)
FT                   /gene="dapB"
FT                   /locus_tag="WRi_004200"
FT   CDS_pept        complement(452345..453130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="WRi_004200"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004200"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95214"
FT                   /db_xref="GOA:C0R2S2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2S2"
FT                   /protein_id="ACN95214.1"
FT                   /translation="MKIRVGVIGCLGRMGKKILNELITNTKVEIAGAVARSGSKYIDSD
FT                   IGPIIANLGIKVTSSISDVFESSDVVIDFTTKECMLDCLKAAVKFKTPLVSGTTGIEGV
FT                   DLKEYAAEVPILWSANMSVGVNVLLKLVKKAAELLGNEYDVEIWEMHHNLKKDSPSGTA
FT                   IELGKTIANASKVDFQSNQYLHSGSNIRKKGGIGFAVSRGGGVIGDHSVMFVNSDERIE
FT                   LNHKAIDRTTFARGAVQAAVWLYENKREIPGLYSMQDVI"
FT   gene            complement(453537..454571)
FT                   /locus_tag="WRi_004210"
FT   CDS_pept        complement(453537..454571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004210"
FT                   /product="Fic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004210"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95215"
FT                   /db_xref="GOA:C0R2S3"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2S3"
FT                   /protein_id="ACN95215.1"
FT                   /translation="MFDISKIVITPEMLKLVAEIDEFKGAWQLFGNLAPERLQMLKKIA
FT                   TIESIGSSTRIEGARLSDREVEQLLSKLDTRSFRSLDEREIAGYAYVCEEVFQNFNKMP
FT                   FTENTIKQFHIWLLQFSYKDQRHMGEYKKSPNHVEAFYESGKSLGIVFETASPLETATQ
FT                   MQELIYWTSQQLEVKSLHPLLIIGIFIVTFLAIHPFQDGNGRLSRILTTFLLLKLGYIY
FT                   VPYSSLESNKESYYLALRRTQQSLKTSSNDFNPWLMFFLRSLQKQKFYLEQKVSHEKVL
FT                   NLYLPPLSAKVLALLSKHGRLTIKDLENITKANCNTLKKHVSNLVKSNHITQHGKGKAT
FT                   WYVI"
FT   gene            complement(454741..455733)
FT                   /locus_tag="WRi_004220"
FT   CDS_pept        complement(454741..455733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004220"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004220"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95216"
FT                   /db_xref="GOA:C0R2S4"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2S4"
FT                   /protein_id="ACN95216.1"
FT                   /translation="MRVTPSKVKRFLEKPDALSGVLIHGSDNSRVDFYVQEIIANLGEY
FT                   SVQVMDFAIVNKLPSLLFSELANVSMFTSKKLIKLINVSGGISKELKNVLDYNVSGHYV
FT                   MMVASDLPYNSATKSYMESSKIFGVIACYKDSNSNLYDIISSYLKQNDIKCTNEIIYHL
FT                   QSYFNHSKLPICSELEKLVLYLGERKDLKLTDIELCFSTSGNDYATLDDLCSAIASKDM
FT                   LRFIRISDALISQENFSPIALIRIISNYFLRLENVLLSVQGGMSEQAAIDQLSPPLFFK
FT                   QLQSFKSHLKSLQLSELKKILEKLISLEVTCKKTDLDHKMIFQHALTGS"
FT   gene            complement(455739..455918)
FT                   /locus_tag="WRi_004230"
FT   CDS_pept        complement(455739..455918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004230"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95217"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2S5"
FT                   /protein_id="ACN95217.1"
FT                   /translation="MSEEGFFSKYISQPVKKFYNYITGKTEESDNVQSTADDIVQESSE
FT                   SLDTHVQSNENDII"
FT   gene            complement(456050..456850)
FT                   /locus_tag="WRi_004240"
FT   CDS_pept        complement(456050..456850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004240"
FT                   /product="cation ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004240"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95218"
FT                   /db_xref="GOA:C0R2S6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2S6"
FT                   /protein_id="ACN95218.1"
FT                   /translation="MLTQDFFINSLVAVVVISLVTGALGSFMIWQRLSYLGDSLSHSSL
FT                   LGVALALIFKISPSLSIMLIAITFAILLSLNFNRLYSADTILNIVTNVVLSSSLILMSF
FT                   LPSGNNSIISSLFGDILTLDQSDIVLIFLTSAVVTLILIFRWRYWLMISINQDLAVVEK
FT                   INVTFVRLEFLITLAIFIAIAAQLIGILLIAAFLLIPAASARLISKTPMQMIIVATVFS
FT                   VISGISGLMLSASFDLLTGPAIILVAAVYLIIAYFIRLVLSRLA"
FT   gene            complement(456852..457217)
FT                   /locus_tag="WRi_004250"
FT   CDS_pept        complement(456852..457217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004250"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95219"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2S7"
FT                   /protein_id="ACN95219.1"
FT                   /translation="MDVTPLISENKNLINGYREGKFLVNNREYCGSIIIFPEKVIKLKE
FT                   SDINSKEHFKSFLTEEIEILIIGTGKTRNILSSSVKSYLMEQKGLNFEFMTTGSACRTH
FT                   NVLISEDRFVVSYLIAI"
FT   gene            complement(457221..458087)
FT                   /gene="ispE"
FT                   /locus_tag="WRi_004260"
FT   CDS_pept        complement(457221..458087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="WRi_004260"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004260"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95220"
FT                   /db_xref="GOA:C0R2S8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2S8"
FT                   /protein_id="ACN95220.1"
FT                   /translation="MKSFCVKAPAKINLFLHVVDKKETGYHLIEGLFVFANLSNFLEIK
FT                   VGEKDSRYDNSTVEFINSESKINNQYNTVMKAVNLLLRHAPVRTKVTVKVVKNIPIAAG
FT                   LGSGSSDAGAVVRTLGKLWEIDRTILNEIALNVGADVPASVDSKPVFVRGIGEELCHIK
FT                   KFSLPTNVVLVKPKKRFLSTPEVFSKHEGKFSEPIKWSDDAEKDLLKLLKETRNDLQEI
FT                   AISFVPEIKDVISTLESQEGSILSRMSGSGVSCFGIFDSEENAKAAAVNIGKKQPEWWV
FT                   CDTQLIV"
FT   gene            458169..461468
FT                   /locus_tag="WRi_004270"
FT   CDS_pept        458169..461468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004270"
FT                   /product="helicase, UvrD/Rep family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004270"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95221"
FT                   /db_xref="GOA:C0R2S9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2S9"
FT                   /protein_id="ACN95221.1"
FT                   /translation="MRSNAINPNFSVWVNASAGTGKTKILIDRVLRLLLENKRNILCLT
FT                   FTNAAANEMENRIHSILSKWAICSDSVLAADLEQLDFFPMSSQCVTLGSQHPYLSSQCV
FT                   TLGSRKNKDYLTRARRLFSELENLGLTIQTIHAFCYKLISSFPIEAGIAPNCTLSECKE
FT                   LHSIIFNKVLHNETVQDDINLIATEIDENKLRDLLYTLCIKRSISANDSKYIKDKLSAP
FT                   DEIHDLQSETIEHVERLAEILSEGSKRDQSYSAILYSTVIPVLDTGIQKKRTSVSYSDD
FT                   TGIKWNDTKIENLAKVFLKSESHEKKSISSIATKSILEKFKDAEQIIESVQNVVFTHIR
FT                   DMNSYQIFKRTSSLLGVFKVYVDLYNSEKSKNALLDYNDIIDLATNLLSDPDHKDWVLF
FT                   NLDQKIDHILVDEAQDNSISQWKIITNLCDEFFAGNDEKRTLFVVGDVKQSIYRFQGAN
FT                   PHLFNYMQQYFHTKTGGRDWISCQLEKSFRSTPEVLMLVDRIFNNFRAEISFNDNEIKH
FT                   VPHRENDQGYIEIWPALPRRKEKEQRALQIPLTCKEGYTIADRLLAQTIANRIHNWLNE
FT                   GRILVAKDRHIEPRDIMILVRQRNVLVDYIISELKKANVPVVGRDYFRIMDYIAVQDLI
FT                   ALAEFLLLQANDLALANALKSPLFNFTEDDLFNIAYDRKEHSLWERIQDYSVVIYSELN
FT                   YLINLSRTESPLALFTHILRTGKKKFAARLGLECFEVLDEFMNLVLQFENPSLQAFVQW
FT                   IKENNPEIKNDMQSERNAVRIMTIHKSKGLQAPIVFLVDTNTVPRNSESIIFDGTEAPF
FT                   WCGKNNNAYCDQVKREKKLEDYNEYLRLLYVALTRAEDELYILSKEPVQKGSWYDLITK
FT                   YGEPYEKKQRGLRPIFKEKVEVLCVNANYPYIYKKRDYFDVPVISLPPALAHSSVSSQR
FT                   VTLESSEKEGAEWIPVSATWMTDGYARGLIIHSILQYMPKIEKERRKNWVRKYLDNINI
FT                   SEDKDEIYSKILAFNEKYGYLFDLEGKSEITLSGIIDGEPVLVRLDRLCITQDKAIIID
FT                   YKSHRNVSVSLLNEIKKQMLTYKTLVQEIYPNKQVEFMVIWVEDLTLQSDF"
FT   gene            complement(461575..461865)
FT                   /locus_tag="WRi_004280"
FT   CDS_pept        complement(461575..461865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004280"
FT                   /product="endo/excinuclease amino terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004280"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95222"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2T0"
FT                   /protein_id="ACN95222.1"
FT                   /translation="MKLSYIYILTNKANSTLYIGVTANLIKRIWEHKNKIVSGFTSRYN
FT                   VNKLVYFEEFEDISLAIARERRLKEWPRQWKINLINQKNPSWVDLYYLALR"
FT   gene            complement(462135..462809)
FT                   /gene="radC"
FT                   /locus_tag="WRi_004290"
FT   CDS_pept        complement(462135..462809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="WRi_004290"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004290"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95223"
FT                   /db_xref="GOA:C0R2T1"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2T1"
FT                   /protein_id="ACN95223.1"
FT                   /translation="MKNYKKGHRKRLREKIILDNGQSLLDYEVLEHILYSAYSRIDVKP
FT                   IAKSLIENFGSLNKVFNADLEALQNVDGVSNAAISAIFCVKQAFVRSAREEIKDLPIID
FT                   NWEKLLDYLRISIGSLNKENFRVIYMNKKYRLIAEDLQNIGTVDQTPLYVREIIKRALL
FT                   IGSTSIVISHNHPSRDTQPSNSDISLTRQLAEACQSIGIELIDHIIITFSSYFSFKENR
FT                   LL"
FT   gene            complement(462784..462930)
FT                   /locus_tag="WRi_004300"
FT   CDS_pept        complement(462784..462930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004300"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95224"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2T2"
FT                   /protein_id="ACN95224.1"
FT                   /translation="MTPFAVFKNECSYNCASCALLNILLKNLISYYTRDKQFIDDEKLQ
FT                   KGA"
FT   gene            complement(463621..464217)
FT                   /locus_tag="WRi_004310"
FT   CDS_pept        complement(463621..464217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004310"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95225"
FT                   /db_xref="GOA:C0R2T3"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2T3"
FT                   /protein_id="ACN95225.1"
FT                   /translation="MLHKFFNRLFSIFSSINVIQKVKKDENGICYVTGLRRYISVLLDL
FT                   IIIVLFLQFCSQALNQLFMNSEDSKILSQIAAKSPMQAPLSAEEKTTQSRLIKLLILNQ
FT                   IVQFIMLFCYVTYMWVKFATTPGKLLFGLRVVDAQTFRKMTLRQATKRFFSFILSVAPL
FT                   FLGLLWSNFNKRCQTWHDKIAGTVVVTSKSLRRQS"
FT   gene            complement(464242..464324)
FT                   /locus_tag="WRi_t04320"
FT   tRNA            complement(464242..464324)
FT                   /locus_tag="WRi_t04320"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUG"
FT   gene            464431..465882
FT                   /locus_tag="WRi_004330"
FT   CDS_pept        464431..465882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004330"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004330"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95226"
FT                   /db_xref="GOA:C0R2T4"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2T4"
FT                   /protein_id="ACN95226.1"
FT                   /translation="MNKLADLLDSRGVDKEICKLPHNLEAEQMLIGAMIRDNRICDAVE
FT                   DTITAENFYDPLHQSIFTQISKTRKHGIVANELSLKMFFENDQAFTECGGVEYLAKLAA
FT                   KASIALDIYSLTRIIRDTYLRRCLIKLGQEIVGDSYNYDIENPAQAQIEQAMTKLFNLA
FT                   VKKQGEKTYIKLASSIKDVVEKISTLKNNPEALGVTTGLQDLNQLLGGLQKSDLLILAA
FT                   RPSMGKTALALNIALNACKMLQKRADKQHYVAFFSLEMSAEQLTARLITIDSGISYYKA
FT                   LTGRISDFELHEFINTSTELSELPFIIDDTPALSISALRTRIRLLYQLYNVEVVFIDYL
FT                   QLIRGTTKRSNENRVQEISEVTQGLKAIAKELNIPIVALSQLSRSVEQRDDKKPQLSDL
FT                   RDSGSIEQDADIVMFLYREEYYELRKQPNEGNNKHREWQEKMEKIRNIAELIIAKQRNG
FT                   PIGSVKLYFDSNRGAFKDYTERHSS"
FT   gene            466013..467386
FT                   /pseudo
FT                   /locus_tag="WRi_p04340"
FT                   /note="hypothetical protein; contains in-frame stop codon"
FT   gene            complement(467460..469106)
FT                   /locus_tag="WRi_004350"
FT   CDS_pept        complement(467460..469106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004350"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004350"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95227"
FT                   /db_xref="GOA:C0R2T5"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2T5"
FT                   /protein_id="ACN95227.1"
FT                   /translation="MEQFENFYITTPVYYVNDKPHIGHAYTSLLCDVVARFMKLAGKNV
FT                   KFTTGTDEHGQKIEKAAKAKEMQPKEFTDDVSVSFKELAKFMNFEYDDFIRTTEERHKK
FT                   AVIALWNRLEERGQIYLDSYSGWYSVRDEAFYQESELIDGKAPTGAEVQWIKEESYFFR
FT                   LSNWQDKLLELYKNQPSFIFPESRRNEVISFVRSGLIDLSISRTSFNWGIKVPGNDKHV
FT                   IYVWIDALTNYLTSIGFPSTEGEEYKRFWAEPETQIPVSSTGMTPNQGKTQIPVSSTGM
FT                   TPNLADNSFNVHVIGKDILRFHAVYWPAILLAADLPLPKQIAVHGWWLNEGEKISKSLG
FT                   NVIDPIGLAQEFGVDQLRYFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTIS
FT                   FLHKQCSGIVPTIDQILLKGEESLPGCKAILDQVMNHLSKYEFNHIILLIINISSEANA
FT                   YIDKSAPWTLSKTDRERVNLVIYKLLEYIRIIGILLQPIVPKSAEMILNQLQIPKEQRD
FT                   LKSLCNACVSLGITLPKPTPVFLRVDAKEEK"
FT   gene            469246..469685
FT                   /pseudo
FT                   /locus_tag="WRi_p04360"
FT                   /note="hypothetical protein; disrupted by frameshift"
FT   gene            complement(469697..470872)
FT                   /locus_tag="WRi_004370"
FT   CDS_pept        complement(469697..470872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004370"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004370"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95228"
FT                   /db_xref="GOA:C0R2T6"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2T6"
FT                   /protein_id="ACN95228.1"
FT                   /translation="MLGIVSIASDHSGYELKSEIKPYLEALGYRVVDQGCTAQQKCVDY
FT                   PDYAVKVVEDITSKKANYGILICGTGLGMSTVANRFEGIYAALCNSVEIAKLAREHGNA
FT                   NVLCLGAGFTASGLAKDIVKQFLETEFSKESRHKKRLDKLSNITSKKKKTKTYNEDEIS
FT                   KFAKMAGQWWDENGKFKPLHIMNPVRVSYIIEKIKELKKCNLKELSLLDVGCGGGILSE
FT                   SMARVGINVVGIDVCEENIKVAHSHAKKVGLNIEYIHTSIEELSNDKKYDVVLLMEVVE
FT                   HVDNLELFMKKAIELLKPNGLIFISTINRTIKSFCLAIIGAEYILNWLPKGTHNWNKFL
FT                   KPSEIANHLRENNVTLQNMAGMEYNVIKREWNLTKGVDVNYILCGLLDLTL"
FT   gene            471773..473521
FT                   /locus_tag="WRi_004380"
FT   CDS_pept        471773..473521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004380"
FT                   /product="DNA primase, DnaG"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004380"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95229"
FT                   /db_xref="GOA:C0R2T7"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2T7"
FT                   /protein_id="ACN95229.1"
FT                   /translation="MDHIDIIKSKLLLSDIVGKKVRLIKRGDSFVGLCPFHNEKTPSFS
FT                   VSNTKGLYYCFGCLASGDAFEFISQTEGLSFKEALEKLASVTGVELPKNLSITKEDNKL
FT                   FLALDLAANWFAQKNQGVVDYLKQRKISPKIIDQFKIGYAPSSGLKEYLNSSGIEDRIL
FT                   IDIGLVNKNFRDYFYDRLIFPIQSIAGRVIGFGGRVLSSEQQPKYLNSPESQLFKKREN
FT                   LYGLNFALSEIRKKQHILVVEGYMDTIALHQAGISNAVAPLGTAISAEQIKNLWRFAKE
FT                   ISICMDGDSAGRHAATRVAELALPILEPGYTLKFVTLPSNKDPYDICNELEYKKEDVLT
FT                   ALDHSTKLHSEYLWHHIIDSNLQNYEKLAPEKYSILEHKFMEYVNTISNSSIRRYYRDY
FT                   FYNKASELRSSFKKQIFNSKTRATKGEYLHNKSPELIEAEQNQAVILRIAVEFPEILNR
FT                   PIFFEQFSHFEFTNEMKRLQQRIIDVISNKNKLDKEALLQELKQFNVIKYVFEKTSVLN
FT                   SQLNERKSAEIVWNNIVLLKELNALRKERTEARLSGNLDLEERLIEQIEQIESSIQEMQ
FT                   MEFIEK"
FT   gene            complement(473588..473716)
FT                   /locus_tag="WRi_004390"
FT   CDS_pept        complement(473588..473716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004390"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95230"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2T8"
FT                   /protein_id="ACN95230.1"
FT                   /translation="MIKVNSKLYMHSRANYKNYTFSSDPNHIKNYRAKLLEEGLIS"
FT   gene            473759..474841
FT                   /locus_tag="WRi_004400"
FT   CDS_pept        473759..474841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004400"
FT                   /product="Fic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004400"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95231"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2T9"
FT                   /protein_id="ACN95231.1"
FT                   /translation="MNWKNFRLSTRLNLEGPVIEQVYELITAVDSVKNSWQITKKLLPQ
FT                   TIERLTHSVIVTSSGASNRIEGNRLTDKEVEDLYKNLRVKKFKNRDEQEIAGYLEMLTL
FT                   IFHDYTDIPISESSILHINNQMLLYSEKDLYHRGKYKASSNRVEAKDQNGKVVGIIFDP
FT                   TPPYLVRKEVQELIDWYHWSLNNKFKHPLIIVANFVFEYLAIHPFQDGNGRTSRLMTNL
FT                   MLLQQGYDFVSIVSHEKIIETNKLDYYLALNKTQSSWKSGKEDISPWLIFFLNVLKTQA
FT                   NEAHYILERENTEYLLSRKQLFFWEWALSLADKEFSRKDAIEALGFPPRTVEAITKKLL
FT                   GMKYLQRLGEGKATRYKVII"
FT   gene            475051..476133
FT                   /locus_tag="WRi_004410"
FT   CDS_pept        475051..476133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004410"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004410"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95232"
FT                   /db_xref="GOA:C0R2U0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2U0"
FT                   /protein_id="ACN95232.1"
FT                   /translation="MQLFLTRLVNKFYCLKVRNKVIIISSIAFILLFFISSAFLKKDQA
FT                   VHSDNATSSFSVKTQECAPQNRTIYLNFSGTVNPLHRASLVSKISGKIIAIYLPDGEKV
FT                   KRDDVVLKIEDYDRIEQAQKAKALLKQREIEYDSSHKLNKKGYGAQIQVEAAFTALQSA
FT                   KADLKRLELDLENTAVTSPIDGYIDKINANEGDFVNAGQKIADVVNFDQILVVLYVSEN
FT                   EVNKIELGSTAQINLLDGKELAGEVSFISKIAEPKTGSYRVEVKVTNNKMISLQGLTAN
FT                   VRLPSGERFAYKVPSSALSLSDEGALGIKIVDDNNYVVFAPIEIVDHESDGVWIVANNE
FT                   GKSIKLIVLGHLFVKPGDKV"
FT   gene            complement(476235..477278)
FT                   /pseudo
FT                   /locus_tag="WRi_p04420"
FT                   /note="transposase, degenerate; ISWpi3"
FT   gene            complement(477358..477672)
FT                   /locus_tag="WRi_004450"
FT   CDS_pept        complement(477358..477672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004450"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95233"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2U1"
FT                   /protein_id="ACN95233.1"
FT                   /translation="MLISKKKQKLLCLSAALLISSLTLYFSISTITGKRGLLTLIDLKK
FT                   EIEYNKLLLKDVSSEKEKLDNKVFGLYEKSLDLDLLDEQAKNALGYVNPNELMVVLDVE
FT                   "
FT   gene            complement(477722..477850)
FT                   /gene="rpmJ"
FT                   /locus_tag="WRi_004460"
FT   CDS_pept        complement(477722..477850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="WRi_004460"
FT                   /product="ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004460"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95234"
FT                   /db_xref="GOA:C0R2U2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2U2"
FT                   /protein_id="ACN95234.1"
FT                   /translation="MKVKGSLKSHRNRDKNCKVVKRGGKIYIINKVKPRCKARQGS"
FT   gene            complement(477900..478730)
FT                   /locus_tag="WRi_004470"
FT   CDS_pept        complement(477900..478730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004470"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95235"
FT                   /db_xref="GOA:C0R2U3"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2U3"
FT                   /protein_id="ACN95235.1"
FT                   /translation="MTLKKLNLHLVSDSSGETVISVAKSALKHFRSVETIEYVWSFVKG
FT                   EEQIDKILEEINRKSDEHNFVICTITDDELRKYLKDNCIKLKIPYRAILSHIIREISSY
FT                   LEIEKDEKLDLHTEINNEYFQRIEAINYTINHDDGQNIQDIDKADIILVGVSRTSKSPT
FT                   STYLAYRGYKVANIPFVSGVPFYVDLAKLKNKLTIGVTIDVSRLIEIRKNRLTSINNED
FT                   NNIYANPEKVEKEIKEAEELFKQNNWPIIDVTQKSIEEVSATIIQYFNKMLSID"
FT   gene            478866..479576
FT                   /gene="ccmC"
FT                   /locus_tag="WRi_004480"
FT   CDS_pept        478866..479576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="WRi_004480"
FT                   /product="heme exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004480"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95236"
FT                   /db_xref="GOA:C0R2U4"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2U4"
FT                   /protein_id="ACN95236.1"
FT                   /translation="MFLLKPTNFSYFSKKALPWLGVICFACFLIGMSLALFFSPEDYKQ
FT                   GEIVRIMYLHVPSAWLALGIYGLIASLSFISLVWNNSIASVLAHAAAPAGTVFSAICLI
FT                   TGSIWGKGTWGTWWVWDARLTSMLILFFLYVGYLSLWSAFDNEARAEKSAAVFAIFSAI
FT                   NIPIVKFSVNLWSTLHQPASILRRGGVAIEGSLLLPLIVMFMFCATFFLVVWILYSLYL
FT                   INLYKIKREISVRY"
FT   gene            479852..481129
FT                   /locus_tag="WRi_004490"
FT   CDS_pept        479852..481129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004490"
FT                   /product="Adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004490"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95237"
FT                   /db_xref="GOA:C0R2U5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2U5"
FT                   /protein_id="ACN95237.1"
FT                   /translation="MNNIVIVGLQWGDEGKGKIVDYLSENADVVVRFQGGNNAGHTIVV
FT                   DDEVYKLNLLPSAVLRPGKISIIGNGVALDSHALISEIESLKVKGVDVNYNNLMVSESC
FT                   PLILSVHKDKEKLFEDLNGNHKIGTTNKGIGPCYEDKVGRRAIRLCDLENADELNKRLD
FT                   TLLNYHNAIRKGLNYQVVKKEEILKEIQEISEKILSYKKPVWKILNDLMKEGKKIIFEG
FT                   AQGAFLDIDHGTYPFVTSSNTVASQAITGSGLSSNAYIIGVVKAYTTRVGNGPFPTEQK
FT                   NEVGDSLFTIGKELGTVSNRRRRCGWFDAVLVRQAVQLSGVSSIVLTKLDVLNSFDTIK
FT                   ICTGYKYSGKMYDYLPASHSIQGELEPIYEEFPGWKENTQGKRSIETLPINLIKYIEGL
FT                   EKLIGVPIHLISTSPKREDVIKLKDF"
FT   gene            481209..481961
FT                   /pseudo
FT                   /locus_tag="WRi_p04500"
FT                   /note="transposase, degenerate"
FT   gene            482213..484651
FT                   /locus_tag="WRi_004510"
FT   CDS_pept        482213..484651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004510"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95238"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2U6"
FT                   /protein_id="ACN95238.1"
FT                   /translation="MTGSLAKEEKTAEAGKTSNQSENYDVESVIRVASCAWNAIHCLLA
FT                   SYEYDLYSSWLESHFTSLKDCINKMEKDNSFTKDSAIIKFCRSIAENNKLYKELKNLNN
FT                   PAEKFSQLEKIITGFKLKDLEDKVSFLMLLKEESDFTAIQKAYRDEWSFYDLINDRDFK
FT                   KTYIDKAVTESANKSFKKDIDKCIKLAEQGKKAASKYLGRKGVELQAYYTETDNAYRVL
FT                   NINSINYNRSEPTRMSDILQQEKDIKELNIYCNKKHEIHAHRKGKERYYEFKEGAYYEM
FT                   KSTWPVKDGSEMCTMIINVSSDGITEVLKFNDEDFVLSDEILELIKQNDELYIQGLSLY
FT                   DAVLEKGKAADVVPTANNNFQNESIVAYRKEPEGELDPKVDADNSLPPSINSNASTQTE
FT                   VNLQHTETQTEVASQQIETKTEVNLQHTGTQTEFASQQMDELILNNQMLSEKNVELKQE
FT                   MSNLKKEAVELKQEIEAGLQVINKKHHELIQENQRLQEKLETTQAEANQTIVKLEKQNS
FT                   NLQDRFEKEEQKNTELQTELAQKNEELAGVLKELQGKAQELKGVYEEKRKLKEELKIVN
FT                   AGKKNLEKELNQAREDAEQIMVERRQQKERLKDQLRELDQEYKVQVEIEQKIKESDRQD
FT                   SDLQDTLGEERLKLNIEELENEYEEFPGDKVLTLELTKDEDKVEELRNELEREKEKCKQ
FT                   LLEEENEWGDELVGMLDGLEEKIRADEQRSFNNQLTGEISNESGNAPRQKKRLSKSSSV
FT                   DNESYVPLREKTTLLRSLSVDSGLDSDEENCDNDLSFNISPISSIEKVAESRNVGRVSL
FT                   "
FT   gene            484764..485027
FT                   /gene="infA"
FT                   /locus_tag="WRi_004520"
FT   CDS_pept        484764..485027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="WRi_004520"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004520"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95239"
FT                   /db_xref="GOA:C0R2U7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2U7"
FT                   /protein_id="ACN95239.1"
FT                   /translation="MIKDEKSKTIFEVEGAVTALLPAAEFRVKLDNEHEIICHVSGKVR
FT                   RSKIRIIIGDRVLVEMSIYDRNARKGRIIRRLKGTSDRTISK"
FT   gene            485005..485601
FT                   /locus_tag="WRi_004530"
FT   CDS_pept        485005..485601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004530"
FT                   /product="maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004530"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95240"
FT                   /db_xref="GOA:C0R2U8"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2U8"
FT                   /protein_id="ACN95240.1"
FT                   /translation="MTERSLNNLILASSSKRRIALLKQINIEPGLILPADIDEAPLKKE
FT                   LPKDYSIRMAKSKAEKIQSSNPNYFVLGVDTVVACGRRILLKAENVEQAEKCIRLLSGR
FT                   RHRVYTSVCLLTPDQSKQHIRTVVTIVKFKRLSEQEIKYYLASEEWKNRAGGCNIQGLA
FT                   GVFVLFLRGSYSSVIGLPLHETYCLLSNYFNFNLY"
FT   gene            complement(485593..488265)
FT                   /locus_tag="WRi_004540"
FT   CDS_pept        complement(485593..488265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004540"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95241"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2U9"
FT                   /protein_id="ACN95241.1"
FT                   /translation="MGTNDTQQEHIYNERIQEIFPLFDKIKKEDDPIYNARVDFNTVKF
FT                   LTKHANWNWDEEENKDKAYGVILQKCDKTKKAGQELESEVKERLKEYVDDVAGVSIYGN
FT                   HASITLGDNKKEFKISEFLNSDFCEKNEISGFSTLHSDGKSGMHGFVAEEEGKKIRHYV
FT                   VTDGSYEMTLKWYAEGKECKIKIKIDANGVDLVKGDDFSLERLEVNRDVKIGGLFLHEI
FT                   EFREKGKVNEVQHNKDSNELSSETTTRIDVNRDVSVQATDITRKKEDHHSHFGPQSNSR
FT                   GQSYDSGIGKDFDDKINSQEAKEKRELRQAAREANSGGQVYNLQSLFEENPQNKKTPPP
FT                   LPPRTSSLPPKKGVFDEQGGAKSGSQKPDDLRENEQTPNNQQKGATSDSSDSSTFTKSV
FT                   SHNQDNRQEDERYDNPTFGHAVPGSQKPDRSEQTPNDQQQPKTQQQEGNSKGDLLQDIR
FT                   NFKKNNLRHIDVDDRKASIAGSRKNNPSPLETLKDRIPYSSSPDNSDNQDASDAKWKES
FT                   EQPLSATALNNKSDSGYSSPTHDNNEQSQVNPEQLKKSLENIEQSDQTPPENLLKEIRD
FT                   RSQQDNRGLRQVDPTDKLSQDKEDGLQKDDLADVKIVEGPTVSVSASTPNSISDSGYIS
FT                   PTNSDSKSQTDLKQVGRKLEEHIRQSNLTLFEELKNTLGQENLGLKPADQSQISEETKK
FT                   RLREVGLLKDSSTDIKANDSGYSSPTHDNNEQSQVNPEQLKKSLENIEPKEIGDTSELK
FT                   GALGNPDKGLREPAQQATKENIPKDSFSENILEKIGEGKQYDPIRKWLEKTVAERENND
FT                   TNPTVDQNSELYKLLEKDEAQLKAGVIEEERGDTLTEHTDGYDRNRIALANRNKRPLDW
FT                   AKQVAESQQKKDTNKGISI"
FT   gene            complement(488612..489955)
FT                   /locus_tag="WRi_004550"
FT   CDS_pept        complement(488612..489955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004550"
FT                   /product="Na+/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004550"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95242"
FT                   /db_xref="GOA:C0R2V0"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2V0"
FT                   /protein_id="ACN95242.1"
FT                   /translation="MDTVKFVLLLPTILLMLVAGVYLSIKLKWLQVFRLPYALSLLGAK
FT                   KGENKFSSIAALFTILGGNLGVGNISGTAVALKTGGPGSILWMAIIIVITSVIKYVTCY
FT                   LSIKTRKEKNGRFIGGPVAYMADAFNSRKATIVFLVVMIMVSITVGNLVQVNSLSIPLN
FT                   MIDVPVVIGGIVMAIIFFVVAALSLKKIKIFISAMIPIMTVSYLTLCGIILFKFSENIL
FT                   PSLKLITSSFFTTSSFNSGLSLGLILEMLTIIQVGTLRGIFATDIGLGLEGIVHSSIVP
FT                   KKNNNKFIIEQSLITIISPFIVAFIVFITTMVLLVTDSWVTDLESTNMCIFAFRKAMNW
FT                   PYIDYLIMAIMFCFAFTTIFTWFFCSKQTIRYVSMDNKYTKIWVVIFTLIIPLGAIGKV
FT                   QLLWDVADISIAALLFINILAILKLTSQDPEVFTMSSRYLKLQKQSYS"
FT   gene            490276..491298
FT                   /locus_tag="WRi_004560"
FT   CDS_pept        490276..491298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004560"
FT                   /product="transposase"
FT                   /note="ISWpi7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004560"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95243"
FT                   /db_xref="GOA:C0R2V1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2V1"
FT                   /protein_id="ACN95243.1"
FT                   /translation="MINNFLGIDVSKERFDVSLSFISKKGKRETRKRKFKNDDTGFQGL
FT                   LNFLQKHNVEEVKACMESTGCYSEALAEFLHNAGYFVSVVNPACIRFYAKSKLTRQKND
FT                   QTDAEIIADYCQRQEPSRWTPPSPEKKKLKHLYRCSNALKDELTLANNHLEKKERLPKE
FT                   VANAWEDLAMNIEQKIETIKNSIRELLKQHKELLEDFQLLLTIPGIGEETAIAILAEIP
FT                   GIKAFINARQLAAYAGTIPQNITSGSSVHAKPRLSKTGSRTLHKAMYFPAIAAKKHNPI
FT                   IMASCERLKEKGKHAMAIVGAAMRKLLHIVFGVLSSKKAFDPDHIKNYRAKRLTEGLVL
FT                   "
FT   gene            492016..492960
FT                   /pseudo
FT                   /locus_tag="WRi_p04570"
FT                   /note="transposase, degenerate; ISWpi8"
FT   gene            complement(493117..493620)
FT                   /locus_tag="WRi_004580"
FT   CDS_pept        complement(493117..493620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004580"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95244"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2V2"
FT                   /protein_id="ACN95244.1"
FT                   /translation="MKIHIYLILFLFFSCTQLYADEEIAKFDLLIGEINEASFTLKGAI
FT                   KVTVEPGWHIYYKDPGDFGLPTSISYEGNASDINIHWPIPKEHKDKVGRETFVSNVYED
FT                   MVLFPFKMNIFLNQGYIDLNFHINYAICKDRCIPKNVEIKIRQPLKDFIDSDINKLINE
FT                   WYEK"
FT   gene            complement(494303..495952)
FT                   /gene="groEL"
FT                   /locus_tag="WRi_004590"
FT   CDS_pept        complement(494303..495952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="WRi_004590"
FT                   /product="chaperonin, 60 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004590"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95245"
FT                   /db_xref="GOA:C0R2V3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2V3"
FT                   /protein_id="ACN95245.1"
FT                   /translation="MTNVVVSGEQLQEAFREVAAIVDSTVAITAGPRGKTVGINKPYGA
FT                   PEITKDGYKVMKGIKPEKPLNAAIASIFAQSCSQCNDKVGDGTTTCSILTSNMIMEASK
FT                   SIAAGNDRVGIKNGIQKAKDVILKEIASMSRTISLEKIDEVAQVAIISANGDKDIGNSI
FT                   ADSVKKVGKEGVITVEESKGSKELEVELTTGMQFDRGYLSPYFITNNEKMIVELDNPYL
FT                   LITEKKLNIIQPLLPVLEAIVKSGKPLVIIAEDIEGEALSTLVINKLRGGLKVAAVKAP
FT                   GFGDRRKEMLEDIATLTGAKYVIKDELGIKMEDLTLDDLGTAKNVKITKDNTTVVSENS
FT                   DSDSVKARIEQIKSQIETSTSDYDKEKLRERLAKLSGGVAVLKVGGATEVEVKERRDRV
FT                   EDALHATRAAIEEGIVPGGGVALLYASSVLDKLKGASDEEQIGINIIKKVLSAPIRRLV
FT                   KNAGLESAVIIDYLIKQNDKELIYNVEAMNYANAFTAGVIDPAKVVRIAFETAVSVASV
FT                   LITTESMIVDVPSKENASSPMGAGEMSGMGGF"
FT   gene            complement(496053..496343)
FT                   /gene="groES"
FT                   /locus_tag="WRi_004600"
FT   CDS_pept        complement(496053..496343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="WRi_004600"
FT                   /product="chaperonin, 10 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004600"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95246"
FT                   /db_xref="GOA:C0R2V4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2V4"
FT                   /protein_id="ACN95246.1"
FT                   /translation="MSSISLNVLDDSVLIKPISEEKQGGIVLPSSAEKKPTKGEVIAIG
FT                   EGSRNSSGERVTLTVKAGDKVFYRQWAGTEIEHNDEKLIVMKESDILAVIK"
FT   gene            496521..497327
FT                   /locus_tag="WRi_004610"
FT   CDS_pept        496521..497327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004610"
FT                   /product="aminomethyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004610"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95247"
FT                   /db_xref="GOA:C0R2V5"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2V5"
FT                   /protein_id="ACN95247.1"
FT                   /translation="MSYIPFLSRGVIVLYGPDTRDFLQGIITNDINKLDSQKAIYSLLL
FT                   SPQGKYLYDFFLIEYGKYTLLECENMHLQQIIEKLDLLKTYLKVKIKDVSALYKVGVLF
FT                   NTKLAECSSESQVIFQDPRHKLLGMRIIHKDEIKEPVGDFTQYEKVRIQNLVPDGAKDM
FT                   VQNSSFPLQFLIDKVNGISFNKGCYIGQEVVNRMSRQEIFRRKLYLVEGDNALPDIGTK
FT                   VTNENNEEIGELRSSVDNIGLALLNTGKSYANLYAGGVKCVKTLKS"
FT   gene            complement(498248..499987)
FT                   /gene="recJ"
FT                   /locus_tag="WRi_004620"
FT   CDS_pept        complement(498248..499987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="WRi_004620"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004620"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95248"
FT                   /db_xref="GOA:C0R2V6"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2V6"
FT                   /protein_id="ACN95248.1"
FT                   /translation="MLLEIEKRSITNALWKLQEADQRQILTLTQRFELPEILARILVTR
FT                   GVNIENASDFLYPLIRSLLPDPFHLLDMDKAVSRIIRAIKNDENLAIFGDYDVDGATSS
FT                   ALINRYLRAIDIHSIIYIPDRVDEGYGLSTDALLQLKKNGIDLCISVDCGTLAYQPIED
FT                   AKAFGLDIIVVDHHLGTEKLPSAVAIVNPNRLDESSPYNNLAAVGVSFLLIVALNKSLR
FT                   EQGFFTNKKEPDLFDLLDLVALGTVCDVMQITGLNRALVSQGLKVMSTRKNVGLRVLFD
FT                   ALGILEKPSVSRLGFSIGPCINAGGRIGEASLGARLLSTDDDEEAHSIALKLIDLNNAR
FT                   KVLENEALLEATAQAEKSAQSGANFIMISGNWHQGIIGIIASRLKEQFHLPTVVISLNN
FT                   GIGKASCRSILGVDIGAAVLSAKFINLIIEGGGHSMAAGFSIKEDKINDLHDFFTERFS
FT                   NSINEKTLKADSIVTAKAINLSLWNQLQRLGPFGVGNPEPRFIIQGAKIRKPEVIGVDH
FT                   IKCFIADDNVMVKAIAFRSANTHLGSAIMQGNVKAILGKISMNYWNGNEFVQFLIEDVL
FT                   TIS"
FT   gene            complement(500327..501349)
FT                   /locus_tag="WRi_004630"
FT   CDS_pept        complement(500327..501349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004630"
FT                   /product="transposase"
FT                   /note="ISWpi7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004630"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95249"
FT                   /db_xref="GOA:C0R2V7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2V7"
FT                   /protein_id="ACN95249.1"
FT                   /translation="MINNFLGIDVSKERFDVSLSFISKKGKRETRKRKFKNDDTGFQGL
FT                   LNFLQKHNVEEVKACMESTGCYSEALAEFLHNAGYFVSVVNPACIRFYAKSKLTRQKND
FT                   QTDAEIIADYCQRQEPSRWTPPSPEKKKLKHLYRCSNVLKDELTLANNHLEKKERLPKE
FT                   VANAWEDLAMNIEQKIETIKNSIRELLKQHKELLEDFQLLLTIPGIGEETAIAILAEIP
FT                   GIKAFINARQLAAYAGTIPQNITSGSSVHAKPRLSKTGSRTLHKAMYFPAIAAKKHNPI
FT                   IMASCERLKEKGKHAMAIVGAAMRKLLHIVFGVLSSKKAFDPDHIKNYRAKRLTEGLVL
FT                   "
FT   gene            complement(502440..503690)
FT                   /locus_tag="WRi_004640"
FT   CDS_pept        complement(502440..503690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004640"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95250"
FT                   /db_xref="GOA:C0R2V8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2V8"
FT                   /protein_id="ACN95250.1"
FT                   /translation="MFLAVCALACSGLLSIIVIFLRLPFISSLVPSAQYIFDNALVIHV
FT                   NLSILVWMCSIISLLFIINLQNTNSWFNFSWVLSTLSMLLIFISAFVPNTEVIKSNYIP
FT                   VLQNKLFLLGLSLFIASILVNTMLAYTSKKEVSFLSVGQIGLVIILVSSFLCFVLAYNN
FT                   MPPGLYHSDNNLFYEYLFWGGGHLLQFAFTQGMFLVYLMISDVSLASSNKITILPLFIN
FT                   TILAVGAPFVYFVYPVDSAKLIQFFTWHMRIAGAVLPCFLIILVCCNIRTFINDKSNYL
FT                   LHSFLLFTYGDVLGVLTIEGNVTIPAHYHGSVVGITIAFMNFVYWLLPKLNFKEIKSSM
FT                   VRLQIYAYSIGHFLHITGLVWLGGYGALRKVADLPSISSMLARTCFIIGGAISVVGGML
FT                   FVIIVLLHLLKGKARTN"
FT   gene            complement(503725..505020)
FT                   /locus_tag="WRi_004650"
FT   CDS_pept        complement(503725..505020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004650"
FT                   /product="Na+/H+ antiporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004650"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95251"
FT                   /db_xref="GOA:C0R2V9"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2V9"
FT                   /protein_id="ACN95251.1"
FT                   /translation="MFYLTNFLPILLFLFLFVGSGIYFTILGVSNAFYQLSPLVAIVPA
FT                   IALGWVLYKGNTEEKMYAFLDGVRDRNIITMCIIFLLAGAFSEVTKAIGSADATVNLAL
FT                   SFIPTQFLLIGLFFVAAFISTAIGTSMGTIATIAPIAVELTQAGISPSLGVATVVGGAM
FT                   FGDNLSIISDTTIASVMSQKADIKKKLKLNAKVALIASIFTIIILFYSSSNSAAISVKE
FT                   YSLLLVAPYIILILLANFGINVFTALVLSITFAGIIGFINNNNYGLLFLSQNITKGFMS
FT                   MHEIMLLSLMVGGLSGLVGKNSKEFADKLSSWVMIQRGGQKTAQLFIAKIVSIFDILLA
FT                   NNTIAIIFSGEIARDIAKKYEIPPHYSAAWLGIFSCVFQGLIPYGAQLLLASTIAGVSP
FT                   LAVVPHVYYCYVLGIIAVLYIVLNKIEKKDCA"
FT   gene            505247..507088
FT                   /locus_tag="WRi_004660"
FT   CDS_pept        505247..507088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004660"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004660"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95252"
FT                   /db_xref="GOA:C0R2W0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2W0"
FT                   /protein_id="ACN95252.1"
FT                   /translation="MRKLVGFCQIERKVKKLSVQMNHQLPKTLYSFIWHFLKPYKLSVS
FT                   IFVSLAIFAGFWGPLNSILIKNIINLLPHVQNGDISILILPSSLIVVNFIVFDNFTWRG
FT                   IGYIRCRFIPVVINSVIGKVMDHVLGKSNKFYQDNLSGKISRQITNLADGIEILISRVA
FT                   PNFLRGASLLLAAFIAAYSVNSIFYFILVVWFIFFASASIMMSRKLISLSDVQAKEESI
FT                   VIGELVDSLSNQSNVRNFSRKSYENSRMIPFLCNQQKAYTATHFYSFIMHSIQGGLIAI
FT                   MMASSACFLIYLYSKNLVAIGDFALILGLSMETGHMMWFTMSEVDEFNKAVGRCKQSLI
FT                   SLMIHCEIQDKLDAVSLKCNSGQITFNNVKFHYDGTEPLFQNKSIAIKAGQKVGLVGYS
FT                   GGGKSTFVNLILRLYDVTDGAILIDDQDICNVTQDSLRAKIAMIPQDPSLFHRTLMENI
FT                   RYGKTNASDDEVIEAAKKAHVHEFISKLPQGYDSLVGERGVKLSGGQRQRIAIARAILK
FT                   NAPILILDEATSQLDSVTESNIQESLWELMQDKTTIVIAHRLSTLLHMDRILVFDQGKI
FT                   LEDGTHQELLDKNGMYKTLWNAQVGGFLPDKKEVEIV"
FT   gene            complement(507101..509554)
FT                   /gene="lon"
FT                   /locus_tag="WRi_004670"
FT   CDS_pept        complement(507101..509554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="WRi_004670"
FT                   /product="ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004670"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95253"
FT                   /db_xref="GOA:C0R2W1"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2W1"
FT                   /protein_id="ACN95253.1"
FT                   /translation="MNIERAVSSSFTALPVLPLRDVVIFPNIMVPLFIGREKSVNALEY
FT                   AISSSNHQNEIFLVAQKDGSVDNPEPEDLYEVGVLASIVQPLIKLPDNAVKVIIRGIRR
FT                   GRVVEYISSHTLLQARVELDNYYKEDEDNIDLEALRRSVVDAFDSWCKLNKKNQPEVAI
FT                   NSIDQIKEVDQLVDTVASHLNIKVSDKQSILEAYDPEERLKKAFAFIEREMSILNAQNR
FT                   LYKTIKSQVESTQKVYYLNEQLKAIQKELGEFENGDEGNILNEFEKKINETKLSQEARE
FT                   KAITDLKRYKKMNPISPEATVISSYLHWLLELPWGKYKDAKINLNAAKKILDENHYGIE
FT                   KVKDRIIEFLAVLKRVKEIKGPILCLVGPPGVGKTSLAKSMARAVGRDFVRIALGGVRD
FT                   ESEIRGHRKTYIGSMPGKIIQHMKKANSCNPLFLLDEIDKMGSDSRGDPASALLEVLDT
FT                   EHNKHFTDHYLEVEFDLSSVMFVATANSLNLPHPLRDRMEIIQLSGYTEDEKISIATHH
FT                   LIPKLKKEHGLYQKEWDITNEALYELIRLYTRESGVRSMERELAKLMRKAVKEILTDKN
FT                   KKISVGVDNLQDYLGVRKYTFGIAENESLVGIVTGLAYTETGGDILMIESVLIPGKGEI
FT                   KYTGKLGEVMQESIKAAYSYIRSNCLFFGIKPEKFQNNDIHLHVPEGAVPKDGPSAGGA
FT                   VCTSIVSLMTNIPVNKNVAMTGEVTLRGRVLAIGGLREKLLAALRGSIKTVIIPSENEK
FT                   DMQEIPASIKEGINVVFAKNIDEVMKVALMHPTTPIDGDDNQNSVPSSIENKDDTFPMS
FT                   ETLKH"
FT   gene            complement(509570..510847)
FT                   /gene="clpX"
FT                   /locus_tag="WRi_004680"
FT   CDS_pept        complement(509570..510847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="WRi_004680"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004680"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95254"
FT                   /db_xref="GOA:C0R2W2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2W2"
FT                   /protein_id="ACN95254.1"
FT                   /translation="MDNNNDLHYCSFCNKAQDEVDKLITNSSDGLKVFICNECIELSHK
FT                   AISQKKDRSFNSDRISDMKLLLKKPEDIKNFLSKHVVGQEHAQHVLSVAMYNHCQSMVQ
FT                   FHAISDIEIEKSNIMLIGPTGSGKTLLAKTLAKVSDVPFAMADATTLTEAGYVGDDVES
FT                   VLSRLLQAANYDVVKAQRGIVFIDEIDKITRKSESTSITRDVSGEGVQQALLKIMEGTV
FT                   AYVPPQGGRKHPQQEFIQVDTSNILFICGGAFEGLDKIIEARKKGTSVGFGADISQSKE
FT                   QKKKNALHDVQPEDLIKFGLIPEFVGRVPITAVLDELDHEDLIHVLTEPRNALIKQYKA
FT                   LLAFSKVNLEFSDEAISAIAKKAISYKTGARMLRAILESLLLDIMYTSGNGGFEGSTIV
FT                   ITKKMVELGKATVNHNNNGNVITVND"
FT   gene            complement(510847..511473)
FT                   /gene="clpP"
FT                   /locus_tag="WRi_004690"
FT   CDS_pept        complement(510847..511473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="WRi_004690"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004690"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95255"
FT                   /db_xref="GOA:C0R2W3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2W3"
FT                   /protein_id="ACN95255.1"
FT                   /translation="MTLIPIVVEQTSRGERAYDIYSRLVKERIIFVTGPIEDNMASVIV
FT                   AQLLFLESENPDKDICMYINSPGGVVTAGLSIYDTMQYINPDVSTLCIGQAASMGSLLL
FT                   AAGTKGKRYSLPHSRIMIHQPSGGYHGQATDIEIHANEILRVKKKLNQIYEKHTGNSLK
FT                   KIEGMMERDKFMDPEEARKIGLIDRVIAERTDIEIENIKVKQKVG"
FT   gene            complement(511485..512822)
FT                   /gene="tig"
FT                   /locus_tag="WRi_004700"
FT   CDS_pept        complement(511485..512822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="WRi_004700"
FT                   /product="trigger factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004700"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95256"
FT                   /db_xref="GOA:C0R2W4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2W4"
FT                   /protein_id="ACN95256.1"
FT                   /translation="MMSNNIPQNTVEVSSVYTYKELSIDKLKYEYEITVGSDYIKQKVN
FT                   SRLQEIAENAKSPGFRAGKMPYDLVVANYKNEALEYVINNTIDYCSSDLMKKIEVKSHI
FT                   YPKVDVISLPDLGKENEEGNFVYKLSFESMPEVPMIDLDKINLKKIEAKIEEEDIKEFI
FT                   DSIKTKFPNFASVDDASYQAKDGDKLIIDFEGRIRNKLFQGGSSKNFAVNLGSGTFING
FT                   FEDQLTGMKKGETKNFKLKFPENYQAISLAGQEADFSVRVNEIQIAKDFENDDEIAKSI
FT                   GFKDYSLLINHAKKMIGDQCTEMRNLLIKKELFDYLDANYSFDLPTDIVKQEQQRMEGE
FT                   LGAQNDSRKEAEKRVKLAMLFMKFSAEHKISLTQNDVLSVIVNQYVSKDVQFDRVLKHF
FT                   ESNKQFQELVRGQALEYKVTDYIIEKVSKEEQIISVKELKELFDNI"
FT   gene            complement(512978..513059)
FT                   /locus_tag="WRi_t04710"
FT   tRNA            complement(512978..513059)
FT                   /locus_tag="WRi_t04710"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUA"
FT   gene            513200..513796
FT                   /locus_tag="WRi_004720"
FT   CDS_pept        513200..513796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004720"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004720"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95257"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2W5"
FT                   /protein_id="ACN95257.1"
FT                   /translation="MRLITSFLLAIFLITQSGCTTLIIGGVVATATATAITMQDKSLGN
FT                   IIDDTTMVIRINKGLLKHGLFSSIKVKVSEGRVLLIGSVDTPEKQLTAEKIAWQQKEIK
FT                   EVINEIRVIPIQMASMLDTTVDGMITAEIRTRLLGKRNIKSINYSVNTVDRVVYLMGIA
FT                   QNKAELKAVIAIARKVKGVKQVVSYVRYRYSKLRH"
FT   gene            513857..514786
FT                   /gene="gshb"
FT                   /locus_tag="WRi_004730"
FT   CDS_pept        513857..514786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshb"
FT                   /locus_tag="WRi_004730"
FT                   /product="glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004730"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95258"
FT                   /db_xref="GOA:C0R2W6"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2W6"
FT                   /protein_id="ACN95258.1"
FT                   /translation="MKVAFQMDENINFETDTTFVLIKEAQRRKHEVFVYAPNNLALKLN
FT                   HPIALAQKVSVDDFSFISKEDVAINLNEMDIIFIRQDPPFDMRYITTTYILEKTSALVI
FT                   NNPTEIRNCPEKLITSLFPELIPPTLITENISMIRDFYYNYQDIILKPLYSYGGNDVIR
FT                   IQDENSIQVVVDLMIAKYECPVIAQSFCKNIDKDKRILLLYGQPIGVMKRIPKISGEIR
FT                   TNMRLGASFEPAQMNDRNNEICNKIGPELKKRGLIFVGIDIIDDFLLEINTTSPTGVVY
FT                   INKLYNISLEKDLWDVFEEKASSHQLNL"
FT   gene            complement(514771..515802)
FT                   /gene="murG"
FT                   /locus_tag="WRi_004740"
FT   CDS_pept        complement(514771..515802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="WRi_004740"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape
FT                   ptide) pyrophosphoryl-undecaprenol N-acetylglucosamine"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004740"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95259"
FT                   /db_xref="GOA:C0R2W7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2W7"
FT                   /protein_id="ACN95259.1"
FT                   /translation="MDIILATGGTGGHIFPAIALAKALKTQGYNCILFTDKKTNKNTDI
FT                   ESYTLPLRRPSSNKFKFFLFLIYSSMLALYQVRKLKPKSVIGFGSYASFPTLLAARVLS
FT                   IPIILHEQNTVLGRVNRFFFKSAKLIATSFPETKYAEGNKCIFTGNFVDIKAQSHSSTE
FT                   KILNILVIAGSQGANFFDDVVSSVICDLPIKMKKKIRVTQQCTKKNVNKVKSLYKSEKI
FT                   DCELSEFFDDMENRLANAHLVISRAGATSIAEITLARRSAIYIPYPYSKDNHQFYNAKY
FT                   IEDSRAAIIVKQNSEAKKNLTEVLFDLLNNSQKLRDMTNSTEKTGIKNGTTEFVKVIVH
FT                   RFS"
FT   gene            515872..516264
FT                   /locus_tag="WRi_004750"
FT   CDS_pept        515872..516264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004750"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95260"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2W8"
FT                   /protein_id="ACN95260.1"
FT                   /translation="MIVELKMPKSNSKKEPNEKNKPQEQREGRSGGFLELLKNIIKILF
FT                   NSVVDLPEHEQHNKMKSTNLQQGLDTKGKGPEDLHPKAKLEVKEAAKGLKEELQNSDAG
FT                   GNQSIETKVPNQTTTQDIDNSKTMER"
FT   gene            complement(516270..517643)
FT                   /locus_tag="WRi_004760"
FT   CDS_pept        complement(516270..517643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004760"
FT                   /product="Dihydrolipoamide dehydrogenase E3 component"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004760"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95261"
FT                   /db_xref="GOA:C0R2W9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2W9"
FT                   /protein_id="ACN95261.1"
FT                   /translation="MNEYDITVIGSGPGGYIAAIRAAQLGFKTAIVEKEKNLGGICLNW
FT                   GCIPTKSLLRASEVYRLIKRSKEFGIEVKGANFDIQSIVKYSRNVVDKLSSGVAYLMKK
FT                   NNIKVHQGFGKLAGNGTIKVAGDKEEQEIVSKHIILATGVRARNLPGIEADGDLIWNAQ
FT                   HAMTPERLPKSLLIIGSGAIGIEFASFYSTLGVDVTIIEIKSTILPLEDKDISDLAQEI
FT                   FTKQGIEIYTSSSVKALTKSKDSAQVLLSSGESKEFERVIVAVGIQANIENIGLENTKI
FT                   KLSPSGFIETNEWYETSESNVYAIGDVAGPPCLAHKASHEAVICIEKIAGKNAHALKKE
FT                   CIPNCTYSHPQIASIGLTEEQAIKGGYDIKIGKFHSNFNGKSVALSETEGLVKTIIDKK
FT                   TGEILGSHMIGAEVTELISNFALVKQLEGTDFDIKSTIFPHPTISEMIHESVLAADVK"
FT   gene            519381..520979
FT                   /locus_tag="WRi_004770"
FT   CDS_pept        519381..520979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004770"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95262"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2X0"
FT                   /protein_id="ACN95262.1"
FT                   /translation="MEKYTNAWFNKKDNHDCANDGTCGQSITDFRIGNTDISFFDSNKN
FT                   LIAKVPKLPKYSRDKYGHQLYKEAESKQFNYFSTNIHDVLSNSFTVKYGYINCTIKYDN
FT                   LSEQEQNQIETDIKTAYEAFKEKFCFKDSSIIKDITVYIFNNRSDYTKYNNLLGIDEDG
FT                   GPGYITRGVTDCQNILTYKQSAMDFVLGHELGHIFQLRFSPSATVKDLSTQDTELIANV
FT                   VGREVEEKNYKAICKQMGVDEYKYDGWSFIFKYIGTTGSVYRLNLSEEEKFQIIQRVKS
FT                   SGLDEYEDHGWMFKFKYKDTTGSIYLKDLSEAEKFQIIQRVKNSGLDEYEDRESMFSFK
FT                   YKGTTYRAEHRDYLSAEEEKLQFIKDIKNSHESLVSECDGLGNENTTLVIYVDENKEIS
FT                   QMYFHNLDKNIFKWLDKTLISRSKPEEDVDDTAGKEPEPESAEEDTQQPSNFLSNIFST
FT                   IKSIIDSISSLFSWLFGSKEKESNQQSDDNPSLFKLDANELDHEVKPDANELGHDVRDH
FT                   LSDNYNHYNSSDGLM"
FT   gene            521229..522161
FT                   /pseudo
FT                   /locus_tag="WRi_p04780"
FT                   /note="transposase, degenerate; ISWpi9"
FT   gene            complement(522455..525379)
FT                   /locus_tag="WRi_004790"
FT   CDS_pept        complement(522455..525379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004790"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95263"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR039441"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2X1"
FT                   /protein_id="ACN95263.1"
FT                   /translation="MLKKITVLFSVALLFILCFFIFLKPLEININYINFYVKHKISKIF
FT                   VGSSVNMENTSVVWQKDGKDPYLVITDLAIANPNFTIKVPELFVHFKLSSLFKASTNLS
FT                   QVSADNVHVCINQKEADFKTVNFNLQNSVKTIREFFFDLNADSKIEFTNIAIDKSTEDE
FT                   FFIDRLYIGKGEDFNVLDIHVNTKDEKGFLDDLSITIKNRNNLLNVYGTFYDLKLGLLS
FT                   EFSTLVKSYNLDKNIGFKGSFSVKINKKDEIVDGNIYVLNTENYLNKNLALTNVNINLT
FT                   YSDGIISVKNFHFKLNGTYLSLIGKMNFSTSHALLRINISKFAAKDLCTYVPDGVVNSK
FT                   FKSWYCDNIDGDVLNTIVSFNGKLVDDDLSDIVIVADIENGSVKFDEDFEQVKELKGDL
FT                   IIKNNDLEITVNSAKFQNFTVNGGDIEMKSLNKENSVLTINGQAVSDAYGLYEPIRFKL
FT                   DDVVKVERDKVSGMAKSVFNFRIFNLNADDKKVDFSANFHSEIDNLAVYNASLGKYDIK
FT                   LSFGSDFIDLNGSGMVNNTQLLFDLKSSNRNESFAWNLTGDLPAQIFNFDSGYVSANLE
FT                   SVINQDKTGYVNGDIDLSEFESHSSYLGWKNRFEDHNKILFSTRLKGAGELLVDKLDIV
FT                   GNDLDIKFSGRVENGNLYLNSSSFKLPDNDFSIEIESGKEKNAITIYGEEINLSDILGL
FT                   LGKNSNGLNKDIEISMNVDNVIMKEGIVIKNAKLNVTCTKGNCKGSQFTGQFLEDSSNI
FT                   LAEYSGIGLEIYADNSGMLLRSLGISKSIKNGKLSFYLSPQRESGEHYGTLSISNFYIK
FT                   DAPLLTTLLSMSSLPGIVNAIKNEGVYFYKCNAPFSYKDGTIEIEESWLEGAELGISTG
FT                   GKLDIRNYKFQVAGQVIPAYSINKSLLKIPIIGKLLTGGKSRGIVSIDYKASGDDKNNN
FT                   VSVDLISSLTPNLLKRLLGVFDRIMTKTNESGLKGGVKKKFGSI"
FT   gene            complement(525372..525809)
FT                   /gene="rnhA"
FT                   /locus_tag="WRi_004800"
FT   CDS_pept        complement(525372..525809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="WRi_004800"
FT                   /product="ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004800"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95264"
FT                   /db_xref="GOA:C0R2X2"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2X2"
FT                   /protein_id="ACN95264.1"
FT                   /translation="MSKKEVAIYTDGACSGNPGAGGWAAIILFQDYRKDIYGREENTTN
FT                   NKMELTAVINGLKVLKFSCNINLYTDSLYVKHGITEWINKWKMNGWKTSNKKSVKNMEL
FT                   WKELDNVASQHEIDWKWVKAHSGDKYNEEADSLARKAIIDA"
FT   gene            complement(525986..526873)
FT                   /gene="ctaB"
FT                   /locus_tag="WRi_004810"
FT   CDS_pept        complement(525986..526873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="WRi_004810"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004810"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95265"
FT                   /db_xref="GOA:C0R2X3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2X3"
FT                   /protein_id="ACN95265.1"
FT                   /translation="MYTSVLLNVESTILDFWRLLKPRIMYLVVFTAVAGMVTAPGSMHP
FT                   FLALISLICVALGSGSAGAINMWYDRDIDLLMERTKNRPIPSGRVSAESALEFGITLGI
FT                   LSVFIMAIAVNYISAALLAVSILFYVFIYTIWLKRRTPQNIVIGGAAGAFPPMIGWAAV
FT                   TNSVSWESFILFLVIFMWTPPHFWALSLNKSEDYAKASIPMFNIVYGPEKTRKYILIYS
FT                   VLLVLTSLLPALFLKKALLYLSMAIFAGCIFIWYAISILRFKNHNSQKQMFSYSISYLF
FT                   SLFASIIFCSIDLF"
FT   gene            complement(526875..528425)
FT                   /gene="coxA"
FT                   /locus_tag="WRi_004820"
FT   CDS_pept        complement(526875..528425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="WRi_004820"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004820"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95266"
FT                   /db_xref="GOA:C0R2X4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2X4"
FT                   /protein_id="ACN95266.1"
FT                   /translation="MSDVPKGVKRWLFSTNHKDIGTLYIIFSILAGIIGGLLSVIIRTQ
FT                   LMHINILNNNYQLYNVMVTGHALIMVFFMIMPALMGGFGNWFVPLMIGAPDMAFPRMNN
FT                   LSFWLLVSSFILLILSVFIGEGPGTGWTLYPPLSQVMSHPSAGVDIAILALHVAGMSSI
FT                   VGAINFIVTIFNMRAKGMSLTKMPLFVWSVLLTAFMLIVALPVLAGAITMLLTDRNIGT
FT                   SFFDPAGGGDPVLFQHLFWFFGHPEVYVIIFPAFGIISQVVSTFSHRPVFGYIGMVYAM
FT                   IGIAVFGFMVWAHHMFTVGLSADAAAFFSTTTIFIGVITGVKVFSWIATMWGGAIEFKT
FT                   PMLFALGFIFMFVGGGITGIILSHGGIDKLLHDTYYVVAHFHYVMSLAALFGAFAGFYY
FT                   WIGKMSGKQYNERLGQIHFWLTFISTNITFLPQHFLGLAGMPRRIPDYPDAFIPWNYIS
FT                   SIGSYMSFVSVMFFVFIVIHLFKWGKKAGDNPWGGDTLEWTVSSPPPFHTFEKPPVVK"
FT   gene            complement(528441..529205)
FT                   /gene="coxB"
FT                   /locus_tag="WRi_004830"
FT   CDS_pept        complement(528441..529205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="WRi_004830"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004830"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95267"
FT                   /db_xref="GOA:C0R2X5"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2X5"
FT                   /protein_id="ACN95267.1"
FT                   /translation="MVKLFALLIIFYSNISVASAPTSWQFGFPAPATEVMEAVVRSHSF
FT                   VMLVMVTIMLFVWALLAYIAFRFRKSKVTNISKTTHSVPLEIIWFVIPTIIVGILAFEN
FT                   AKLLKLQEEIPKADITLKVIGHQWYWSYQYPEYQGVSFDSYIKGKEDFIEGDLKLFSVD
FT                   NNIVLPINTNVRLQVTAGDVIHSWGVPAFGVKIDAIPGRLNEAWFNIKKSGVYYGQCYE
FT                   LCGQGHGFMPIVVEAVSKEDFNKWIENRKLVS"
FT   gene            complement(530906..531629)
FT                   /pseudo
FT                   /locus_tag="WRi_p04840"
FT                   /note="transposase, degenerate; ISWpi3"
FT   gene            complement(531772..533364)
FT                   /locus_tag="WRi_004860"
FT   CDS_pept        complement(531772..533364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004860"
FT                   /product="secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004860"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95268"
FT                   /db_xref="GOA:C0R2X6"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2X6"
FT                   /protein_id="ACN95268.1"
FT                   /translation="MECLNYRFFVFVCYLELTQIHSSIMISKLKKLSAGFSLTGLIGHG
FT                   DNINMQGAKNKKKKYPKFLDKTFALIDAVINFILKRESNNVNEVLKVTWGPLFFGLVVI
FT                   LIFFGIGGIWSAIAPIDGAVHASGEVIVSSNRKIVQHLGGGIISKILVKESQAVKKDEP
FT                   LVLLSDVNEKANLSIIKEKLLSFLATEARLLAIRVDLDTLEFSDEVKKLSNDELVNKVI
FT                   KNQVKLFNSQRKSILGKTDILQQRIKQLNDELAGLNFQLNAAHKQYDLITEELETKRQL
FT                   LDSGHISKPHILALEKQFAEIEGRVGHYRSAISQVQQKIGENELEIINVKNDSQERANA
FT                   ELKEVSTSIADLKERLMVAEDSLARTIIKSPQDGIVTDIRYHTEGGVIQSGVPIMSVVP
FT                   SDDDLIIDAKIQTRNIEEVLSAQKKDSNIVSIDGLEGLKVKVRLSAYSARRLSLISGIV
FT                   SHISPDALDDPRLGRYYSVRVVIPKSELAQFKNVYLYPGMPAEVYIVTQSRTLLSFLFT
FT                   PIIATVDRSFIER"
FT   gene            533559..534293
FT                   /gene="fabG"
FT                   /locus_tag="WRi_004870"
FT   CDS_pept        533559..534293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="WRi_004870"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004870"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95269"
FT                   /db_xref="GOA:C0R2X7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2X7"
FT                   /protein_id="ACN95269.1"
FT                   /translation="MFGLESRKFLITGASGGIGQAIVKIMHKAGATLCISGTKKEVLEE
FT                   VAKQYEKNIHILPCDLSNAEEVNQLINRASELMEGFDGLVCNAGITRDSLLLRMTDEIW
FT                   QKVIDINLSSTFKLSREACKRLIKNNWGRIINISSIIGLTGNAGQANYAASKAGIIAMS
FT                   KSIAKEVASRNITVNCIAPGFIDTKMTEVLNEVQKGKILDNIPMKRMGTGEEIAAGVLF
FT                   LASDEAKYITGHVLNINGGLFM"
FT   gene            534389..534724
FT                   /locus_tag="WRi_004880"
FT   CDS_pept        534389..534724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004880"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95270"
FT                   /db_xref="GOA:C0R2X8"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2X8"
FT                   /protein_id="ACN95270.1"
FT                   /translation="MSSIIGFFGVLCVVLLFSFSGYADNPGVDMDDTTKVICNIIGYVW
FT                   GIGGPLMTVVIIGAALLAIFGRMPWPALFALGMFCGVFFGAKTIITKIMPNVSDEAKTM
FT                   LEKCGQK"
FT   gene            complement(534752..536032)
FT                   /locus_tag="WRi_004890"
FT                   /note="contains TPR repeats"
FT   CDS_pept        complement(534752..536032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004890"
FT                   /product="peptidase, M48 family"
FT                   /note="contains TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004890"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95271"
FT                   /db_xref="GOA:C0R2X9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2X9"
FT                   /protein_id="ACN95271.1"
FT                   /translation="MFRVAKFLTLLFFFAYCNNAYSINIIRDSEVEAIVKELAQPLFSA
FT                   ADIDHEQIKVFIINDNSINAFVINNNSIFIHLGLLQYSAKPYVLLGILAHEIAHISAGH
FT                   ILQMSSAMGYFQSIAMISYMVGLVSSIIINPQVAGAILLSGVAFSSRLFFNYSQEQESV
FT                   ADSYALRYLDESGYDNSGMKEIFDYFKSIEHENTEEYFRTHPLSEKRIFAVQNYKVKNN
FT                   VKPIFADKLLKFERVVAKLDSFFAPIHVLSNKYEDNSEYVNAIVCYRQGKIEEAIAKVN
FT                   SLIQESHSDPYLYELKAEMLYKAGNLSEAIKMYEESLRYLSEKNSYLVKLALSHTLLLH
FT                   GDAKKAIFYLEQILNVEPNNAFVWKYLSIAYKCEADTAMHYFALTKKACIEGDLKQFMK
FT                   YAELAVKTLPKDSPYLLQVEDMKRFNG"
FT   gene            complement(536104..536748)
FT                   /locus_tag="WRi_004900"
FT   CDS_pept        complement(536104..536748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004900"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004900"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95272"
FT                   /db_xref="GOA:C0R2Y0"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Y0"
FT                   /protein_id="ACN95272.1"
FT                   /translation="MVQATYASMSLPGISSVEDVLEDARSGKLFILVDDENRENEGDLI
FT                   VLAEKIKPEHMAFMVRYGTGVVCLAMTKFHMKRLGLNFMEKKNIGENHTAFTTSIDARY
FT                   GITTGVSAEDRTKTIHAAINKDGTQDDIITPGHVFPVIAHKGGVAQRAGHTEASVEMAK
FT                   LVGFDHSAVICELVNDDGSMMRLPQLLKFAEQHKIKLTTIDKLISYVKNLN"
FT   gene            complement(536755..537249)
FT                   /gene="greA"
FT                   /locus_tag="WRi_004910"
FT   CDS_pept        complement(536755..537249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="WRi_004910"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004910"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95273"
FT                   /db_xref="GOA:C0R2Y1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Y1"
FT                   /protein_id="ACN95273.1"
FT                   /translation="MASSIINKFPMTREGFENMQAELEKLKEEKPSVIQAISDARDQGD
FT                   LSENAEYHAARERLGFIEGRIMEIESKLSHAEVIEVKNLSGDSVMFGATVTLSMLSDNN
FT                   GEVEYVYKVVGEYEADVSKQLISTSSPLGSALIGKKVGEYVEVTVPNGEKLYKIVKIEF
FT                   K"
FT   gene            complement(537259..538800)
FT                   /gene="atpA"
FT                   /locus_tag="WRi_004920"
FT   CDS_pept        complement(537259..538800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="WRi_004920"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004920"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95274"
FT                   /db_xref="GOA:C0R2Y2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Y2"
FT                   /protein_id="ACN95274.1"
FT                   /translation="MKNSMNVSEIASIIREKVETFDNPIKRENIGEVISVTDGIALVYG
FT                   LEKAKFGEKVFFASGVEGIVLDLDHDTAGIVVLGNDRDVKEGDVVKCSGDVVQVPVGHE
FT                   LLGRVVNALGHPMDDGGEIRAKNRMDIESKAPGIIDRKSVHEPLQTGIKIIDLLIPIGR
FT                   GQRELIIGDRQIGKTTIALDTIINQKKINDEVNENQKVYCVYVAIGQKISTVAKVVNKL
FT                   KESGALEYTTVVVASASDCAPMQFLAPYAGCTIGEFFRDNGMHCLIIYDDLSKHAVAYR
FT                   QMSLLLRRPPGREAYPGDIFYVHSRLLERAAKMSDKKGQGSLTALPIVETQAGDVSAYV
FT                   PTNVISITDGQIFLESELFYKGFRPAVNIGLSVSRVGSAAQLKSVKKVAGSIKLSLAQY
FT                   RELEDFAKFGSDLDASVQLSLNKGKYLVELLKQKQHLPMSIEEQVVLMYIFSNLYNQLS
FT                   KIQISYINKFEHDLINYFHTVHPGVLKKLSNDMSDDIKGDIFNIVSNFVTQFNCV"
FT   gene            complement(538797..539357)
FT                   /gene="atpH"
FT                   /locus_tag="WRi_004930"
FT   CDS_pept        complement(538797..539357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="WRi_004930"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004930"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95275"
FT                   /db_xref="GOA:C0R2Y3"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Y3"
FT                   /protein_id="ACN95275.1"
FT                   /translation="MKKTQYNNLVSSYARVLFHVSGSRLGIIREEVEFLLAFFKDQRDV
FT                   FVYLSHPMISFAHKKEVMLSINEHLSENLVKFIMVIFANKRSSLLILILEKFLSLAREN
FT                   ENEFEITIKSAETLKESDIKIITESLSFLGKIIKVSNVVDPSILGGFVVRYGFNLIDAS
FT                   LKSYLDRLVDLSKMEILKVRNFV"
FT   gene            complement(539399..539749)
FT                   /locus_tag="WRi_004940"
FT   CDS_pept        complement(539399..539749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_004940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004940"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95276"
FT                   /db_xref="GOA:C0R2Y4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Y4"
FT                   /protein_id="ACN95276.1"
FT                   /translation="MVSRLRYFVGYFGELLVLVYLKLKWYNVIKRRYRCKFGEIDLIVS
FT                   KKKELIFIEVKTSLLGKEIPISHLQCQSIINSSKYFLSKNLSFLDYSVRYDLYFLSLKR
FT                   RPVYIKNAWIEE"
FT   gene            complement(539773..540201)
FT                   /gene="rplQ"
FT                   /locus_tag="WRi_004950"
FT   CDS_pept        complement(539773..540201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="WRi_004950"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004950"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95277"
FT                   /db_xref="GOA:C0R2Y5"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Y5"
FT                   /protein_id="ACN95277.1"
FT                   /translation="MKHGIKKRKLSRCTEHRLSTLKNLSISLINHEQIVTTLPKAKELR
FT                   PYVEKFITIAKNKNTLHGRRLLLSRLHNSKLAVDKLLNVLASRYQDRKGGYSRIIKFST
FT                   RKGDCASMAVIELVDRDIAARGKVYSKNKEGGKVVTQS"
FT   gene            complement(540209..541276)
FT                   /gene="rpoA"
FT                   /locus_tag="WRi_004960"
FT   CDS_pept        complement(540209..541276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="WRi_004960"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004960"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95278"
FT                   /db_xref="GOA:C0R2Y6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Y6"
FT                   /protein_id="ACN95278.1"
FT                   /translation="MYYNNDVSLCSNLDKLIKPSSVKVISDDSSEKSDIVLEPLESGFA
FT                   LTLGNALRRVMLSSLKGSAVYGIKIEGVTHEFTSIQGVREDVTDIVLNMGMLRCKLNGA
FT                   SNKCLNLNAKGPCQVLAGMIETDDQCSIVNKDLLICTLGQNVELNMTIYVASGKGYLPV
FT                   TKYKENELLKLMSEQDLIGFIPVNALYSPVNRVSYRVENSRVGQVTDKDKLILSIETDG
FT                   TISPSQAVDSAARILQEQLQPFISSDVSYKKSQVSSSSGAKDLGYDPVLLRKVDEMELS
FT                   VRSHNCLKNENITYIGDLVQKTEGEMLRTANFGRKSLNEIKAVLTNFGLSLGMNVLNWP
FT                   PKDIDELAKQHTDED"
FT   gene            complement(541298..541684)
FT                   /gene="rpsK"
FT                   /locus_tag="WRi_004970"
FT   CDS_pept        complement(541298..541684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="WRi_004970"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004970"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95279"
FT                   /db_xref="GOA:C0R2Y7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Y7"
FT                   /protein_id="ACN95279.1"
FT                   /translation="MKKVKTVGKSKKEFITGVVHIRATFNNTFVNVTDVHGNTLCQTSV
FT                   GACGFSGSRKSTPYAAGKAAEAAAKNAIERFGMKVVSVIIRGPGFGTEAAVKALQSCGL
FT                   TVTSIADKTAIPHNGCRLRKKRRV"
FT   gene            complement(541709..542047)
FT                   /gene="rpsM"
FT                   /locus_tag="WRi_004980"
FT   CDS_pept        complement(541709..542047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="WRi_004980"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004980"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95280"
FT                   /db_xref="GOA:C0R2Y8"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Y8"
FT                   /protein_id="ACN95280.1"
FT                   /translation="MRKCVPFALTYIYGIGIATANVICHACEVDKRKRVSELRDEDIEK
FT                   ISSFIRQNYVIEGELRKEVAMNIKSLVEMGCYRGVRHRKGLPVRGQRTHTNAKTRKGRS
FT                   RLPIAGKK"
FT   gene            complement(542137..542778)
FT                   /gene="adk"
FT                   /locus_tag="WRi_004990"
FT   CDS_pept        complement(542137..542778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="WRi_004990"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_004990"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95281"
FT                   /db_xref="GOA:C0R2Y9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Y9"
FT                   /protein_id="ACN95281.1"
FT                   /translation="MIITIFGPPGSGKGTQSSLLIAKYNLKLISVGDLLRNIISSSSEL
FT                   GKKIKGTVESGNLIQDEIICGLLRDQLALVDDNCLLDGFPRNLNQAHFLTQVLQEKYNR
FT                   DVDIVVELQLDDNIAIDRLKNRLACLDCKSIYSVSSFKSTTCAKCKSTRLEKRIDDADM
FT                   SAINKRISEYHLQMKGLREYYKGKLLTIDANLSVDEVTQEIESKISCNLV"
FT   gene            complement(542775..544103)
FT                   /gene="secY"
FT                   /locus_tag="WRi_005000"
FT   CDS_pept        complement(542775..544103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="WRi_005000"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005000"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95282"
FT                   /db_xref="GOA:C0R2Z0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Z0"
FT                   /protein_id="ACN95282.1"
FT                   /translation="MGNKSAFNSLDPTLLYKGDLLKRIFFTLIALICYRLGTYVPIPGI
FT                   NLDVINDIFPKDGSGVFGVFNLFSGGALARMTILALNVMPYIMASIIIQLLSSAIKGMK
FT                   EVKNDGESGRRKMNSYIRYLTIVICVFQSIPILVGLEGMNREGVLVVIEPGVMFRTIGV
FT                   FSLLGGTMLLIWLGERISASGIGNGISLIIFTGIISELHSALSSLLTLNKNGSVSLFII
FT                   LFVLVLFFLLLLLVIFVESSYRKVIVQHPKKQFKRLHNDDFTYIPLKINLSGVVPTIFA
FT                   NAILLTPISIANFYKGHAFSDFILNYFMANKVVYIVAYLVLIVFFNFFYTNFIFNPEEN
FT                   ADFLKKNGGFIPGRRPGKHTSDYLQDIVFKLTFIGSAYLVVICTVPEVMRYYYDIPFIF
FT                   GGTSLLIIVNVITDTIMQIQSYIFSNRYDNWIKKYESKTRKVR"
FT   gene            complement(544107..544577)
FT                   /gene="rplO"
FT                   /locus_tag="WRi_005010"
FT   CDS_pept        complement(544107..544577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="WRi_005010"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005010"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95283"
FT                   /db_xref="GOA:C0R2Z1"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Z1"
FT                   /protein_id="ACN95283.1"
FT                   /translation="MNNAVKLNSIFTKLSKKKKPKLLGRGIGCGKGKTSGRGHKGQKAR
FT                   SGVSINGFEGGQQSIYTRLPKRGFKPIRRSIYSIINVGDIQRLMEAKKIVKDSVIDKER
FT                   LYKLGFIKSIKDKIKLLNKGKLSEKFVFHVDFASEAAKKSVASVGGSVEILS"
FT   gene            complement(544581..545093)
FT                   /gene="rpsE"
FT                   /locus_tag="WRi_005020"
FT   CDS_pept        complement(544581..545093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="WRi_005020"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005020"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95284"
FT                   /db_xref="GOA:C0R2Z2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Z2"
FT                   /protein_id="ACN95284.1"
FT                   /translation="MAIKNLQNNNDLSELLVSVRRVTTVTKGGRRFSFSILVVVGDEKG
FT                   RVGCGIGKHAEVAEARVKAVNAAKKSMIRVYLREGRTLHHDIKAKFCSGEIVLRTARAG
FT                   TGIIAGGAIRSVFEVLGIKDVVAKSTRSNNPHNVICAVFKAFDSMLSPRQVASKRGKKI
FT                   SEIVGNR"
FT   gene            complement(545106..545477)
FT                   /gene="rplR"
FT                   /locus_tag="WRi_005030"
FT   CDS_pept        complement(545106..545477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="WRi_005030"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005030"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95285"
FT                   /db_xref="GOA:C0R2Z3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Z3"
FT                   /protein_id="ACN95285.1"
FT                   /translation="MKRSYNFLSNSEKRKLRNRAKLDKSAERLRISIFKSNRHFYVQLI
FT                   NDVKGITLTSASTLDAKIKDVCKGKVNAETIKQVSSLMVERLSGMKLEQQLTFDRGAYK
FT                   YTGLVSQFAEALRSSGFEF"
FT   gene            complement(545483..546028)
FT                   /gene="rplF"
FT                   /locus_tag="WRi_005040"
FT   CDS_pept        complement(545483..546028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="WRi_005040"
FT                   /product="ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005040"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95286"
FT                   /db_xref="GOA:C0R2Z4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Z4"
FT                   /protein_id="ACN95286.1"
FT                   /translation="MSRIGAAPINIPAGVSVEYNNGSMLIKSAKAEKEVSLIRDVVCQI
FT                   IDNQLLLSVDQDKDNYDKIKPMWGTYRSNINNIINGMVDGFSVNLEINGVGYKAECDGK
FT                   YLTLYLGYSHNVKYKVPKDVEIKCIKPTHLVVSGMDKQKVYMVASDICKIRKYDPYKGK
FT                   GVVIKGKFMLRKVVSKKK"
FT   gene            complement(546045..546440)
FT                   /gene="rpsH"
FT                   /locus_tag="WRi_005050"
FT   CDS_pept        complement(546045..546440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="WRi_005050"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005050"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95287"
FT                   /db_xref="GOA:C0R2Z5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Z5"
FT                   /protein_id="ACN95287.1"
FT                   /translation="MALSDSIGDFLTRIRNAQLAMHRATRVLFSKMNSSILEILKEEGY
FT                   ILDYEKQVVDNLPSFIVKLKYYEKSPVISDIVRVSKPGCRRYSKYKDISKAYNGLGIFI
FT                   ISTPKGVMTDYNAHKLKVGGEVLCRVF"
FT   gene            complement(546462..546770)
FT                   /gene="rpsN"
FT                   /locus_tag="WRi_005060"
FT   CDS_pept        complement(546462..546770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="WRi_005060"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005060"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95288"
FT                   /db_xref="GOA:C0R2Z6"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Z6"
FT                   /protein_id="ACN95288.1"
FT                   /translation="MAKKSMIERNLRRIKLCDQYKEKREKLKSIINNKNLSIVERFTAQ
FT                   NKLIKKLPRNSSKTKIRNRCALTGRPRGVYRKFGLCRIVLRDLCSFGQIPGVTKSSW"
FT   gene            complement(546787..547320)
FT                   /gene="rplE"
FT                   /locus_tag="WRi_005070"
FT   CDS_pept        complement(546787..547320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="WRi_005070"
FT                   /product="ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005070"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95289"
FT                   /db_xref="GOA:C0R2Z7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Z7"
FT                   /protein_id="ACN95289.1"
FT                   /translation="MFKELYKDSIVKSLKDKFNYGNIMQVPKLVKVCINMGVGDAATDS
FT                   KAINEPLDSLYLIAGQKPLSTFAKKSISGFKIRKGATVGCKVTLRRDKMYEFLERLIYI
FT                   ALPREKDFRGFSVKQFDGNGNFSFGIKEHISFLEIDYDKISKIRGMDINIITSAVSDKE
FT                   AKELLLALKFPFFD"
FT   gene            complement(547327..547644)
FT                   /gene="rplX"
FT                   /locus_tag="WRi_005080"
FT   CDS_pept        complement(547327..547644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="WRi_005080"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005080"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95290"
FT                   /db_xref="GOA:C0R2Z8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Z8"
FT                   /protein_id="ACN95290.1"
FT                   /translation="MSAKIKSGDDVIVLTGKDKGKIGKVIKVIARDAKKKVIVSGVNVH
FT                   KRHTKPKAGSSGGILNKELAIDISNVATLDPKYKTPTRVGFKVIDGRKVRFAKVSGEVI
FT                   D"
FT   gene            complement(547644..548003)
FT                   /gene="rplN"
FT                   /locus_tag="WRi_005090"
FT   CDS_pept        complement(547644..548003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="WRi_005090"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005090"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95291"
FT                   /db_xref="GOA:C0R2Z9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R2Z9"
FT                   /protein_id="ACN95291.1"
FT                   /translation="MIQKNTLLEVADNSGARAVLCIGLLGGRKSASIGDTVIVSTKSIT
FT                   PRGKVEKGKVYRAVVVRVKSPIRKSDGSVIRFSSNAVVLINDQGEPLGTRVFGPVKKLS
FT                   SGSFMKIMSLAVEVL"
FT   gene            complement(548017..548253)
FT                   /gene="rpsQ"
FT                   /locus_tag="WRi_005100"
FT   CDS_pept        complement(548017..548253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="WRi_005100"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005100"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95292"
FT                   /db_xref="GOA:C0R300"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R300"
FT                   /protein_id="ACN95292.1"
FT                   /translation="MPKKVFCGTVTKAKCDKTVKVSVLQVYKDELYKKVIKKYKKYTAH
FT                   DENNSCKEGDKVLIQEHKPISTTKKWVIVNSSH"
FT   gene            complement(548246..548449)
FT                   /gene="rpmC"
FT                   /locus_tag="WRi_005110"
FT   CDS_pept        complement(548246..548449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="WRi_005110"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005110"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95293"
FT                   /db_xref="GOA:C0R301"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R301"
FT                   /protein_id="ACN95293.1"
FT                   /translation="MDIADIESRSSQELHEILVNLRKEFVNLVFQKKLGQCNNISRFSL
FT                   IRKSIARILTTLNKRRREEKNA"
FT   gene            complement(548461..548874)
FT                   /gene="rplP"
FT                   /locus_tag="WRi_005120"
FT   CDS_pept        complement(548461..548874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="WRi_005120"
FT                   /product="ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005120"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95294"
FT                   /db_xref="GOA:C0R302"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R302"
FT                   /protein_id="ACN95294.1"
FT                   /translation="MFIPKKSKYKKVFKGRIKGNTKGGSTLSFGDYGLKAMEAGRIQSK
FT                   HIETARRVISRTLKRSGKVWIRIFPDTPVSKKPADVRMGKGKGSVEFWVFKAKPGRMLF
FT                   EISSDVPMHLARLALEKATAKLPMKCKFVSNHN"
FT   gene            complement(548889..549503)
FT                   /gene="rpsC"
FT                   /locus_tag="WRi_005130"
FT   CDS_pept        complement(548889..549503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="WRi_005130"
FT                   /product="ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005130"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95295"
FT                   /db_xref="GOA:C0R303"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C0R303"
FT                   /protein_id="ACN95295.1"
FT                   /translation="MGNVNPKGFRLKIINTWSSIWYAEKGYKQGLHQDLSIRSYINESF
FT                   KHAGVSKVIIERTIDLVSVIIHSSRPGVIIGKKGSDIEKIKQKIAEKVKNNVEVNVVGV
FT                   KRSEIDAVLISNSIAQQLEKRVSFRRAMKKAIQSCLRMGARGIKVSCSGRLGGAEIART
FT                   EWYKEGRLPLHTLRANIDYAFAEAKTIYGIIGVKVWVYIGN"
FT   gene            complement(549543..549890)
FT                   /gene="rplV"
FT                   /locus_tag="WRi_005140"
FT   CDS_pept        complement(549543..549890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="WRi_005140"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005140"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95296"
FT                   /db_xref="GOA:C0R304"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R304"
FT                   /protein_id="ACN95296.1"
FT                   /translation="MKNRDVIVKAGSRVLKSTPRKLNLVAGLVRNKKVSFATVQLRFCE
FT                   KKAAGLIRKVLNSAIANAQNYGLDIDNLYIKEILIGKSLTLRRVCPKAMGRANRVSKRY
FT                   SNITVKLGEII"
FT   gene            complement(549896..550180)
FT                   /gene="rpsS"
FT                   /locus_tag="WRi_005150"
FT   CDS_pept        complement(549896..550180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="WRi_005150"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005150"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95297"
FT                   /db_xref="GOA:C0R305"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R305"
FT                   /protein_id="ACN95297.1"
FT                   /translation="MSRSAWKPPFCHPSILKSVNNALNKGFVNMAIKVHSRASVILPNC
FT                   LGLKFAVYNGKDYIPVNVNDQNMIGHKFGEFSPTRKFTGHSGDKKATRR"
FT   gene            complement(550184..551008)
FT                   /gene="rplB"
FT                   /locus_tag="WRi_005160"
FT   CDS_pept        complement(550184..551008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="WRi_005160"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005160"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95298"
FT                   /db_xref="GOA:C0R306"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R306"
FT                   /protein_id="ACN95298.1"
FT                   /translation="MGMKFFNPVTPSSRGTVLVSKVGLSKDEPEKSLTSGKKSSGGRNN
FT                   HGRITTRHRGGGHKKKYRVIDFKRNRSGQGIVEKIEYDPNRSGFLALISYKEDDIKSYI
FT                   LAPQGMKPGDVVTAGNDADILPGNCLLLKHIPVGSFVHNVELKPGNGAAIARAAGCYAQ
FT                   IVGRDGQYVLLRLRSGQIRLILSSCKATIGVVSNPDHKNRKLGKAGRSRWLGIRPTVRG
FT                   VAMNPVDHPHGGGEGKTSGGRHPVTPWGVATKGKKTRKRNKSSDKYIKQLKG"
FT   gene            complement(551010..551297)
FT                   /gene="rplW"
FT                   /locus_tag="WRi_005170"
FT   CDS_pept        complement(551010..551297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="WRi_005170"
FT                   /product="ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005170"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95299"
FT                   /db_xref="GOA:C0R307"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C0R307"
FT                   /protein_id="ACN95299.1"
FT                   /translation="MIKYNNIIKSPIITEKASFLREKFNKYSLYVFVNVNKRQIKLAIE
FT                   SLFDVKISSINVVRIKPKYRRFRGVIGCEKQKKKVYFSLMGGQKLDIMSV"
FT   gene            complement(551294..551908)
FT                   /gene="rplD"
FT                   /locus_tag="WRi_005180"
FT   CDS_pept        complement(551294..551908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="WRi_005180"
FT                   /product="ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005180"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95300"
FT                   /db_xref="GOA:C0R308"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R308"
FT                   /protein_id="ACN95300.1"
FT                   /translation="MECNLVNLSNDNVGTAQLNPLIFSAKQKLSILHDIVRWQLAKRRA
FT                   GTHKTKGISDVSGTTAKPYGQKRTGRARQGSLRSPQFRGGGIIFGPVVRSHTYSLNKKV
FT                   RKFGLKIALSLKYLNNQVIILDNLNIDVKKTSEMCKCIKNFKFSSFLIVGDYGDDLLRA
FT                   AKNLHYVDLIKPIGLNVFDILNHECVMLTKDTLKHLEGRLL"
FT   gene            complement(551911..552633)
FT                   /gene="rplC"
FT                   /locus_tag="WRi_005190"
FT   CDS_pept        complement(551911..552633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="WRi_005190"
FT                   /product="ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005190"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95301"
FT                   /db_xref="GOA:C0R309"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:C0R309"
FT                   /protein_id="ACN95301.1"
FT                   /translation="MKRINSLRRIGLLMMNIGHTAMYSDNSRMAVTLLHLSETYIIDIK
FT                   GQDKCGYNSVILGTGDFKNIAKPQLEYLKKKGINNKCKLYESRLNDLSGIECGKKVGIN
FT                   HFVVGQYLDITGYSIGKGFAGVMKRHNFSGLRASHGVSIAHRSQGSTGQCQDPGRVFKG
FT                   KKMAGHLGNSRITAQNMKILSIDHENSIIAVKGNNVPGFKNSYVFVRDAVKKSLHKDVP
FT                   FPVGLLLDVNDDASNLVS"
FT   gene            complement(552643..552963)
FT                   /gene="rpsJ"
FT                   /locus_tag="WRi_005200"
FT   CDS_pept        complement(552643..552963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="WRi_005200"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005200"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95302"
FT                   /db_xref="GOA:C0R310"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R310"
FT                   /protein_id="ACN95302.1"
FT                   /translation="MKQDIYINIKAFDCSLLEECVRKFVDELKRSSAKLSGPIALPRKD
FT                   SKFIVNRSPHVDKKSREQFEMRTSRRLIVLHDLTPTMMQMLTGLSFSAGVEVDLKVKEV
FT                   KV"
FT   gene            complement(552978..554150)
FT                   /gene="tuf"
FT                   /locus_tag="WRi_005210"
FT   CDS_pept        complement(552978..554150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="WRi_005210"
FT                   /product="Translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005210"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95303"
FT                   /db_xref="GOA:C0R311"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C0R311"
FT                   /protein_id="ACN95303.1"
FT                   /translation="MTAVVEAFGKPHVNVGTIGHVDHGKTTLTAAITKHYGNFVAYDQI
FT                   DKAPEERKRGITIATAHVEYQTEKRHYAHVDCPGHADYVKNMIVGAAQMDAAILVVSGV
FT                   DGPMPQTREHILLAKQVGVGYIVVYINKADVADADMMDLVEMEVRELLNKYGFPGDEVP
FT                   VVVGSALKALEDDSSEYGKKSIDKLMEKLDEYVAVPPRPVDLPFLLPIEDVFSISGRGT
FT                   VVTGRIEKGEIKTGEEIEIIGLKATQKTICTGVEMFKKLLDKGSAGLNVGILLRGTKRE
FT                   EVERGQVLAKPGTITPHRKFKAEVYILKKEEGGRHTPFFANYQPQFYLRTTDVTGSIKL
FT                   LDGKEMVMPGDNVSVEVELQVPIAMDKGLRFAIREGGRTVGSGVVSEILE"
FT   gene            complement(554229..554299)
FT                   /locus_tag="WRi_t05220"
FT   tRNA            complement(554229..554299)
FT                   /locus_tag="WRi_t05220"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGA"
FT   gene            complement(554304..554386)
FT                   /locus_tag="WRi_t05230"
FT   tRNA            complement(554304..554386)
FT                   /locus_tag="WRi_t05230"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   gene            complement(554501..555592)
FT                   /gene="carA"
FT                   /locus_tag="WRi_005240"
FT   CDS_pept        complement(554501..555592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="WRi_005240"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005240"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95304"
FT                   /db_xref="GOA:C0R312"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:C0R312"
FT                   /protein_id="ACN95304.1"
FT                   /translation="MQDAVLILQDGKCFWGKSIGKKGKCIGEVCFTTGMTGYQHTITDP
FT                   SFADQIITFTFPHIGNVGINHKDNEGKKIFASGVVMRELSSMSHPSSYISLNDWLEKNN
FT                   VIGISGVDTRALTRHLREHGSQNGMICSSSKAHALDKLKEYKSVNGIEITNKVSLHSNF
FT                   KSDLNAKYRVVIVDFGVKISIVSRLIELGCTVELIRPSTGFAQKVLSMNPDGIVLSNGP
FT                   GDPQEIGESVVSEIDIIIKSKIPIFGICMGHQLLAITLGAKTIKMDIGHRGSNHPVYDV
FT                   SSGKVGITSQNHGFVVDSASLPSNVEITHISLFDNSVEGIMMKDYSVFSVQYHPEEAPG
FT                   THDSHYLFRRFIDNIVLYKMKSA"
FT   gene            555798..556292
FT                   /locus_tag="WRi_005250"
FT   CDS_pept        555798..556292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005250"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95305"
FT                   /db_xref="GOA:C0R313"
FT                   /db_xref="UniProtKB/TrEMBL:C0R313"
FT                   /protein_id="ACN95305.1"
FT                   /translation="MNTGTNQSKKINEKWLAGGIGALLFVMMLPSILLLAKIAIGLIMV
FT                   SVAAIAIKVALKTISNALEDKQADQSQATQQTTQSKIINLAIGLTSIFVGGLSLFIIAQ
FT                   TGLIAACAAITALALHEYVKNQEIGKEINDKFDEVANSITNFIVSSVEKLISIKSPGIT
FT                   A"
FT   gene            complement(556835..557932)
FT                   /locus_tag="WRi_005260"
FT   CDS_pept        complement(556835..557932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005260"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95306"
FT                   /db_xref="UniProtKB/TrEMBL:C0R314"
FT                   /protein_id="ACN95306.1"
FT                   /translation="MVGLLFQLYNKVQSIIDPHDKKVQPIVDPRDKNATEGISQEKLIV
FT                   QEVSKDECMFDNNPEVQYILSDFDNLDFSNGPFNYSLYDINYNEGKEANPFDKIAKYYG
FT                   RKKNVFLFISMLQNSEQLEKIINIIGEKCNAQDRKKFTERLNIYLGRIREGDQDAKELL
FT                   NGDFPGAFFNGPHIGKNRNIHQNLNIKIKPGQTLEVSSLFNKKSELEREKIYNEKGQRI
FT                   ATIEKNEKQQRNYSFTKFAICDTEISWGAKDESEKGLNCAVVLNINLGQVSIKKSTIDG
FT                   KDVEPKKILELTKQNEAVLIKGKALHEVLAAHFIKQTPCEEKENIQPHENIIVPDSGAP
FT                   SSAIDEKITVEHPFGKAANKMDREE"
FT   gene            complement(558033..558971)
FT                   /gene="glpX"
FT                   /locus_tag="WRi_005270"
FT   CDS_pept        complement(558033..558971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="WRi_005270"
FT                   /product="Fructose-1,6-bisphosphatase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005270"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95307"
FT                   /db_xref="GOA:C0R315"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:C0R315"
FT                   /protein_id="ACN95307.1"
FT                   /translation="MLYLWFLKQMMEDLAYKLVKVTEAAALAAYKLAGFGDEKKADQVA
FT                   VDAMRTVLNSMEINGTIVIGEGERDEAPMLYIGEKVGTGNGPEIDIAVDPLEGTTICAH
FT                   YKSGAMSVLAATKKGNFLHAPDVYMEKIAVGKNLPEGVVSLKNSIEKNLDNLAKAKKCK
FT                   VNDLVVTVLKRERHGELIEKIRKLGAKIKLIDDGDVAAIVSLVNGNHDMYIGIGGAPEG
FT                   VLAAAALSSIGGQMEGRLVLDTDQLRERAKNLNIDDPEKVYAVKDMARGESVFIATGVT
FT                   SGELVDGVDNICSTSSLIILPNKLIKLQVIN"
FT   gene            559069..560097
FT                   /locus_tag="WRi_005280"
FT   CDS_pept        559069..560097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005280"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95308"
FT                   /db_xref="GOA:C0R316"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R316"
FT                   /protein_id="ACN95308.1"
FT                   /translation="MTYEKIKEIVTNNPNITAEEFGEKLKENRINIKKTNKYHYTLLGH
FT                   IVNSKGPNITDNTNDRAIFLHIIKLLTELKTEGNTGQFKHVKAGLSEAITTKQADVVRI
FT                   LLDSGKFNEEEKFNALLCAVTQKYVQGVKLLLGHVNDENMQKALKVAMDKEQTTQVEEI
FT                   TQILLNFITPETSNVEENIVPAPPIVTEANANQPVSSSVNDQPGHSNENETPVIPEETN
FT                   TKQTATPNNDNKANGFVDAQFSMPNEQETKYKESKKDFYTSLTKDVVGVVITGLFITAA
FT                   VMVPFVAGAVVCSVIAALVAIYTGLHVKNSTLPSYREMRENEVERVTGCHPSAQTLGSR
FT                   RP"
FT   gene            complement(560176..561558)
FT                   /locus_tag="WRi_005290"
FT   CDS_pept        complement(560176..561558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005290"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005290"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95309"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95309.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            complement(561673..564438)
FT                   /gene="ppdK"
FT                   /locus_tag="WRi_005300"
FT   CDS_pept        complement(561673..564438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="WRi_005300"
FT                   /product="pyruvate phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005300"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95310"
FT                   /db_xref="GOA:C0R318"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C0R318"
FT                   /protein_id="ACN95310.1"
FT                   /translation="MYNVFISENPEKMMGEKLIHYFSQGKCEGNAEMKNLLGGKGANLA
FT                   EMCNVGIPVPPGFTISTSACKVYYQDNRSSVIQVSDYSDPEKNVVTHWNDICSGIKNYM
FT                   TMLENDIGCKFGDLNNPLLVSIRSGSVSSMPGMLDTILNVGLNDETVVGLAKKSGERFA
FT                   YDSYCRFIMMYSNVVLQLDHHLFQDVIDNEQQKSGAKSLADLDVDVLKRIVNDFKKIVY
FT                   EKTEKHFPQNVEEQLLNSVNAVFASWKNDRAVSYRRIHNIPENLGTAVNVQAMVFGNLN
FT                   DNSATGVIFTRNPSTGEKKLFGEFLVNAQGEDVVSGVYTPMPIDGEQKNTMEKLLPSVY
FT                   RELCVVCEKLERHYKDMQDIEFTVQDGKLWILQTRSGKRTAEAAIRIIVDMVNEGTITK
FT                   EEGILRIDPKTFDNLLHPVLDVKSDQKVIGKGLPASPGVASGYVVFSASDAEKAAEQGK
FT                   KVILVRSETSPEDINGMNAASGIVTARGGMTSHAAVVTRGMGKPCICSVSGLYIDKDGT
FT                   FFSVGDTKVNKGEPITINGGTGEVMLGILPTISPELSQEFKTVINWIDEIKTVKVRANA
FT                   DTPKDAKIAKEFGAEGIGLCRTEHMFFASDRIEFIQKLIIADDENERANALIKLEEMQK
FT                   SDFKEIFSIMEGREVTIRLLDPPLHEFLPNDQSTIEKIAKSLSKSVESVKNKIAQLSEK
FT                   NPMLGHRGCRLAISHPEIYSMQIRAILSAASELKKEKKIEVEPEIMIPFIMSEKEFILI
FT                   CELAKKESSVISQTQIPASRAGMTSDKAYSIGTMIELPRAALIADKLAKHAEFFSFGTN
FT                   DLTQTTMGLSRDDSVNFLDSYKKNNIFDNDPFEVLDIEGVGELIKMAIERGKKTRKEIK
FT                   LGICGEHGADPKSIEFLIESGVDYVSCSPYRVPIAKLVAAQFSVRSKFAR"
FT   gene            564610..565053
FT                   /locus_tag="WRi_005310"
FT   CDS_pept        564610..565053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005310"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95311"
FT                   /db_xref="UniProtKB/TrEMBL:C0R319"
FT                   /protein_id="ACN95311.1"
FT                   /translation="MALSKFLDPKNDVAFRRIFGTEKNKDILIHFLNDILGFTGKDEIK
FT                   EIEFLSTIQDAEIASDKQSIVDVLCRDSSGNRYIIEMVRPESLRSYCLKGEEFIQKETE
FT                   RILKLIEPDVLPSESTHQCELGNQLVPSDADNEPPLDKEDAQS"
FT   gene            complement(565206..565439)
FT                   /locus_tag="WRi_005320"
FT   CDS_pept        complement(565206..565439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005320"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95312"
FT                   /db_xref="GOA:C0R2N3"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2N3"
FT                   /protein_id="ACN95312.1"
FT                   /translation="MEVCSFSRELMLQILSISLQNGIRFLHYPLPAHPSAFLAGCLPYR
FT                   RKYRLILFLLSYNSGLGGFSIPVELLFAYIQK"
FT   gene            565491..567038
FT                   /locus_tag="WRi_005330"
FT   CDS_pept        565491..567038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005330"
FT                   /product="reverse transcriptase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005330"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95313"
FT                   /db_xref="GOA:C0R2L9"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2L9"
FT                   /protein_id="ACN95313.1"
FT                   /translation="MITSTTVSAPTNNSEAWNQLPWKKCQKVVMRLQRRIVKAVQQGRW
FT                   GKVKTLQHLLTRSFSGKALAVKRVTENQGKNTAGVDRQIWSTCNTKFQGIKLLKQRGYK
FT                   PSPLKRIYISKSNGKRRPLGIPTIKDRAMQALYLFALEPIAETISDRHSYGFRPKRSCA
FT                   DATVACHLLLASRNQLQWILEGDIKGCFDNINHEWLMKHIPMEKKILHSWLKAGFLESK
FT                   TLYSTTAGTPQGSIISPILANLALNGLEKSLESQFGKLGSKRRSKIRSGVNVIRYADDF
FT                   IISGITREVLENEVKPLVSSFLQERGLILSEEKTKITSITTGFDFLGCNVRRYNKKLII
FT                   KPSKESIKKLLNKARTLIKANIANTQAVLIKLLNSLLRGWGNYYSHVCAKRAFNKIDHE
FT                   IMCALWKWAKKRHPRKGLRWIKNRYFKVMKQRQWVFAAPICKNKPKEIRYLRLLRLIDI
FT                   PIRRHVKIRADANPLDLKWKKYFDERVKQTKMLASSFSREGSLLLVSPLRMMFSEES"
FT   gene            567035..567808
FT                   /locus_tag="WRi_005340"
FT   CDS_pept        567035..567808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005340"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95314"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:C0R322"
FT                   /protein_id="ACN95314.1"
FT                   /translation="MKDKPVREKKDLDKGLKRSVGKPACCVSKGGSSSNTTSLPNQLAK
FT                   TKGFEKRAQYYAAKAYSRQADKGDQYHDLKEIIFIAIADCILFPDKSEYKSKHTIRDED
FT                   TNEHDLKDFYFIFIELPKFPKTKEDQLSSIVEKWVYFFKYADETSEEELEKIIGSDLII
FT                   KKAYEELNRFNWSEKEFIAYEQEIKRILDEQAVLAQKLDDATAKGILIGHEKGRKEREI
FT                   EVAKNLLKAGVSIDIIAQTTGLTANEIKDLSSLDV"
FT   gene            567809..568348
FT                   /locus_tag="WRi_005350"
FT   CDS_pept        567809..568348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005350"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95315"
FT                   /db_xref="UniProtKB/TrEMBL:C0R323"
FT                   /protein_id="ACN95315.1"
FT                   /translation="MNIFVLDENPEIAAKMLCDKHIVKMLLETAQLLSNVFSIALKVPN
FT                   PLVSITDQNIEVPYKLTHKNHPCSLWARQSKGNFFWLIKYGRELCKEYTWRYKRKHRSE
FT                   EVIDWCDSNKNLLVFQSTDIKPFVQALPDQYKSSHSVKAYREYYLKEKMRFAKWEKGRE
FT                   VPDWLLSRIVRLKSRK"
FT   gene            complement(569051..571480)
FT                   /locus_tag="WRi_005360"
FT   CDS_pept        complement(569051..571480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005360"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95316"
FT                   /db_xref="GOA:C0R324"
FT                   /db_xref="UniProtKB/TrEMBL:C0R324"
FT                   /protein_id="ACN95316.1"
FT                   /translation="MLFSRRILVRLIGEVLMTLTKCVLTSPLSSVQQYLLVLGKVMVVN
FT                   TKSDQQRAEDDLYTVLRFKEKGDFERRIRELLVNDYKKLKKPLSKLLGKLESKIRTDKE
FT                   NNQAARNVYDQIKKSKTNEDKLSNLLNFKKQLKAFLKNQDDCSIVLNAIDSASVIPVIE
FT                   VNGVHPKDSEIKKLKKAQPLTSNRQDFEEALGYIESQEKVMGITLEEIMEYKQHSVKIF
FT                   LLNRVHSCKNGHSQLHPDVKEAIAILSNDKLRAFYDEEVKKKTLQPILSYKECEQLYDK
FT                   INYEKNESRIIIEREELGENVRRVMGVKRFTNESSREDQKNGTSPTGTSTNYRQEQVAS
FT                   SGDRTLYNSDIPSLGRSIKSSRSALFMPFGASVDTSTPIKPANPSNLVTTGENYTSNAD
FT                   LSDELNVSEVTKIVERMELLSNSLKKIQEIVEKLGNTTLSEEVIVHERHFKKFMDFVGE
FT                   ILVNIGTRLPQSDSKSMYLEQKLKGLEKMNESLNNSVQELEKKVDKLEKENKDFLAEND
FT                   ELKEKLATAKEEKELLFNKKEKMQEVINGLNENNQRLMQKINGLEDDYEYLLRAEKTKR
FT                   ETEDSCIQVEDADIPEGKAELCKDYEIKLVKLEQEIDAKGKQCEELLLENSILRGNIER
FT                   LKEENKRLEGIEESFSIDPSHFCSVKNLHDELILANEQPENIDISIQDEMDSKVATESV
FT                   GVNVKQGYSKRTSNLSRVSEQSSAVKSQFSEARAQSRKQIIYASASLILSGVFAVGTSL
FT                   TMSHLGISISLALTALTFLTLGCYCSYKASTTLRNIELDRTFKMADHEAVFMVPSL"
FT   gene            571723..573147
FT                   /locus_tag="WRi_005370"
FT   CDS_pept        571723..573147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005370"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95317"
FT                   /db_xref="UniProtKB/TrEMBL:C0R325"
FT                   /protein_id="ACN95317.1"
FT                   /translation="MPIETKRQAEVLKKLQDVIKHTDRDIAAGRKLAIKRWVETYIEYI
FT                   KLFKDDKLEFLYNVFRDEGCWLGTRLNNTVLGQKLTEEKIGEIDNPLPRYGMASRYCIT
FT                   GKIGDFFNKQFVLSRGQFTSEEVDSQGNPISDQYVRNILLSSMKRNGPVFDFWIDRESG
FT                   ELKKYDAVEGFDSAVKLKWSEGVEYFYNQLEEKDKEKKLTEAIVALSRPQSVKKDAPIL
FT                   DFCVRNIGDKDTLLQKLLQKDKGVYSLLAELIESCFFDTVHDLVQCWCYKGVSAGGDCS
FT                   DKIFSQQDYELFLYSLSNVMLKNPELSVQARSLIMEIWKCERFAEYRETSVNTSNYTVP
FT                   IKSVLGGLIINWKREDVCKPDRKIEKEEILDMISFAKGCFPEKFDLFKEVMIENLRICG
FT                   REGKRKGVDYGKFAEELFLQLEKVTLPSVGDGPWNNLRSQSKVSLPLDGSGDGPQSEFE
FT                   APSVSGISGSHKKRKI"
FT   gene            573202..576723
FT                   /pseudo
FT                   /locus_tag="WRi_p05380"
FT                   /note="hypothetical protein; contains in-frame stop codon"
FT   gene            577843..580743
FT                   /locus_tag="WRi_005390"
FT   CDS_pept        577843..580743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005390"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005390"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95318"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R326"
FT                   /protein_id="ACN95318.1"
FT                   /translation="MDTGSVKYIAEPISEQSKHTDEQKLKCDLSAGQEFSEIGSPKTEA
FT                   TGLPVDSYYEFIKRDLFSADRSLIDDKKYLEDLIDEWLIHAPNLGLEESQKKLNQKLLN
FT                   SIIKDFNMGNYDSFSNLKQFLESNEKNKDLKYVLNLKRGHLGTTILNVFLEYDEIIPSL
FT                   LKAGADLNMQDNKGKTLLHDTAIYSSGYEDLGYLLDAKADPNIQDEKGNTPLHYYAAKC
FT                   SDQSRKTMDLLISKGADLSIKNNDGKTPLQVAIDNDNIIGCLLTNSQKKLREQLGKMLL
FT                   ATSSDEDWDNAYDPEVENLRKFLNQYENDNDLKIVLNVKDDSSVLLDSPSRQFPNVKAL
FT                   LLKAGAADFIGKKQDNYEKCDSFLSEIYQINYLAKRNEFLSKVVKAKSMIELQEVVNEI
FT                   IASGMRLNFAKDKDYYFADHVLEKIAQIEGSYGIASDIVCTLISRGAKLKRSESLKVID
FT                   TIELKFKAHKANMISAHLEYVSNAEEFFRIAKAATSGQLYDGKIDNNVFYLEYSEDSII
FT                   DVARITNRTRNLELIQESYRRDIIKIGKSKVEIITENGIRYYTDLTEGSDIVLTFYTSL
FT                   GNIDLRLYPDIQDKSKIIVEVSNREEILEKFKGREEELGNDCALGGYSVYNAIEQGYFE
FT                   RSRKLMRPEVISESNNKWTEREELRRDSMEEIARRHKLLQDLRNIESNIVQKEKNFDIK
FT                   TYLIDIFKTLSRFYEEKGDISKTDLAKAAEKESKKLGLEGKYNWSKIFGLEEEIIEKVE
FT                   KQGDKEQKSNIPDDFYLGHTINNGSCFFDSFRQSLEQQKGIKVTVEQLRNECKRFAQDN
FT                   PPEWFISKIGNDFDKVESELVNRGITCNQYINSIGKNEFWGRSDIEGRVLCDKYGVKLH
FT                   VAESNPLHTIDKQQDPFLHQLIDSSGSKAGKIDYSHNSALHMVNGGHDHFQPLLYRNKA
FT                   LAKQTQEQKDSLCYSSLPSCSMDELKIEKANIRHCL"
FT   gene            complement(581150..582643)
FT                   /locus_tag="WRi_005400"
FT   CDS_pept        complement(581150..582643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005400"
FT                   /product="site-specific recombinase, resolvase family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005400"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95319"
FT                   /db_xref="GOA:C0R327"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:C0R327"
FT                   /protein_id="ACN95319.1"
FT                   /translation="MLKEVRCAIYTRKSNEDGLEQKFNSLDAQRVVCEKYIKSREGWVA
FT                   LAKKYDDGGFSGSNLNRPAIKELFEDVKVGEVDCVVVYTLDRLSRETKDCIEVTSFFRR
FT                   HRISFVAVTQIFDNNTPMGKFVQTVLSGAAQLEREMIVERVKNKIATSKEQGLWMGGTL
FT                   PLGYDVKDKELIINEKEAKTVKHIFERYVELKSMAELARELNREGYRTKAKSDIFKKAT
FT                   VRRIITNPIYMGKIRHYDKQYEGKHEAIIEEEKWQKAQELIRNQPYKKAKYEEALLRGI
FT                   IKCKSCDVNMTLTYAKKENKRYRYYVCNNHLRGKNCESVNRTIVAGEVEKEVMRKTEQL
FT                   YENWKEKTEEEWKNLSFGKQKEVVKKLIKGVMVKGDGIEVSSEDKIEFIPIKKKGNKCV
FT                   VMEPEGKTNNALLKAVVRAHLWKRQLEEGKYGSIKELSAKINIGARRIQQILRLNYLAP
FT                   KIKEDIVNGRQPRGLKLVDLKEIPMLWSEQREKFYGLDL"
FT   gene            complement(join(582637..582804,583724..583996))
FT                   /pseudo
FT                   /locus_tag="WRi_p05410"
FT                   /note="hypothetical protein; disrupted by IS-insertion"
FT   gene            complement(582831..583663)
FT                   /locus_tag="WRi_005420"
FT   CDS_pept        complement(join(582831..583289,583289..583663))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="WRi_005420"
FT                   /product="transposase"
FT                   /note="ISWpi1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005420"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95320"
FT                   /db_xref="GOA:C0R2R0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R0"
FT                   /protein_id="ACN95320.1"
FT                   /translation="MRKKYPTDLSEREWARIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKKVKGRKRHIITDTQGFILGCYVGAANENDRDGIKIALN
FT                   NMRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFWVHKDTPPELLPTR
FT                   EQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMSRVMLKREYA"
FT   gene            complement(584009..584467)
FT                   /locus_tag="WRi_005440"
FT   CDS_pept        complement(584009..584467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005440"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005440"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95321"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R329"
FT                   /protein_id="ACN95321.1"
FT                   /translation="MSKKEKEDALKELLENSGKNIKGTKKELHYAVDGKTVSLLVEKGA
FT                   NVNAADVEGYTALHLAITEKRLETVRELIKSGGNVNAEEYGSKCTPLHLACMVGKVEIV
FT                   EELVKAGAEIEQADKFGMTAMDYAKNSKEVTEVLKKETDRIEKLFEKL"
FT   gene            complement(584493..585227)
FT                   /locus_tag="WRi_005450"
FT   CDS_pept        complement(584493..585227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005450"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005450"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95322"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R330"
FT                   /protein_id="ACN95322.1"
FT                   /translation="MGFSEEKKESFNKFFKEVSRNGFKNINKRDEKGETVLHHAVENSD
FT                   HKTVRLLIEKGAEINARDKNGYTPLHCAVFAKSLENVKVLLRSGAEINATQYVSGCTPL
FT                   HSACKIGGAGVEIIKELVKAGSEVNQLNKYGSTPMYYIWESEKYCLCDREESEKASKFL
FT                   RAKGGVTKSRKLTCYGIEGLVGEIADKLDRSYMPELKIMEIEEIRKRDKSLIKKECQNL
FT                   ATKIMCQVNEMIDEVVRIKKGT"
FT   gene            complement(585395..586555)
FT                   /locus_tag="WRi_005460"
FT   CDS_pept        complement(585395..586555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005460"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95323"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:C0R331"
FT                   /protein_id="ACN95323.1"
FT                   /translation="MLLPPNATKKEKALVDAIDYKVDPGCIRGFKFSQGEKVLPWIIEE
FT                   YGLGEILHWVKNKRKAIKKGIKFQRLRGTPASLKIALKWANIEDITIIEEPSGKHFFEL
FT                   QIGIKDVPNDFFVDAVVELAKLSLPARSRLMRIFNDYYNISRFILDESFFGSLLSDYSG
FT                   VKIEKDGPVLSFGRVNFFRSHGPVIRIVENYLRDHYERALSNDIYRLDVAILGETEPHT
FT                   KNYNGIYERNHVWYNFKALYPLPQSLLPKIKFAKAQIVLSDSWNLGEINACFPVTSGEE
FT                   KGSKFLLGSDKLSEQLWNLKHKPILERFSVTHHYKVEDFTNQKVIIFGVAEHNIHFERD
FT                   LNSEQKDSIHEPENYVLVFYPGVLTWHEHRHLNRGWEEKQVICLMH"
FT   gene            complement(586555..587346)
FT                   /locus_tag="WRi_005470"
FT   CDS_pept        complement(586555..587346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005470"
FT                   /product="baseplate assembly protein J, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005470"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95324"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:C0R332"
FT                   /protein_id="ACN95324.1"
FT                   /translation="MQQTNIIEPLNFEEIFSRMKEELISRDESFTALVESDSAMKVLEV
FT                   AAWRELLLRQRINEAVKSNLLKFATGEDLDNLAEFYGVERQKEEDDERFRKIIKAKIIG
FT                   WSTGGSKEHYRYHALSADSRVKDALVESPIPGKVQVSILSTELSTLQEELLEIVKNQLN
FT                   REDVRILTDTVEVVSCNMIEIDIHSKISIKRPDIIETVKKKFIEKFGTTKRLGWKVTRS
FT                   WIIANLFMEGVENVELIEPREDIVVKGNECAFLKSLNVELN"
FT   gene            complement(587349..587684)
FT                   /locus_tag="WRi_005480"
FT   CDS_pept        complement(587349..587684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005480"
FT                   /product="baseplate assembly protein W, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005480"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95325"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:C0R333"
FT                   /protein_id="ACN95325.1"
FT                   /translation="MKGMDGKTGKALEGIEHLKQSIIDILTTPIGSRIMMRNYGSRLFE
FT                   LLDKPVNRDLTLEIYAATAEALEKWEKRFKLEKVKMTEVKEGKVTLDLEGLYVPMGKKI
FT                   RFDEVVV"
FT   gene            complement(587687..587941)
FT                   /locus_tag="WRi_005490"
FT   CDS_pept        complement(587687..587941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005490"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95326"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:C0R334"
FT                   /protein_id="ACN95326.1"
FT                   /translation="MNKSVVRVGDYCGEATPHFCISGSNNVFVNDFPVCRKGDNFNEGK
FT                   VMIQGSKTVFANGHGVGRVGDSVSCGLKVIKGSKSVFAK"
FT   gene            complement(587949..588413)
FT                   /locus_tag="WRi_005500"
FT   CDS_pept        complement(587949..588413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005500"
FT                   /product="baseplate assembly protein V"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005500"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95327"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C0R335"
FT                   /protein_id="ACN95327.1"
FT                   /translation="MLESNFAISELQRKLANIVRIGLVKEVDYEKARVKVQIGEFLTDW
FT                   LPWITSKAGKDRNWSPPDIDEQVIILSALGELSLGVVLAGIYQEKYPAPENKKEINSVK
FT                   IQDGTRLLYDKEKHHLEIEVVDKITLKAGESSIEMTRSEIKLKADRIELN"
FT   gene            complement(588400..588876)
FT                   /locus_tag="WRi_005510"
FT   CDS_pept        complement(588400..588876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005510"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95328"
FT                   /db_xref="UniProtKB/TrEMBL:C0R336"
FT                   /protein_id="ACN95328.1"
FT                   /translation="MILIELHKAICRMLKKEIPAIQTCEIYPMIRREIVAPAVFVELSS
FT                   LEQGKDSGTEELALKARFEARIVIDSTIENAAIIVRELAAEVARVVNKNTWNVKNVSPG
FT                   EFISAEIDGFRPELDAYLVWMVDWVHEVHLGRSIWEEGKFMPHKIEIGEINVGK"
FT   gene            complement(588873..589394)
FT                   /locus_tag="WRi_005520"
FT   CDS_pept        complement(588873..589394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005520"
FT                   /product="minor tail protein Z, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005520"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95329"
FT                   /db_xref="InterPro:IPR010633"
FT                   /db_xref="UniProtKB/TrEMBL:C0R337"
FT                   /protein_id="ACN95329.1"
FT                   /translation="MSINIEVTDNINKVIENVNAERKKVEKAAVRALNKTALWLKTQAA
FT                   KEISEEKKIKLTVMRKRLRIFKAKTSRLDVLMRANLYDIRVSAIGKMRQTRKGAKVGKH
FT                   KFIGGFMATMPRGNSGVFRREGRTALPIQEVKLGLEPEASKIIKELVNYETEGIFEKYF
FT                   ERELNYIVKV"
FT   gene            complement(589396..589701)
FT                   /locus_tag="WRi_005530"
FT   CDS_pept        complement(589396..589701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005530"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95330"
FT                   /db_xref="UniProtKB/TrEMBL:C0R338"
FT                   /protein_id="ACN95330.1"
FT                   /translation="MQENIKRLLQDCFAHLGKVALYESKDKSYMVQVLKQQPDKLYEIG
FT                   EGQFVGEILLLEVSVFDVLKPMVGDTFSIGSCRYRVHTPPLRDNSGMVWKIQASGV"
FT   gene            complement(589799..590803)
FT                   /locus_tag="WRi_005540"
FT   CDS_pept        complement(589799..590803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005540"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95331"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:C0R339"
FT                   /protein_id="ACN95331.1"
FT                   /translation="MQNPFTNTAFSMTALTNAINILPINYGRVENLNLFPSRSVRFRHI
FT                   TIEEQNGVLSLLPTQLPGAPATVGKRGKRKIRTFTIPHIPHDDVVLPEEVQGIRAFGSE
FT                   SELKALADVITDHLQLMRNKHAITLEHLRMGALKGIILDADGSELLNLYNEFEITPKVV
FT                   NFALGTATTDVKRKCLEVLRHVEDNLSGEYMTGIHALVSPEFFDALISHSKVKEAYERW
FT                   QEGAALRNDMRSGFTFCGITFEEYRGQATDPEGTVRRFIERESGNCFPLGTASTFTTYF
FT                   APADFNETVNTLGQPLYAKQEPRRFDRGTDLHTQSNSLPMCHRPGVLVKVVVT"
FT   gene            complement(590841..591212)
FT                   /locus_tag="WRi_005550"
FT   CDS_pept        complement(590841..591212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005550"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95332"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="UniProtKB/TrEMBL:C0R340"
FT                   /protein_id="ACN95332.1"
FT                   /translation="MISITEGNNLGDLLKYEVSNLYSRDQITVAKGQNLKLGKVVGYDT
FT                   KDGFIKALNPTATDGTQTAIGVIASDVNAKENSKGVIIARGAILADHAVVWPANIIEEQ
FT                   KTAAIKHLEGRGIIIRKGA"
FT   gene            complement(591287..592348)
FT                   /locus_tag="WRi_005560"
FT   CDS_pept        complement(591287..592348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005560"
FT                   /product="minor capsid protein C, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005560"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95333"
FT                   /db_xref="GOA:C0R341"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:C0R341"
FT                   /protein_id="ACN95333.1"
FT                   /translation="MKNQAIWLNRCVMVEPRSFELLSLQTGKQPIFKNIKHAVRNSERG
FT                   IIPIHGILTKKSEVFDDVLGMTSYEKISEEIEEALIDKEVETIILDIDSPGGEVNGLFD
FT                   LSDFIYQARRKKRIVAIANDDAYSAAYAIASSAEKVLVTRTSGVGSIGVIASHIDQSGF
FT                   DEKQGIKYTTVFAGSRKNDLNPHEPITSESLESLKSEVNRLYGMLVELIARNRNLSVEA
FT                   IKSTEAGLYFGEKAVEIGLADGITILSEFKSINKKGDITMNEKTTNDLETDNLTKYRTE
FT                   VLELIRLCNLSRMPEKIGEFIEQSVSVEQAREVLMELLAERTKKTEILSAIPQNSGEEL
FT                   MMQVAKSRAQSNI"
FT   gene            complement(592345..593763)
FT                   /locus_tag="WRi_005570"
FT   CDS_pept        complement(592345..593763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005570"
FT                   /product="portal protein, lambda family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005570"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95334"
FT                   /db_xref="GOA:C0R342"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:C0R342"
FT                   /protein_id="ACN95334.1"
FT                   /translation="MLLKSFKQLFNKPKIKSSAWDAAGSGRRFFHFQPELGSINNLLSQ
FT                   NLETLRSRSRDMVRKNPYAANIIDTIVSNSIGTGIKPQSKARDGEFRKRVQELWLRWTD
FT                   EADSNGVSDFYGLQALVCRSMIEGGECFVRLRTRKLEDRFSVPLQLQVLESEHLDNKTN
FT                   QTLGNGNVIRNGIEFNKLGQREAYYLFKEHPGEGSFGESVRVPANDVLHIYRPLRPGQI
FT                   RGEPWLSSILLKLYELDQYDDAELVRKKTAAMFAGFITRLDPEANILGEGESNEQGVAL
FT                   SGLEPGTMQLLDPGEDIKFSEPSDVGGSYEAFMRQQLRAIAIGTGITYEQLTGDLTGVN
FT                   YSSIRAGLIEFRRRCAMLQHNIMVFQFCRPVWSRWLELAVLCGELSIDKKVAKAAKEEV
FT                   KWIPQGFDWVDPLKDQQAQQMAVRNGFKSRSEVVSELGYDVEEIDQEIAEDQRRASSLG
FT                   LSFDSDVTTNQEII"
FT   gene            complement(593866..594147)
FT                   /locus_tag="WRi_005580"
FT   CDS_pept        complement(593866..594147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005580"
FT                   /product="Putative addiction module toxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005580"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95335"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C0R343"
FT                   /protein_id="ACN95335.1"
FT                   /translation="MGIIYQIGYLEGVDTEDLPSLPKTIRLRVQKAIEKRLTIIPDKVG
FT                   EALSHKWVGYFRLRVGDYRVIYLIDNSEHMVKIAAIGHRKEIYKRSPE"
FT   gene            complement(594138..594398)
FT                   /locus_tag="WRi_005590"
FT   CDS_pept        complement(594138..594398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005590"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95336"
FT                   /db_xref="UniProtKB/TrEMBL:C0R344"
FT                   /protein_id="ACN95336.1"
FT                   /translation="MDQSQGRLNVNVNFEGEFAQYLTEMAKVQNRTIEEIVKDLVEEEL
FT                   EVSKLSEGDEMDEGEIALLELAAKRNVPGAKIIRHEDIKWE"
FT   gene            complement(594439..594672)
FT                   /locus_tag="WRi_005600"
FT   CDS_pept        complement(594439..594672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005600"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95337"
FT                   /db_xref="GOA:C0R345"
FT                   /db_xref="InterPro:IPR004174"
FT                   /db_xref="UniProtKB/TrEMBL:C0R345"
FT                   /protein_id="ACN95337.1"
FT                   /translation="MYNEDYLIQVEEAIKKLQNGERVVSIAYGDHVVRYAEVDINDLLS
FT                   LRQRIKAELKIAGMKPKRKIVFSTNKGVDKIM"
FT   gene            complement(594676..596499)
FT                   /locus_tag="WRi_005610"
FT   CDS_pept        complement(594676..596499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005610"
FT                   /product="putative phage terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005610"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95338"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:C0R346"
FT                   /protein_id="ACN95338.1"
FT                   /translation="MIYATSFSEGLKPDPLLKVSEWANEYRVLAPTAASEPGKWRTERT
FT                   PYLKEIMDSLSPSSPAEKVVFMKGAQIGGTEAGNNWIGYIIDQTPGPMLVVQPTVEMGK
FT                   RWSKGRFAPLIESTPCLKSKVKDPRSRDSGNTVQSKEFPGGIVVITGANSSVALRSMPV
FT                   KYLFLDEIDAYPGDSGGEGDPVLLSIARTNTFARRKIFLVSTPTIHGISRIEKEFEATD
FT                   KQYFFVPCPYCNYYQVLKWSQIKWENNDSRTAHYVCTECSGKIENHQKTEMLERGEWRP
FT                   TNRVKGEKKGFHLSSLYSPVGWYSWTQAVEDFLHAKESEQLLKVWINTTLGETWVDKGE
FT                   VPDWKQLFNRREFFPVGTVPRREVVLTAGVDVQKDRLEVEVVAWGKSRESWSIEYRVFE
FT                   GDTGRGEVWGKLSELLNHHFIGENGLEYMISMMAVDAGYATQEVYNWVRGHQGSGRVMA
FT                   VKGVNKALVPLSSPSRVDITVGGQKLKRGIKLWPVGVSILKSELFQLLNVLKDGEEAPA
FT                   GYCHFPEYAPEYFKQLTAEQLVSKVVKGYTKQEWQKVRERNEVLDCRIYARAASIALGI
FT                   DRWPESKWNSLSEKPESKKSKKIVKSKWISE"
FT   gene            complement(596496..597977)
FT                   /locus_tag="WRi_005620"
FT   CDS_pept        complement(596496..597977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005620"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005620"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95339"
FT                   /db_xref="GOA:C0R347"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R347"
FT                   /protein_id="ACN95339.1"
FT                   /translation="MSANLSLELIKCLINQPGVDVNVRGLNGKTPLHYAVEINELSMVA
FT                   LLLNRKNINPLITDDNGKSALDCAREEILQALINHKYGLEKDSLLHLAAMLNEANAVRF
FT                   LLDKGTNVNEQNALLHTPLHLAAGAGHEQIVEILIREGNADKDVLDARNHAAIHYAVNN
FT                   KKLGVVKLLSNLGANVNVVGSGRNAMKLSSLHVAISSSNYDERDLCLDIVRCLINVPNA
FT                   GVNLQDYENKTPLHYAERLKTIEVLLTREDIDPLIKDDNGKTPFCYAKEANRLDIVKIL
FT                   ASNRYGADKNSLLHLAARKGYEDLIDGILGEGVEIDAVDESGKTGIYVAVKHGHFNVVK
FT                   LLLKRGADATDVFQYAIITNNAKLIKLLSKEKEIVLFGRQKNFPTFHLLSNKYFEERKI
FT                   ADKKIKKYINIVCVSITVCAIVIVGIYPNIIAAVMVGIVALIAAIAMSNLTQKYIEEAL
FT                   EKKMFIELESEKTSECSSILSDVEVSSNDGEELAI"
FT   gene            complement(597981..598460)
FT                   /locus_tag="WRi_005630"
FT   CDS_pept        complement(597981..598460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005630"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95340"
FT                   /db_xref="UniProtKB/TrEMBL:C0R348"
FT                   /protein_id="ACN95340.1"
FT                   /translation="MEKITQTEWAREIGVSKQYVCYLVKKGIIELENGLVNREQANEAV
FT                   AAIRDPSQPLRRKNPENENTSNLSTMLLKTRIKNEMERGKLLEAKAKAEIGELVAVEEV
FT                   KRDAFNVARVVRNNLLNIPNRVSALLASLSDTEKIHMALTEEITNSLQELSNIKF"
FT   gene            complement(598474..599700)
FT                   /locus_tag="WRi_005640"
FT   CDS_pept        complement(598474..599700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005640"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005640"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95341"
FT                   /db_xref="GOA:C0R349"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C0R349"
FT                   /protein_id="ACN95341.1"
FT                   /translation="MNLAIHYYPVENLVEYKRNPRKNDDVVNRMCASIREFGFRIPIVA
FT                   KSDGTVVDGHLRLKAARKLGMESIPVVLSDNLNEPQTKAFRLLANQSANWAKWDDELLK
FT                   VEIQELEDLQFDLKMTGFELEKVQRFLDDFDGKEEVERGVLELIDKKVEIAKPGDLWIL
FT                   GDHRIYCGDSCVVESFKAVLDDKMADITVCDPPYNVDYGSSQEREDKKILNDNQGEKYE
FT                   LFLYDICSNILAYTKGAIYICISSSEFSTLQKAFEEAGGKWSTFIIWAKNHFTLGRSDY
FT                   QRQYEAMLYGWKSGNKREWHGGRNQSDLWFYDKPIHNSLHPTMKPVELMEKAIVNSSRP
FT                   GDTVLDPFSGSGSTLIACERTGRICRTIELDSKFVDVAIKRWQVYTGREAILSGTGKTF
FT                   AQIQEEKQQ"
FT   gene            complement(599814..600269)
FT                   /locus_tag="WRi_005650"
FT   CDS_pept        complement(599814..600269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005650"
FT                   /product="Putative Holliday junction resolvasome,
FT                   endonuclease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005650"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95342"
FT                   /db_xref="GOA:C0R350"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0R350"
FT                   /protein_id="ACN95342.1"
FT                   /translation="MSILTLDLGKQTGWAILTDGIIESGSKSFHGSRFSGGGMCFLNFC
FT                   NWLNSLKDISAVYFEEVRRHLGTDAAHCYGGFLAVLSAWCEENNIPYQGVNVKTIKRFI
FT                   AGKGNASKSEVIEAIREKSFSPRDDNEADALALMFYISKDINKTKNP"
FT   gene            601106..602110
FT                   /locus_tag="WRi_005660"
FT   CDS_pept        601106..602110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005660"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95343"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:C0R351"
FT                   /protein_id="ACN95343.1"
FT                   /translation="MDENKIVFYTTPGGNIEIEVLCRDENLWLTQKRMAELFDVQLPAI
FT                   SKHIKNIFESGELQEKEVVSTFEVTAADGKNYPTQLYNLDTIIAVGYRVNSKKATLFRV
FT                   WATKVLKDFIIKGFALDSKRLKNGKKFGKDYFNELLEKIREIRASERRFYQKITDIYAE
FT                   CSADYDPNSEITKQFYAKVQNKLYWAIYGLTAAELICSRVDHKKPHMGLTTWKDGPGKK
FT                   IHKSDVSIAKNYLTEEELSELNHIVSMYLDYAELQAKKNRLMKMQDWAEKLDAFLLFND
FT                   YEVLKDAGKVSAEVAKALAEGEYEKYRVIQDKLHESDFDELIKASKESEKITI"
FT   gene            602696..604009
FT                   /locus_tag="WRi_005670"
FT   CDS_pept        602696..604009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005670"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005670"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95344"
FT                   /db_xref="GOA:C0R352"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:C0R352"
FT                   /protein_id="ACN95344.1"
FT                   /translation="MQGKLNQIAVRAKQDKRVKFTSLVHLINEENLAECYKELKRNKAC
FT                   GIDRVTVEAYGENLEEKLKTLVDSMKRKQYQPLPVKRVYIPKAGSKEKRGLGIPSTEDK
FT                   LVQVMLKKILENIYEANFMDSSYGFRPGRNCHQAINALDKAVMHKPINYIVEVDIKKFF
FT                   DNVQHKWLMNCLRERIADPNLLWLIKRFLKAGIVEVGCYKATDQGTPQGGIVSPVLANI
FT                   YLHYVLDLWFEKKFKPKARGYLQLIRFCDDFVVGCEREEDAKEFLELLKQRLSKFGLEI
FT                   AENKTKIVKFGKKEWYQAEREKRRTASFNFLGFTHYCGKSRNGKLMMKQKTSKISLARK
FT                   IKEIKEWLKMVRSRICLKDWWQKLKAKLTGHYSYFGVSGNYRCLIQFYRPVTKLAFKWI
FT                   NRRSQKKSMDWEQFIHYLKVNPLPKPKVYVSLYTGALV"
FT   gene            604202..604312
FT                   /locus_tag="WRi_005680"
FT   CDS_pept        604202..604312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005680"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95345"
FT                   /db_xref="UniProtKB/TrEMBL:C0R353"
FT                   /protein_id="ACN95345.1"
FT                   /translation="MLFVSILSSNQILRASVSSSMAVTSNFFPLASSTIC"
FT   gene            604707..605060
FT                   /locus_tag="WRi_005690"
FT   CDS_pept        604707..605060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005690"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95346"
FT                   /db_xref="GOA:C0R354"
FT                   /db_xref="UniProtKB/TrEMBL:C0R354"
FT                   /protein_id="ACN95346.1"
FT                   /translation="MYFSLNVNILIIFCGSLSGLLSFCCLSYCTLFVFYYYFILSIIIY
FT                   YYYIYIIYKGFRNAESAILADFRHIITRNTFRNRGQKVRIQAIFSFLVSHYLFSNQGIR
FT                   NIIQPFDVLSLFN"
FT   gene            complement(605175..607370)
FT                   /locus_tag="WRi_005700"
FT   CDS_pept        complement(605175..607370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005700"
FT                   /product="regulatory protein RepA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005700"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95347"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:C0R355"
FT                   /protein_id="ACN95347.1"
FT                   /translation="MVQDFLTDVKQKNTLNDEYYDFNNTVEPLEQFDVEEIKRQLLLNI
FT                   RSCLSYLFPRGTFHGDEFRIGDVHGNKGQSLRVALTGGKAGLWQDFATGQKGDVLDIWA
FT                   GAQGKDTKRDFCEVMASISECLGYNKKCAKADEDFEKFITHSWNYYDENGQVIVKIYRS
FT                   DPPKGKKQYKPFDVKQSRYGAPKVRPLYNIPSILKSDKVVLVEGEKCAEALIEQGITAT
FT                   TAMSGANAPIDKTDWSPLKGKHIIIWPDNDEAGNKYAKNAEKKLLEIGVASLAVLEIPR
FT                   GKPEKWDAADCVEEGIDVKEFLASTPLLTIDTPATDTSNMKSLERSTKQPLNILDWSAE
FT                   RFVGPVPEQKFLVEGLFPLGVTSIIAAMGDTGKGMLLLDLALKVASDKDQMCGFGSLVT
FT                   EHGSVVIFSAEDDASEIHRRLERLDPKCERLKHKDKLFIVPLPNVRGSLTILRNVRGKI
FT                   VEVSPEFESVMKQLEEIKDLKLIVFDPLASFIHADINADPAVGDYLMCLLSDLACSTGA
FT                   SIITAHHMRKPKGEKPILTAEQARDAIRGTSALVNGVRCSYAFWPIENTARLEIFKAVG
FT                   ETPRQNALFHGAVVKANGLADRTVRTYLRNQETGLLEDITIQLTVKNASEKDLKICLTD
FT                   AITRSAVAGHPFTHTGSTGVYKQRHRLPEIFHSMGRDRLERIVQELLQAKQLVKGMSTG
FT                   AKEDKWLDIPTGPFACGIGKFTLGAEDFSYRQNLMLG"
FT   gene            607977..609359
FT                   /locus_tag="WRi_005710"
FT   CDS_pept        607977..609359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005710"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005710"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95348"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95348.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            complement(609568..613095)
FT                   /locus_tag="WRi_005720"
FT   CDS_pept        complement(609568..613095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005720"
FT                   /product="helicase, SNF2 family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005720"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95349"
FT                   /db_xref="GOA:C0R357"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C0R357"
FT                   /protein_id="ACN95349.1"
FT                   /translation="MTIYGRTWWGKKWLQSFDGIDYDNRLPRGRTCANTGRAFGIKING
FT                   HIVTAKVHSSGSYPYRGSKPQPYKVKIILNELSSSEQQTIRQIIETSPAILAKLINRQL
FT                   SASLFDKLNDLGIKLFPSNWQEMNASCSCPDWAMPCKHIAAVIYLIAAEIDKNPFMIFN
FT                   IHNCNLSALIDDFGNGKLENAQNILKIDDIFKACSKIRIHNQAILNDIDLSTIPNLFDC
FT                   ISSILTDNPLFFEKNFHNILQIAYKHWQKYPAGRLVYYPASKKELSEEELFIKRWGNIE
FT                   NWQTFQLFIDDQHYLTQVSNGTTNLFRLSGNVLRDVARFLNDIPSSLLHKLNPELRFMH
FT                   MISQFAHMLMEKSALIPQVLQNKRGEVIIRWIPALFNESVKEIHSKISSICPPLLIKYQ
FT                   EIVMEPEEQVNVAISLILLGYIEDNFPASLDKHRDKSIFELFFTGRSYKFTEFSNKEIP
FT                   QAINLWLSRLYLADKPYKLYLMIKDHHEKFELEVQLSLDDEKSFIKLEKALSNQNVKLS
FT                   ILSDLALLSEYIPELEKSIDDNSTLSFNLDNFAPLFLHILPVLRAIGIKVILPKSLQKI
FT                   LKPQLSLNLSTKDKIKEDRESFLTLENLLKFDWKVAIGDKKLSVTEFKKLLKDSRRLVR
FT                   IVDQYVLLDDKEVEALLKKLDKLPDYLSQAELMQAALTGKVNETKVAFDQQLTSLFNKL
FT                   NTYTPVTTPNNLIAQLRPYQERGFSWLVQNIENGFGSIIADDMGLGKTLQVIAAILCCK
FT                   NTGFLDRDRVLVVAPTSILSNWQREMERFAPELKLFVYHGQNRELASDYDVALTSYGLA
FT                   RRDKKELNKIRWFLLVIDEAQNIKNPNTEQTKAIKTIAAKHKIAMSGTPVENRLLEYWS
FT                   IFDFINKSYLGTPKQFKSSFATPIEKARDKTCLERFMKITSPFMLRRLKSDKSIIQDLP
FT                   DKIENNRYCSLTSEQTALYQKVVDTTMEKIEKSEGIERKGLIFKLINALKQICNHPSQF
FT                   GKKKRASIEQSGKMQMLEEILISIGEVAEKSLIFTQYTEMGEIIARLLEERFESEVPFL
FT                   HGGLSRKARDTMINDFQNLFQSNILIVSLKAGGTGLNLTAANHVIHYDLWWNPAVEAQA
FT                   TDRAYRIGQERNVMVYRLLSTGTFEERIDEMIQSKKELANLTISSGESWITEFNNDQLR
FT                   DLVNIKNAL"
FT   gene            613789..614550
FT                   /locus_tag="WRi_005730"
FT   CDS_pept        613789..614550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005730"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005730"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95350"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C0R358"
FT                   /protein_id="ACN95350.1"
FT                   /translation="MDNTLIILAAGKSSRMNSQYSKTLHLVGNFTLLEHIIHNAKPLSL
FT                   KSLSIVISKPFLKELERFSTLKDIIDKYNIKLIIQENITGTGTAVKIALESLERLSDQD
FT                   IVLIQYGDTPFISSDTVMRMTDCLKCNNKNLVLLGFNSQDKQYGRLVIDDNDNVQKVLK
FT                   SEDEILLANSGIMVSYAKDLYTLIKEVKFNDSTNECCLNDIIPIAASNNLRAGYVVADE
FT                   KEAMGVNNKEDLVKAERYFQANRRRQPTLLS"
FT   gene            614682..615641
FT                   /locus_tag="WRi_005740"
FT   CDS_pept        614682..615641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005740"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005740"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95351"
FT                   /db_xref="GOA:C0R359"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R359"
FT                   /protein_id="ACN95351.1"
FT                   /translation="MGILITGAAGLIGSALVEKLEKQGYEVISCDIRFRDNPLSFFSED
FT                   IMPLLAKCTGVIHLAAISRVIHGELYPELCQKVNVDGTIQFLEFCKSLPNKPWFIYASS
FT                   REVYGEQKELPVAESASINPINNYAKGKAFIEEQVINLKGSNFNVAILRFSNVYGGLLD
FT                   HSSRVIPALCINALKGDPIRIEGKECVFDFTYLDDVIEGIYLTVKYLQNEKSSLPAIHL
FT                   TTNSPCTLENLAKTILKVTESDSRIDFYPPRNFDVTKFHGDFTRAKELLGWSPKHSLKV
FT                   GLGKFIKSLQNNTQEYPNNIDMVIYENIKSYSWLPSLL"
FT   gene            615598..617934
FT                   /locus_tag="WRi_005750"
FT   CDS_pept        615598..617934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005750"
FT                   /product="glycosyl transferase, group 1 family protein /
FT                   moaA/nifB/pqqE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005750"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95352"
FT                   /db_xref="GOA:C0R360"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:C0R360"
FT                   /protein_id="ACN95352.1"
FT                   /translation="MKILKVIHGYPPYYSAGSEVYSQTLAHELANNNEVQIFTRHENSF
FT                   LPDFHYTIALDCSDSRILLNLINIPTTKYRYKFINEEVNIKFKRIIDNFQPDLIHFGHL
FT                   NHLSITLPEVAFKENIPTIFTLHDFWLMCPRGRFIQRNSEDLLRLCDGQKDQKCATQCY
FT                   KGHFTGDEEFLNSDLNYWEQWVATRMKQTKKVVDYIDYFIAPSKFLMDKFTQDFNVPIN
FT                   KISYLDYGFDLNRLKNRNRVQEKGFIFGYIGTHTPEKGVDLLLKAFSRLSSKAKLRIWG
FT                   AAREETKTLKAIADQFPHAVKERIEWMGSYNNKNIVTDVFNKVDAIVVPSIWGENSPLV
FT                   IHEAQQLSVPVITADYGGMAEYVRDGINGLLFKHRDTNSLSEKMQVLSTDQELYSELTQ
FT                   RGYLYTKNGNVPSISEHTEKLNKIYRNVIENKGKSVATKPGPWRITFDTNPDYCNFACV
FT                   MCECFSPYSKVKEEKKAKGIKPKIMSIETIRKVIKEADGTPLREIIPSTMGEPLMYKSF
FT                   DEIINLCHEFGLKLNLTTNGSFPIKGARKWAELLVPILSDVKISWNGATKETHERIMKG
FT                   SKWEVVTENLKTFLEVRDKYFSDTGERCTVTLQLTFLESNLHELYDIVEMAIKNGIDRV
FT                   KGHHLWAHFKEIKDLSMRRDELAISRWNTEVGRLYELRDNMLLPNGKKIKLENFTILSQ
FT                   EGIKDLAPGGQCPFLGKEAWINNEGKFSPCCAPDELRKTLGDFGNVNEVKLEEIWQSSE
FT                   YLNLQKNYLNYELCKTCNMRKPLVN"
FT   gene            617934..619589
FT                   /locus_tag="WRi_005760"
FT   CDS_pept        617934..619589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005760"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95353"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0R361"
FT                   /protein_id="ACN95353.1"
FT                   /translation="MKDSEYLKSIRVSPCERFHQLSENPLYKNRFIRVDKFHEPGLAPV
FT                   YDETGAYHIDAMGEAIYRDRFLKTFGFYCNRAAVEDDTGYYHIDPSGCRVYKHSYQWIG
FT                   NYQEDICVIRKHDKFFHIDLNGNRVYEQEYNYVGDFKDGIAVVHKDGKATHINNHGKLV
FT                   HNKWYKKLNVFHKGFAIAEDKHGWFHIDINGNPVYRQRFKMVEAFYNGMAKVETFEGVL
FT                   GQIDITGNVKFSIFDLDKESQVHKISAELSAFWKTYLANVAIELDLLNILPATMPVLSQ
FT                   KLNIIVPNLERLLRALWEIGFIDYDKNKDLWQLSSKGKCFKEIPFLPKAAAMWARVAAE
FT                   KNWLKIADILRQESISSFESFKEKETSEDRKIAFYQALLGYSRFDTKEFNSRVNIDGAK
FT                   NILLFGVHSLFLAYSDIHNKGSIGLYYYNEHKVPRQAVEDLKIKLITQEELSATNYELG
FT                   VFCRFLQHYDDNKVLSYLKLVKNKGIPRVLVIETILDYYSPVGGSVDINVMVETGGKLR
FT                   TLSDWKRILKQVKGLKIFSIVPLTDYLSVIDIRC"
FT   gene            619593..620582
FT                   /locus_tag="WRi_005770"
FT   CDS_pept        619593..620582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005770"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95354"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C0R362"
FT                   /protein_id="ACN95354.1"
FT                   /translation="MKALQKNGFFIIKNLVPLELITQSLNDIISKISKLSQELGVSTSD
FT                   YLNCTGRWGTSSQVTRIVSQVLDKIIKNYLEKSLQCQILQKKSNVICKTADLIDAVPFH
FT                   QDISYSFNDPYHFSVWLALNNVNKTSGALQVIEDSHNWKIQPLVDFWHPYFLDQYSDNR
FT                   ENYKIKSLPISAGDAIVFDSRLWHGSDKNIDAKDRFAYVTRWVVKDKSLPCVPKPQPSV
FT                   FGILNCGALTEFILREYLSLFRRQESIKTKNMEELIKSWLAFITDTTTNISEVNTAEAK
FT                   RDLYKLLILNQASALHDAGDISGKIYKNLWFSLLVFLNKKVNVVELAL"
FT   gene            620583..622358
FT                   /locus_tag="WRi_005780"
FT   CDS_pept        620583..622358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005780"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005780"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95355"
FT                   /db_xref="GOA:C0R363"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0R363"
FT                   /protein_id="ACN95355.1"
FT                   /translation="MNKSRVGSFKYILVFILNILSKFKLNVLVMFLVALVVAVDLSFRK
FT                   YLVKNILDTAVKYQEGNVIENLLLPVSAYVCMALLITTAFRFYGYFVDIRMFTSMRQKI
FT                   ADMSFYRLLQQDHSYYQNNLSGSLVYKVSNLMDSVIELIRLLIDCFFSYSIALILAIYT
FT                   LSLVNIKFAIATFIWVNIFILISVFSFRVLTGLADDHSKQSSQVIAGIADSILNVISVR
FT                   LFSRQAHERHKFFQVCKKKTIAERKLQWAYFWLWFIYGYSFDILQAVNLYFLIHDYQLN
FT                   KIAIGDIALVLGINISIIEFLNHLTRNLTQFSTHFGKVSDALPILTTVPEIQDKENAKK
FT                   LNLLSGRITFNNVSFSYEGQKSLFQDFSVTINPCEKVGLVGYSGGGKSTFINLIIRLFD
FT                   VKKGNIQIDNQVVSEVTQSSLRQQISVIPQEPLLFHDTILANIIYGKLQSTIEEIIRAA
FT                   KLAGIHDFIMTLPDQYETVVGEKGIKLSGGERQRIIIARAFLKNAPILFFDEPTSQLDS
FT                   ITEKTIQMSLFKLMENKTTITIAHRISTLLHMDRILVFNKGKIVQDGKHAELVSKQGLY
FT                   KELWNAQIGCLNGKK"
FT   gene            622360..623409
FT                   /locus_tag="WRi_005790"
FT   CDS_pept        622360..623409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005790"
FT                   /product="L-allo-threonine aldolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005790"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95356"
FT                   /db_xref="GOA:C0R364"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:C0R364"
FT                   /protein_id="ACN95356.1"
FT                   /translation="MEKIIDLRSDTTTLQSSNVIHAISNATVGDFAYGEDKSCNDLSEY
FT                   CKQLFKVEEALFATSGMLANRLAIASQTSPGDELITHYNYHVNFFDSAGNAKVNNIVFN
FT                   CIRNNSGILDVAEVEYAINSKPRYKIFAQVSLVSIENSINGFNGKIYPFEKQVELYHFL
FT                   KAHNVNLHLDGARIFNAHVETNIALADYAKYVDTMSFSFTKGLGAPFGSMLMGKREIIE
FT                   RAKKLQVWLGSGYHQIGYCANAAKYVLQNNISRLKEDNKLAKLFADKIKEIPHIKLVLP
FT                   YPETNIVSFSIKALNVTNEVFLSKCQAYGLLLFPWLESHIRAVTHLGTKETDIMKAAEI
FT                   IKEVVLNLI"
FT   gene            623406..624458
FT                   /locus_tag="WRi_005800"
FT   CDS_pept        623406..624458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005800"
FT                   /product="L-allo-threonine aldolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005800"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95357"
FT                   /db_xref="GOA:C0R365"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:C0R365"
FT                   /protein_id="ACN95357.1"
FT                   /translation="MRVKIDFFSDSNTDPSAKMREAMAKAKVGNEAACEDPTVNELVAT
FT                   ACKILGKPAGIFLISGTMSNVIAYKVHIQRPGDYLLLDETSHPLIVQSGLIAAQAHATP
FT                   LPIKGTRGIFTGEQIVEFITRPSLRNIPRVGLVSIEQTTNFGGGAVWPLEYIQEISSLC
FT                   KENDVFTHLDGARLFNACAHTKISPKEYASYFDSVFIDFSKGLGAPMGAILLGSEDFIE
FT                   KAWYYKFQIGGGMHQAGIISAACLYALRNNVNSLEEDHKKMQHLIEGLDSIDQVIIDID
FT                   LYKTNIAYFSLRTNCISTQELINVLMTNYGIRMANIKGKIRAITHRDISYEDINTTVSA
FT                   IRKILSNFLH"
FT   gene            624586..625731
FT                   /locus_tag="WRi_005810"
FT   CDS_pept        624586..625731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005810"
FT                   /product="Major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005810"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95358"
FT                   /db_xref="GOA:C0R366"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0R366"
FT                   /protein_id="ACN95358.1"
FT                   /translation="MLLYLSRQSIPIALPLLIDTDHVKLSYFFACFSFFYGVSKFVNGI
FT                   IMDSKNNPLFMFGLCNIATGLLTIGITLSYNNLTLLLLTLILLAWTQGLGWPAITKFMV
FT                   TNSSISSIASSWGVMSASQQLGSCITLIVLPSIIKIYNAKSAFLYSGFLCLLFGIYIIL
FT                   KAYYKESANFTTYYKVQKSQIGIKVTSSIWFLCCATFCAYIIKMGIFFWFPIILKNKLQ
FT                   ISLVQSSLITGVYDLGGILGTLITGRISDMYFFQNRSLLASLYMLGIALTFIAMNFGQN
FT                   IILMNLCAILSGFFIFGVQVLTGVIAVEIAPQNNVCAIVSLTGLFGYIASSIFSCVLLG
FT                   VLVKHCGNSIMFSFFSICSVVALVCFSILSSKDLKKLSKAV"
FT   gene            complement(625749..627056)
FT                   /locus_tag="WRi_005820"
FT   CDS_pept        complement(625749..627056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005820"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005820"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95359"
FT                   /db_xref="GOA:C0R367"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R367"
FT                   /protein_id="ACN95359.1"
FT                   /translation="MYITIIGIGYVGLVSCAMLSEQGHNVDCIDINTKKIELLKLGKIP
FT                   IYEPGLADYLENNIKLQRIRFFDSYSQINPNTEVVFVTVDTPSDSLGNANLQNVYNAVS
FT                   EVSERVNQDCLIVIKSTVPPGTAENIYNYLSNKGYNFDLGVNPEFLKQGSAVSDFLYPD
FT                   RIIIGVKTKLARAKLEVIYRSFIDKNIPLIVTDTVTAEMIKYASNAFLATKVAFINEMA
FT                   GLCELLGADIDLLANSMGMDHRIGKEFLKAGPGFGGSCFPKDLSALIRLAEDHNVKLQI
FT                   LNSVKESNYNHITNIAKKVEYVLNGVQNKKIAIWGLTFKSGTDDVRNSPAIDIAQLLVN
FT                   NKAKITAYDPMGMDNARQVLKDIEYADNAIGAARDAEALLLLTEWKEFKNQDFASLKSI
FT                   MAAPNVFDFRNLLDSELLLRYGYHVYSLGKKSIYKV"
FT   gene            complement(627121..628035)
FT                   /locus_tag="WRi_005830"
FT   CDS_pept        complement(627121..628035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005830"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95360"
FT                   /db_xref="GOA:C0R368"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0R368"
FT                   /protein_id="ACN95360.1"
FT                   /translation="MDHRLRAYLLGVTWFILSLLSSVANDTISKYLSLHLQSFEVIFFR
FT                   FLFSTITLVPFMLYYGREAFKTSQISIQITRGVLLFVGITLWTYGLAIFPIVTATIISF
FT                   SIPLFVILLAIPLLNENIIWQRWSVTVIGFVGIAITTKAYSEDFNPKILIFIVSTLIFA
FT                   ILDILNKKLAIKESVISMLFYSALTTTIFSTVPLLFYWHLPSLLELVLLLILGINSNLI
FT                   LFFTLKAFTLADATALAPYRYIELIISAIVTYVMFNELPDKSALYGILILIPSTLFIVY
FT                   SESKVIKKNNVCNARVKIYDSNC"
FT   gene            complement(628519..629430)
FT                   /locus_tag="WRi_005840"
FT   CDS_pept        complement(628519..629430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005840"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005840"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95361"
FT                   /db_xref="GOA:C0R369"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0R369"
FT                   /protein_id="ACN95361.1"
FT                   /translation="MFVSVSDISSISYKIGQKIEDSRLMRGHTQVELASEIGLTYQEVN
FT                   SYENGYIPIPIEVLYVIARVLSVNAIDLLPEPVIVREDSYEDEEILYLTKIYENQKLGK
FT                   IVPSLVRFVHISEKINQEEARLEIAKNLVKEGVSVDIISQATGLSIYEYDNTEREICTD
FT                   SIYYRIGQRIREWRLIRRYTQKDLADKVGVTLKEIHEYERGYTTILFDKLYEIAGALSV
FT                   NIKVLLPETRESKKLLSLINEYREPESLDALVKSLSEDMKSGKEKVKKAEKIRVAKNLA
FT                   KAGVAIDIIVRASGLTADECEN"
FT   gene            complement(629456..630364)
FT                   /locus_tag="WRi_005850"
FT   CDS_pept        complement(629456..630364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005850"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005850"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95362"
FT                   /db_xref="GOA:C0R370"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0R370"
FT                   /protein_id="ACN95362.1"
FT                   /translation="MVLFVEKSLDYKVGEKLKSWRLERGYTQKDLAEKLGVKYWVILQY
FT                   EKGNRRISIERLYAITEALSISITDLIPISKSCLEDEGEEILNLVREYKKINDQELRKM
FT                   FCLLTNFVQVSEKSSKKAEKIKIAKGLVKAGVSVDIVAKTIGLSADECVEEKGGSIYCQ
FT                   IGKKIKEWRLVREYTQKDLVEKMSTTRDEISNYEQGRTAVPLDKLYEMAEALSINITDL
FT                   LIEEGSKVKNELPDLIKEYKEIESQELRHALIKSLFEGIRICEEKVREIERIKVAKDLV
FT                   KGGISIDIILQIIGLSVDQIA"
FT   gene            complement(630440..631573)
FT                   /locus_tag="WRi_005860"
FT   CDS_pept        complement(630440..631573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005860"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95363"
FT                   /db_xref="UniProtKB/TrEMBL:C0R371"
FT                   /protein_id="ACN95363.1"
FT                   /translation="MTSKDRNKKTNVNHKKIFGALEGVDIKQSKFVSKINNQKEINREA
FT                   SPSRNIRENKINYGKSLDYVYGTKPLNDQAEDLNPFASNLQKIKPSASESEKLSWFKSA
FT                   VVETKNVNALHKVIEQVLASGARVNACNDGEWSFAEYMILGTHFHRLEKSDRKKIMRKL
FT                   MLSGAEFHDTLLQNKLIGEIYNELQPEVQPQIDERLEELEKAGESAVQEGELIDVEIDN
FT                   TTSYIEFSGNSKVEVAKILRELGSNILKMGNNAVEIRREEGGARNYVDVSDGSSVVLEF
FT                   PTSLGKLNIVLYQDVKNCSQVQVKVADKEMWAELQKRGEEIGKNCLFGGVKLKKVVERG
FT                   NFTRCGIWSEKQKEVSEKLFSWADKVRENSKETCRAL"
FT   gene            complement(631674..632330)
FT                   /locus_tag="WRi_005870"
FT   CDS_pept        complement(631674..632330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005870"
FT                   /product="DNA repair protein RadC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005870"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95364"
FT                   /db_xref="GOA:C0R372"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C0R372"
FT                   /protein_id="ACN95364.1"
FT                   /translation="MNKSKEEIEFRILESKGKALLDREIMETFLSAVHESPQAQEIAKN
FT                   LVNTYTGVGRILGREMDDLKVIEGVTDSAVAMIMCVKETLERVLKEKLKSEPIMDLQGI
FT                   VEYLNVSIGHSERECVKILYLNKRRQLIGEESYIGEMEKAPVYIKEITRKALMKNATSI
FT                   IMSHNHPGGSLEPSEEDQAVTKSLAAACSTVSVKLFDHIIITSGGYFSFRENGLL"
FT   gene            complement(632500..633411)
FT                   /locus_tag="WRi_005880"
FT   CDS_pept        complement(632500..633411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005880"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005880"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95365"
FT                   /db_xref="GOA:C0R373"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0R373"
FT                   /protein_id="ACN95365.1"
FT                   /translation="MANISIRYKIAQKVRSWRLKRGYTQKDLAGKIGVTYQVVLQYEKG
FT                   TRKISIEKLYAIAEVLSVGIIDLIPVSSEKICLKNEEEEILNLVRKYKTINDQELRKVF
FT                   YLLTKFTRVGEKSSKKAEKVKIAKGMVKAGISVDIVSQAIGLSANECVEEKTGSIYYQI
FT                   GKKIKEWRLVREYTQKDLAEKMDTTRDEISNYEQGRVAIPLEKLYAIAETLSISITDLL
FT                   IEEDEIVESELPDLIKEYKKIESQELRYALIKSLFESIQICEEKVKRAEKMKIAKDLVK
FT                   GGISTDIILQITGLSLGEIQQI"
FT   gene            633541..633984
FT                   /locus_tag="WRi_005890"
FT   CDS_pept        633541..633984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005890"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95366"
FT                   /db_xref="UniProtKB/TrEMBL:C0R374"
FT                   /protein_id="ACN95366.1"
FT                   /translation="MALSKFLDPKNDISFKRIFGTEKNKDILIHFLNDILGFAGTNAIQ
FT                   DIEFLSTIQDPDIASKKQSIVDVLCRDKNGLQVIVEMVRPESLRSYCLKGEEFIQKETE
FT                   RILKLIEPDVLPSESTHQCELGNQLVPSDADNEPPLDKEDAQS"
FT   gene            complement(634137..634370)
FT                   /locus_tag="WRi_005900"
FT   CDS_pept        complement(634137..634370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005900"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95367"
FT                   /db_xref="GOA:C0R2N3"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2N3"
FT                   /protein_id="ACN95367.1"
FT                   /translation="MEVCSFSRELMLQILSISLQNGIRFLHYPLPAHPSAFLAGCLPYR
FT                   RKYRLILFLLSYNSGLGGFSIPVELLFAYIQK"
FT   gene            join(634422..635654,637145..637459)
FT                   /pseudo
FT                   /locus_tag="WRi_p05910"
FT                   /note="reverse transcriptase, putative; disrupted by
FT                   IS-insertion"
FT   gene            complement(635896..636918)
FT                   /locus_tag="WRi_005920"
FT   CDS_pept        complement(635896..636918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005920"
FT                   /product="transposase"
FT                   /note="ISWpi7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005920"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95368"
FT                   /db_xref="GOA:C0R2Q0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q0"
FT                   /protein_id="ACN95368.1"
FT                   /translation="MINNFLGIDVSKERFDVSLSFISKKGKRETRKRKFKNDDTGFQGL
FT                   LNFLQKHNVEEVKACMESTGCYSEALAEFLHNAGYFVSVVNPACIRFYAKSKLTRQKND
FT                   QTDAEIIADYCQRQEPSRWTPPSPEKKKLKHLYRCSNALKDELTLANNHLEKKERLPKE
FT                   VANAWEDLAMNIEQKIETIKNSIRELLKQHKELLEDFQLLLTIPGIGEETAIAILAEIP
FT                   GIKAFINARQLAAYAGTIPQNITSGSSVHAKPRLSKTGSRTLRKAMYFPAIAAKKHNPI
FT                   IMASCERLKEKGKHAMAIVGAAMRKLLHIVFGVLSSKKAFDPDHIKNYRAKRLTEGLVL
FT                   "
FT   gene            637456..638184
FT                   /locus_tag="WRi_005930"
FT   CDS_pept        637456..638184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005930"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95369"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:C0R377"
FT                   /protein_id="ACN95369.1"
FT                   /translation="MKDKPVREKKDLDKGLKRSVGKPACCVSKGGSSSNTTSLPNQVAK
FT                   TKGFEKRAQYYAAKAYSRQADKGDQYQGLKEIIFIAIADCILFPNKSEYKSDHVMLDKD
FT                   SYEHDLKDFYFTFIELPKFPKTKEDQLESIVEKWIYYFKYADETSEEELEKIIGSDVII
FT                   KKAYEELNRFNWSEKEFIAYEQEIKRIRDERAVLEQKLDDAKKEGKIEVAKTMLANNVD
FT                   VTTIVKFTGLSMSEIKELQN"
FT   gene            638324..639706
FT                   /locus_tag="WRi_005940"
FT   CDS_pept        638324..639706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005940"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005940"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95370"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95370.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            complement(639781..641168)
FT                   /pseudo
FT                   /locus_tag="WRi_p05950"
FT                   /note="phosphoglucomutase/phosphomannomutase family
FT                   protein; disrupted by frameshift"
FT   gene            641170..642687
FT                   /pseudo
FT                   /locus_tag="WRi_p05960"
FT                   /note="hypothetical protein, truncated; disrupted by
FT                   IS-insertion"
FT   gene            complement(642930..643952)
FT                   /locus_tag="WRi_005970"
FT   CDS_pept        complement(642930..643952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005970"
FT                   /product="transposase"
FT                   /note="ISWpi7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005970"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95371"
FT                   /db_xref="GOA:C0R379"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C0R379"
FT                   /protein_id="ACN95371.1"
FT                   /translation="MINNFLGIDVSKERFDVSLSFISKKGKRETRKRKFKNDDTGFQGL
FT                   LNFLQKHNVEEVKACMESTGCYSEALAEFLHNAGYFVSVVNPACIRFYAKSKLTRQKND
FT                   QTDAEIIADYCQRQEPSRWTPPSPEKKKLKHLYRCSNVLKDELTLANNHLEKKERLPKE
FT                   VANAWEDLAMNIEQKIETIKNSIRELLKQHKELLEDFQLLLTIPGIGEETAIAILAEIP
FT                   GIKAFINARQLAAYAGTIPQNITSGSSVHAKPRLSKTGSRTLRKAMYFPAIAAKKHNPI
FT                   IMASCERLKEKGKHAMAIVGAAMRKLLHIVFGVLSSKKAFDPDHIKNYRAKRLTEGLVL
FT                   "
FT   gene            complement(644216..645154)
FT                   /gene="trxB"
FT                   /locus_tag="WRi_005980"
FT   CDS_pept        complement(644216..645154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="WRi_005980"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005980"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95372"
FT                   /db_xref="GOA:C0R380"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0R380"
FT                   /protein_id="ACN95372.1"
FT                   /translation="MKNYKFSTKVLIIGSGAAGYAAAIYAARANLEPIVVTGMQPGGQL
FT                   TITTDVENYPGFVSIQGPELMEQMRLHAEKVGAKIIDDEIKSVEQLEDSNEYRFRSSGN
FT                   TNDYYSDAIIIASGAQAKWLGLKSEKEFQGYGVSACATCDGAFFRNKVVAVIGGGNTAV
FT                   EEAIFLTRFAKEVILIHRRDKLRAEKVMQDRLFKNDKIKVMWNHTVEQILGEENPKRVA
FT                   GIAIKSAETQELKVDGVFIAIGHAPNTGIFKGFVEMDEQGYIITKPGTTLTSRAGVFAA
FT                   GDVQDKVYRQAVVAAGTGCMAALDAEKFLES"
FT   gene            complement(645141..645740)
FT                   /locus_tag="WRi_005990"
FT   CDS_pept        complement(645141..645740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_005990"
FT                   /product="antioxidant, AhpC/Tsa family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_005990"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95373"
FT                   /db_xref="GOA:C0R381"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0R381"
FT                   /protein_id="ACN95373.1"
FT                   /translation="MNLVTKSAIDFTASSVLSDGEIVDDFCLSKRIKNKYAVLFFYPLD
FT                   FTFVCPTELISLNNRINEFAKRGVEVIGISVDSKFSHYKWRNTPVNDGGIGEISYTLVS
FT                   DIKKSISRDYGVLYDDSIALRATFVIDDKFIVRHQSINDLPLGRNIDEFVRIVDAIKHN
FT                   EEHGEVCPAGWKKGKPAMQASDEGVADYLNSYSEEL"
FT   gene            complement(646689..647561)
FT                   /locus_tag="WRi_006000"
FT   CDS_pept        complement(646689..647561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006000"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95374"
FT                   /db_xref="UniProtKB/TrEMBL:C0R382"
FT                   /protein_id="ACN95374.1"
FT                   /translation="MTKNISIISRNLISIELVNKQDLENFIKIFTVLDKHIAAKTLFTE
FT                   EVRIEYKQHNGIEVVELLKDTDFTYHEVENVLNHLSKHGMKVPSSVIAHTLFAAYNHAL
FT                   EFKDVAFSFSEGSPQFNIRVSKNTFIITPMSEENLELNSQSSKKLIESLQSEKNIYDCI
FT                   VEENTIKVIVHSEIHQAINLIIKSLIKSRLLAKEEEGKFKEKLRQLAFKDQAFVEYSSI
FT                   KTISRYPHNHPLRKHESVTKDIENILCDFIANENSEFAIERLNRLSSAVSPDTPRIITK
FT                   TIDKLVKFH"
FT   gene            complement(647677..648015)
FT                   /locus_tag="WRi_006010"
FT   CDS_pept        complement(647677..648015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006010"
FT                   /product="glutaredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006010"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95375"
FT                   /db_xref="GOA:C0R383"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0R383"
FT                   /protein_id="ACN95375.1"
FT                   /translation="MKNVVIYVKKGCPYCIRAKDLLDKKGVKYEEIDVLKNSDLFNDIK
FT                   SKYNVRTVPQIFINDKHIGGCDKLMDLEKEGKLDDMLNNNDNHTDVTTYTNSNDECGEC
FT                   VIPHDDFM"
FT   gene            648084..649016
FT                   /gene="ribF"
FT                   /locus_tag="WRi_006020"
FT   CDS_pept        648084..649016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="WRi_006020"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006020"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95376"
FT                   /db_xref="GOA:C0R384"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C0R384"
FT                   /protein_id="ACN95376.1"
FT                   /translation="MKIIYNCEQGIENNIALTFGNFDGIHLGHEFAISTLKKVAQEREL
FT                   PSAVLTFEPHPSTVLFGRNNFRLIDQEQKKELISSYGIDYLYIINFNRGFSEVSCDDFI
FT                   SEILIDKYGAKHIIVGENCTFGHKRLGNILTLEKYSEIYGYSLTKLEPLTIDGKICSSS
FT                   SIREYVQRGEIEIANKLLGRPYQVSGVVTKGACRGREIGFPTINIPIEDCMIKPKFGTY
FT                   YARVTFPDSNPNWLYGVVNIGMRPTFKDLKKPIIEMHIFDFDEDVYSHKVNIQLLKFIR
FT                   SEKKFHSIEELTKQINYDILKVYRLKANL"
FT   gene            649013..649489
FT                   /gene="lspA"
FT                   /locus_tag="WRi_006030"
FT   CDS_pept        649013..649489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="WRi_006030"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006030"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95377"
FT                   /db_xref="GOA:C0R385"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:C0R385"
FT                   /protein_id="ACN95377.1"
FT                   /translation="MKKLCLVVILIIVLIDQTSKLYINSLIDEGESIEIASFIKLVEVW
FT                   NSGISFGMCSALPHGGFFFSAFSILIIGILAYLIYKSDDQSTYLGFSLMIGGAIGNVVD
FT                   RIYWGAVYDFIYFHIDDWYWPAFNLADLSIVCGMFTLLYKWYIYDMLISKQNEE"
FT   gene            649519..650859
FT                   /locus_tag="WRi_006040"
FT   CDS_pept        649519..650859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006040"
FT                   /product="peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006040"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95378"
FT                   /db_xref="GOA:C0R386"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C0R386"
FT                   /protein_id="ACN95378.1"
FT                   /translation="MLHKFFSFLILPVLFFTYPISSNALNIEHNIKYTKLSNGLDVYVV
FT                   SNHRIPAVLHAVIYKVGGMDDPIGKAGLAHYFEHLMFETTGKFTDIEATMSSIGAQFNA
FT                   FTTKEYTCYYELVPKKDLPLAMEVEADRMGSFNVTQDKIDREKNIVLEERKMRFDNHPN
FT                   NLLWEEMNSAFYRTGYGRSVIGWESDIKTYNLDDITRFHDNYYHSGNAILLIVGDVELD
FT                   EVVKLAEEKYGEIKAKPVMRNYPNQDPVHNAGLSVTLESTEVKEPVLYFRYRVPLFEHI
FT                   NEASAAHLAVEILGSGKSSKLYNDLVLDEDVAVSVFAYYNSLAFSDGYIDIQVIPKSGV
FT                   NLDIVERELDNAINNFMSKGITDEELQSSKYRYKAAQFDNLSDLTHIAMFYVPHLALGI
FT                   PLDEIDISYSKIDDVNLEDVNNKIRTIFSSNKLIGRLLPKGDNNENK"
FT   gene            650846..652165
FT                   /locus_tag="WRi_006050"
FT   CDS_pept        650846..652165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006050"
FT                   /product="peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006050"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95379"
FT                   /db_xref="GOA:C0R387"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:C0R387"
FT                   /protein_id="ACN95379.1"
FT                   /translation="MRISKFVLLFFFCLSFNLQASGSLNIEEVTTRKGFKFLFVENCAL
FT                   PKVSLNISFKDAGYVYESAEKQGLAWFTSLVIQEGAGENDAKDFAKKLKIKGINLLFYP
FT                   DLESFGVSLETLSENLEESISLLSDAIIRPKVDSEGLNRVFEKAKVDFNNLEKNPYFVA
FT                   GKELDTLLFKKHPYSKSVYGTLDTIMSITRDDVLTYIKRNFAKDNIVISVAGCTKKEEI
FT                   ITLLDKYLSKLPSKRSKVRKIPVKNDFGSAESKNIFMDIPQSVILFAQKGIAYEDPDYY
FT                   NAQVLVNALGGMGLNSVLMKELRQNLGITYGISASMASYTHANIIAGGLSTDSSTASQS
FT                   ISAIRDTLSRIKKEGIDEQLFKDTKISMVNNFIFSLSNNANTAVFLASMQVRNRDINRL
FT                   NNFVSLINDVKLEKVNELASSLLEPENLFFVEVGKNAQGQ"
FT   gene            complement(652159..652725)
FT                   /locus_tag="WRi_006060"
FT   CDS_pept        complement(652159..652725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006060"
FT                   /product="phosphoribosylglycinamide formyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006060"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95380"
FT                   /db_xref="GOA:C0R388"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C0R388"
FT                   /protein_id="ACN95380.1"
FT                   /translation="MKKIKLGILISGRGSNMQALIEACQDQNFSAEVACVITNNSEAAG
FT                   LKIAEQAGISAFIVKDKPLDAGKIHEILVQHKVDLICLAGFMRILKADFLSKWHNKVIN
FT                   IHPSLLPSFKGLNAQEQALKAGVKITGCTVHYVTPEVDAGAIIAQVVVPVLPADDIQSL
FT                   SERILAEEHKCYVEAVRSIAESINY"
FT   gene            653030..653446
FT                   /locus_tag="WRi_006070"
FT   CDS_pept        653030..653446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006070"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95381"
FT                   /db_xref="UniProtKB/TrEMBL:C0R389"
FT                   /protein_id="ACN95381.1"
FT                   /translation="MSKLPNNAKIGKSQVTQWEVIKNCEYADNCLSKIVTLYVIRITQL
FT                   SDFYTSDEPEINTVLARISVTSENVFLNKATTIEVMEGIFPYKFNSKKRNNILRLEDLY
FT                   NYLCSIVNNSLPKEMLESLVREYKDAVNLFKAIT"
FT   gene            complement(653439..653969)
FT                   /locus_tag="WRi_006080"
FT   CDS_pept        complement(653439..653969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006080"
FT                   /product="Na+/H+ ion antiporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006080"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95382"
FT                   /db_xref="GOA:C0R390"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:C0R390"
FT                   /protein_id="ACN95382.1"
FT                   /translation="MKNLNFRKEIKFFSLSFIILFVLWTVLSGYFEPFFIFCGVFSCIF
FT                   TSFIFRRLINAERALSQILNSTSRLSFYKLVSYIPWLMYQIILSSVYVTKKVLQLKSKL
FT                   EPIIILRKCKGHNDESIALFANSVTITPGTLTINVESKQKTYFSTMYLIDKDLESGISE
FT                   IENKILKILRSVK"
FT   gene            654038..655885
FT                   /locus_tag="WRi_006090"
FT   CDS_pept        654038..655885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006090"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006090"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95383"
FT                   /db_xref="GOA:C0R391"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R391"
FT                   /protein_id="ACN95383.1"
FT                   /translation="MLKDITTKLYLLSEEVMEYNKFMEILKKINDLSDLSKDNIVEKIK
FT                   AKLQEEDPDLCQEWEKSKPDNDSGSGINYIFTISRGQNSKEVKLLHLASYWNCANVAKA
FT                   LIENGADINAEHDNKITPLHIAAHYGHEDVVTILTGKGAIVDAKNGDGWTSLHFAVEKN
FT                   HKNVVNTLIGKGANVNAENDKGWAPLHLAITNGHKEIVQVLSKAEGINVDAKNSDGWTS
FT                   LHLAAANGRKDIVETLIEKGADVNAKDHYKWTPLTFASQKGHKAVKEALLKAQENIKAL
FT                   HSAVKHNNEEEVKNLLNKGVNVNAKDDDGCTPLHLAAREGHKDVVDILIAKGAKVNAEN
FT                   DDRCTALHLAAENNHIEVVKILVEKADVNIKDADRWTPLHVAAENGHEDIVKTLIAKGA
FT                   KVNAKNGDRRTPLHLAAKNGHEDVVKTLIAKGAEVNAKNGDRRTPLHLAAKNGKIKVVE
FT                   VLLHTEADPSLKDVDGKTPRDLTKYQGIIQLLEEAEKKQTLKNENKKTPKDLTENKDVM
FT                   QLPEKKEEKQIGKNAIVKEKEQSAKNAIVKGVIVCFVTAVIVGVALAFATALSVPAIIG
FT                   LAAGSALIVGAGQYIMSKPKTEMKEVKELVPRETEKALT"
FT   gene            656006..656455
FT                   /gene="smpB"
FT                   /locus_tag="WRi_006100"
FT   CDS_pept        656006..656455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="WRi_006100"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006100"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95384"
FT                   /db_xref="GOA:C0R392"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R392"
FT                   /protein_id="ACN95384.1"
FT                   /translation="MEVIAENRKARFEYFILEEFEAGMVLLSSEVKSLRERKVNISDAY
FT                   VVEKNSEVWLHNMHIAEYKAANRKNHKPKRERKLLLHKKEINKLIGQIKTAGITVVPLS
FT                   VYFNDKGFAKTKIAIVKGKKLYDKRATIKQREWDREKSRLSKNNL"
FT   gene            656462..657253
FT                   /gene="lgt"
FT                   /locus_tag="WRi_006110"
FT   CDS_pept        656462..657253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="WRi_006110"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006110"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95385"
FT                   /db_xref="GOA:C0R393"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R393"
FT                   /protein_id="ACN95385.1"
FT                   /translation="MSLNPVIFSIGPVSIYWYSLAYVLGIVFAYWYLHRLDDQKIFTKN
FT                   FYDSLLTATIVGIILGGRLGYVLIYDPVLYISNPIEILKTWEGGMSFHGGAIGVLLAVI
FT                   ISCRRHNIPIFYALDLVSCGVPIGLFLGRIGNFINGELFGRVTTMPWGMVFPESGDNLL
FT                   HHPSQLYEALFEGLLLFAVANSLFFLTRIRLYHGALTGIAVMWYGIARFFVEFFREPDY
FT                   QIGYLWLDLTMGQLLSIPMVLLGMLVYLGALNLKFNTKSVT"
FT   gene            657944..659689
FT                   /locus_tag="WRi_006120"
FT   CDS_pept        657944..659689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006120"
FT                   /product="type I secretion system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006120"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95386"
FT                   /db_xref="GOA:C0R394"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C0R394"
FT                   /protein_id="ACN95386.1"
FT                   /translation="MEITPSIKKELKQSTLYICLEKCKSAFWFIFWFSAGINLLMLFLP
FT                   LYTSQVLDRVISSESVSTLTMLTIITLSAFACSAMLETCRYLAMAKIGDWIDKTATPDL
FT                   IVRSIRLTSVQSSTSSGEAIRDLGVIKNFITGNGIFSLFDTPWSLIYLVVIFMIHTSTG
FT                   FIAITGIIILVSMAIWNELATKRILQETNEETIRNINAIDVATRNAEVVEAMGMSEFIV
FT                   SDWCKRNDQNRAMQIKAQNRSNVITGITKFLRSTLQISVIGTGALLAITAHKTAGSIIA
FT                   ASILMGRVLAPFDAAVHTWKFLNQARMSYGRLQRLILTSPKREQTMALPEPEGKLEFDR
FT                   VFFTPYGSNKPTVKGISFIIDPGDVVGVIGASASGKSTIAKLTVGVWKPISGVVRLDGA
FT                   DVYTWNRENFGNYVGYLPQDIELFNTSVKANIARMRPDPNPEEIIKAAKIAGIHELILS
FT                   LPNGYDTIIGGPGGVTLSGGQKQLLGLARAFYGHTKLLVLDEPNANLDSNGEACLINAI
FT                   GIARKQNTTTVIITHKLPLLSVVDKVILMSDGVIYAMGPKDEILSKLVAPSSSTTEDER
FT                   SSANG"
FT   gene            join(660051..660143,661632..662978)
FT                   /pseudo
FT                   /locus_tag="WRi_p06130"
FT                   /note="hypothetical protein; disrupted by IS-insertion"
FT   gene            complement(660369..661408)
FT                   /pseudo
FT                   /locus_tag="WRi_p06140"
FT                   /note="transposase, degenerate; disrupted by frameshift;
FT                   ISWpi7"
FT   gene            662983..663591
FT                   /locus_tag="WRi_006150"
FT   CDS_pept        662983..663591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006150"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95387"
FT                   /db_xref="GOA:C0R395"
FT                   /db_xref="UniProtKB/TrEMBL:C0R395"
FT                   /protein_id="ACN95387.1"
FT                   /translation="MTISQLKRKATIQFISYLLLSVGLIGLLTYVVIYNEKIYNKNQIE
FT                   IDKIRFINLQITEIQKKEVILNKNLDLWKKISSSNLHSSRYIANLNFELSKLYKKYYIL
FT                   EPEISISIPEEVELHNKSERTKVIKSEVALNLSSISDKHIFLFLQSIPNLPGYVMIKSL
FT                   ILNKQRNIDAATMNQILNGNMIEIVRANIVFDWYTILSR"
FT   gene            663596..664402
FT                   /locus_tag="WRi_006160"
FT   CDS_pept        663596..664402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006160"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95388"
FT                   /db_xref="UniProtKB/TrEMBL:C0R396"
FT                   /protein_id="ACN95388.1"
FT                   /translation="MNIKLFFIFTLLISNVNAYCSCEDIIESIGICKKYSCRQYIGNED
FT                   FIEHKILGLNSGNLCVYIEKQGNDEMVCHHSQYGMMIEKRYFESILKVGNQEIDDFIDI
FT                   ANLRAKECFFINNQKLSYTDRDDIIREAVESDFDVLSQYSNVKSIFFDEEPVNKMVHEM
FT                   EKFNLWSSKAAKEENFNCKVVSLDSILYLSPDTWKIWVNGKLFINTKDLKVHSVTENYV
FT                   TFVWTVDQKAIKKHANDSQNVYFGYGSIMFTLYPKQKFNLDGLSIK"
FT   gene            664416..664489
FT                   /locus_tag="WRi_t06170"
FT   tRNA            664416..664489
FT                   /locus_tag="WRi_t06170"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGG"
FT   gene            664557..665039
FT                   /gene="ssb"
FT                   /locus_tag="WRi_006180"
FT   CDS_pept        664557..665039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="WRi_006180"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006180"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95389"
FT                   /db_xref="GOA:C0R397"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C0R397"
FT                   /protein_id="ACN95389.1"
FT                   /translation="MSGGTINKVILVGNLGKDPEIRTTQNGKEMASFSIATSESWTDKF
FT                   SGTRSEKTEWHNIVIFSEGLVKIVKDFARKGSKVYVEGSLRTRKWTDQNGGERYTTEVV
FT                   LYNFNSALTLLDSRNSAPNSDYKPSEYKQGETEQKDKHESFDNDIKDELLDDEIPF"
FT   gene            665142..666005
FT                   /gene="dapA"
FT                   /locus_tag="WRi_006190"
FT   CDS_pept        665142..666005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="WRi_006190"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006190"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95390"
FT                   /db_xref="GOA:C0R398"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:C0R398"
FT                   /protein_id="ACN95390.1"
FT                   /translation="MQVKAENGVVLLGSTGESLSLTDSEKRTLVEFVCKLKLNTKIIIG
FT                   VPGVNLYQTLEWLDFCKGMPIHGYLMTTPIYAKPGIMGQTLWFEKLLEKAHVPAMFYNI
FT                   PSRAGVSLYAETIRNLSSDEKFWAIKDSSGTVDTLAQYKKVAPNIEVFCGDDNMISDMA
FT                   AYGAAGLVSVASNVWPRIAHEYVKKCLNDELSSLSFQRVTLESRRKPVQMTENDMKSST
FT                   DIWQQACEALFTASNPIPTKALLHDIGLIEHKTVRLPLSTEDLPSVEKLRQVNKMILGW
FT                   KELATL"
FT   gene            complement(666044..668032)
FT                   /gene="ligA"
FT                   /locus_tag="WRi_006200"
FT   CDS_pept        complement(666044..668032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="WRi_006200"
FT                   /product="DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006200"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95391"
FT                   /db_xref="GOA:C0R399"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R399"
FT                   /protein_id="ACN95391.1"
FT                   /translation="MTNLEKMREKLQDQINYHNVLYHQKNKPEISDAEYDELKKKLAEI
FT                   EPEIYATQESVGAPPDERFSKVEHQEPMLSLENAYDEQGVEKFLSKIKRFLIEDKIEIL
FT                   CEPKIDGLSFSAIYEDGRFVKAATRGDGFVGEDVTHNVATIKGFPKFLQGVQGRLEVRG
FT                   EIYISNSDFLKLNENDEFANPRNAAAGSLKQLDANITASRPLRYFAYSLIGGAEKSQSE
FT                   VLNKLEALGFCVNEHQSLTSSLDGMLKFYNEVYNCRYNLDYDIDGIVYKVNDLVLQNRL
FT                   GNTHKAPRSALAYKFSAVYAKTKLNKIFIQVGRTGVLTPVADLVPVNIGGVLVSRASLH
FT                   NQDEIKRKDIREGDIVTIKRAGDVIPQIVEVSRDSRLPNTPEFVFPEVCPECGSKVRQV
FT                   EGEAAVRCPEEFACKAQIIEKLKHFVSKDAFDIVGLGDKQIEFFYDLGLIKQIPDIFTL
FT                   EERLDEFNLEEQSGWGKKSIAHLLNAIQSRRVITLDRFIFSLGIRFIGQVAAELLADYY
FT                   VSYDNWYNSMIELSSDNTELVGIDGIGKKVAESLESFFSKEHNIKMLNDLTACLQILPV
FT                   SSNSSNSVLNNKIIVFTGKLLAMSRGEAKVRAKTLGAKVSSHLSAKTDYLIAGEKPGSK
FT                   YKKAVELGVEILDEDQWHKVISLGVFK"
FT   gene            668247..669569
FT                   /gene="gltX"
FT                   /locus_tag="WRi_006210"
FT   CDS_pept        668247..669569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="WRi_006210"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006210"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95392"
FT                   /db_xref="GOA:C0R3A0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3A0"
FT                   /protein_id="ACN95392.1"
FT                   /translation="MLTRFAPSPTGYLHVGNVRTALVCWMYTRNQNGKFLLRFDDTDLQ
FT                   RSDVKYINDIIQDLKWIGINWDASFKQSERFERYNEVFLQLIKEGHIYACYETREELDI
FT                   KRKLQLKQGLPPVYDRSALLLTEQEKISYEQEGRRPHFRFKLDRNEVVKWNDEVKDEIN
FT                   IATSSISDPVVKREDGIYTYMLPSVIDDVDFNVTHVVRGEDHVTNTAVQLQMIKALKAK
FT                   IPTFAHLSLLHFDDSKISKRTGVLNIKSIKEDEIEPMALVSYLVKLGTSNPIEACACMQ
FT                   SLIDSFNIKKFSSASVQFSLSEIYKLNSKVLQQMPFEMVQDRLNQIGVDSSEFWYFIRN
FT                   NIERFSEVAKWWKICKSDIEPVILDKELIKIAFNALPQGDCNENTLSEWVKTIRQTVDI
FT                   KAKNLFTQLRSALTGTETGPELAKLLIFIGKENIIARLKEK"
FT   gene            670114..673590
FT                   /locus_tag="WRi_006220"
FT   CDS_pept        670114..673590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006220"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006220"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95393"
FT                   /db_xref="GOA:C0R3A1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3A1"
FT                   /protein_id="ACN95393.1"
FT                   /translation="MIRGLAEFVKEVFCILTLDLRNLIGFCSHENYVLMSKLMLSFFVD
FT                   LKFLMFIHLRVHSVYSLLESSVKIEELIGLCLRNKMPAVAITDSGNLFGSLEFAEYAAS
FT                   RGIQLIIGCNIIVKHSEQNLPILLLAKNEQGYTNLVTLVSESFRKRKNNSDIPYVDFDE
FT                   LLNLSTGLIALTGGCLAQLLLGQDKETVEKLLSAFNGHLYVELQRHGLSKELELEETLI
FT                   DFAYQRNIPLVATNDVFFPNRSDYEAYDILTCISEGSYALENNRKKLTTEHYFKSVAEM
FT                   EELFSDIPEAIHNTLVIAKRCSYMPRSRQPILPKFPCRENKTENEELREQAVAGLEFRI
FT                   ANETDIDLKQYYDRLNYELSVITSMNYAGYFLIVSDFIRWSKANGIPVGPGRGSGAGSI
FT                   VAWGLQITDLDPIKFGLIFERFLNPDRISMPDFDIDFCQEKRDLVIDYVQKKYGYVAQI
FT                   ITFGKLQARAVLRDVGRVLQMPYSQVDKISKMVPFNPVNPVTLSQAIEFDQNLQKERDS
FT                   DEVIAKLLDISLKLEGIYRHVSTHAAGIVICDQKLENFVPVYYDPNSALPITQYSMKYV
FT                   EKAGLIKFDFLGLGTLTLIDHVCRLINRDRQKIDISSVPLDDQKTYEMLSSGDSIGVFQ
FT                   LESSGMREALIKLKPDCIEDIIALISLYRPGPMDNIPTYVARKHGLEKPDYIHPLLEEV
FT                   LKETFGVIIYQEQVMEIARILSGYSLAEADLLRRAMGKKIKEEMDKQRELFIQGATKNG
FT                   VDYDRASYIFDLVAKFAGYGFNKSHAAAYAVISYQTAYLKANYPLEFFTALMNLNIDDR
FT                   DKLNLFYHAAKFSGVTVLSPDINKSQAEFSIEDERIRYGIAALRNVGFSIAEGIVNVRS
FT                   SACKDIWEFIQNSGHIINKRALESLIKSGAFDSVHKNRKQLYESMDTLIYFANKNKQDR
FT                   ESSQAALFGSLDVLKPKLENVEDFDEEEKLEHELFSLGFYLTNHPLEKFRTLLEKLNIG
FT                   FIGENRTAKTAGVILNARMRTSERGRFVILTLSDPHNVSEIAFYNNEIIEEKRDLFSPG
FT                   TFVIIDLEASENTTRLAGKDISEFTKRVTSTIKELVLTTECTDSQKAAMELNAILKDEG
FT                   RTKIMLKLLLEKHKVSILLPGAYSIAPQVIYEISNLSWIKGVEINTNNLLI"
FT   gene            673639..674412
FT                   /gene="rpsF"
FT                   /locus_tag="WRi_006230"
FT   CDS_pept        673639..674412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="WRi_006230"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006230"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95394"
FT                   /db_xref="GOA:C0R3A2"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3A2"
FT                   /protein_id="ACN95394.1"
FT                   /translation="MNLYEFTFIAQQGLLQQEVEEMVQELAVLLKNIKTDVMFQQIRDI
FT                   LKKGNDKLTKQELEVRAENIKESLVAYSDFLEDLTKILWVELEEDLSNLKEVKSKIDKE
FT                   LKDDLKDLGITQDFTKFLGGSTKSAFIHNAVNALKRNISEHLIKIFQDILKDFRINGPT
FT                   QSSKALEMLLKNIEASGLIKYEHWGLLDFAYHTNKMKSGHYCIMCISSTASILDEFVRR
FT                   MKLNENVIRHFPVQVDKIFEGKSYMMNKQIEEQSA"
FT   gene            674412..674687
FT                   /gene="rpsR"
FT                   /locus_tag="WRi_006240"
FT   CDS_pept        674412..674687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="WRi_006240"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006240"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95395"
FT                   /db_xref="GOA:C0R3A3"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R3A3"
FT                   /protein_id="ACN95395.1"
FT                   /translation="MMKRRNSFNNSYVSVNNRTGFRRSKVCPLAASKDEDIDYKNIDLL
FT                   SKFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLALIPYCTKKV"
FT   gene            674695..675249
FT                   /gene="rplI"
FT                   /locus_tag="WRi_006250"
FT   CDS_pept        674695..675249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="WRi_006250"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006250"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95396"
FT                   /db_xref="GOA:C0R3A4"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R3A4"
FT                   /protein_id="ACN95396.1"
FT                   /translation="MLIILKENIRTLGKLGEVVKVKPGYARNFLFPQRKAVKATKENLT
FT                   KLEEQRLLLEEENIKRLNVAKELALSLHDKFVVLIKQASEDGKIFGSVTTREIAKILLQ
FT                   EGHVIDHRSLSFGGISIKNLGEYQVNVELHSEVVVPITIYVVKSETDANELRQVKLQNQ
FT                   KSEQQEAEQDANKEAADGDDS"
FT   gene            675486..676778
FT                   /gene="purB"
FT                   /locus_tag="WRi_006260"
FT   CDS_pept        675486..676778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="WRi_006260"
FT                   /product="Adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006260"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95397"
FT                   /db_xref="GOA:C0R3A5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3A5"
FT                   /protein_id="ACN95397.1"
FT                   /translation="MIPRYSRKEMSSIWEENNKFNIWLKIEKLACEAQAKLGVIPNNIA
FT                   ENLSGAIEFDVECINEIESIVKHDVIAFLTYIAKKAGVDVRYLHYGMTSSDVLDTCLAV
FT                   QLKESCDILLENLKNLLAALKKKAEDYKDIVCVGRSHGMHAEPTTLGIKFARFYAEFKR
FT                   NYQRLISAQKEISICKISGAVGNFANVDPFVEEYVAKEIGLIPEIISSQVIPRDRHAMF
FT                   FSVLGVIASSIENVAVEIRHLQRTEIGEISEHFSTGQKGSSAMPHKCNPILSENLTGLS
FT                   RLIRSYVFPALENVALWHERDISHSSVERCIAPDACITMDFALVRLTDLIDKLVINKEN
FT                   IEKNLNSSKGLVFSQRVLLELVNSGLAREEAYKIVQSNAMKVKQNNSDFLAELKQDKPL
FT                   LKVINSEKLESLFDLKYYTKHIDRVYNKVFN"
FT   gene            676778..676850
FT                   /locus_tag="WRi_t06270"
FT   tRNA            676778..676850
FT                   /locus_tag="WRi_t06270"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            complement(677021..678277)
FT                   /locus_tag="WRi_006280"
FT   CDS_pept        complement(677021..678277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006280"
FT                   /product="araM protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006280"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95398"
FT                   /db_xref="GOA:C0R3A6"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3A6"
FT                   /protein_id="ACN95398.1"
FT                   /translation="MHYLKQILHQAEQTFLREVITDYHLADDIYEICTRHGNDIFLVAD
FT                   ENTAKLLNKNVFNKISHLIIPAPPVIPVSRAGMTPGGEMTPSRAASLETVNLVRNKVKD
FT                   SDLIVAFGSGTVNDICKYASYLEKKDYISFPTAASMNGYTSANASILVNGYKKSFKAHL
FT                   PRAVYIDIDILVNAPLRLTLSGFADFICRSTVQADWLLSHLLLGTEYNELPFTLVRDLE
FT                   QILLREYTALTKRSRKVVLLLMEVLLISGLGMVISKGSYSASQGEHMIAHAMEMVTRDH
FT                   SLLHGEKIAVTTITMANLQEKILSIQNPIIKPTTLDVEHITQCFDNIEFVRTFEQKQIM
FT                   QQKIQEIICKEWHNISSLIKQNLLPAKHLQKIFEDLSIPHLPEHLSWNKEQYCKVVDLA
FT                   FTTRDRFTFLDLANCIEES"
FT   gene            join(678320..679441,680932..681006)
FT                   /pseudo
FT                   /gene="dapE"
FT                   /locus_tag="WRi_p06290"
FT                   /note="succinyl-diaminopimelate desuccinylase; disrupted by
FT                   IS-insertion"
FT   gene            complement(679465..680847)
FT                   /locus_tag="WRi_006300"
FT   CDS_pept        complement(679465..680847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006300"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006300"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95399"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95399.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            complement(681124..681762)
FT                   /gene="nth"
FT                   /locus_tag="WRi_006310"
FT   CDS_pept        complement(681124..681762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="WRi_006310"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006310"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95400"
FT                   /db_xref="GOA:C0R3A8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3A8"
FT                   /protein_id="ACN95400.1"
FT                   /translation="MDSKKVELIFEKFQQSNPAPKIELNYTNDFTLLVAIVLSARTTDI
FT                   SVNKITKELFSITDTPEKMLSFGQSELRKCISSIGLYNSKAKNIIGLSKILIERYNSKV
FT                   PTDFDDLVSLPGVGRKSANVFLNSGLGIPTLAVDTHVFRVSNRIGLVKEKDVFKTEQSL
FT                   LNVVPKKYLLYAHHWLVLHGRYVCKAQKPSCETCIIHDLCEFECKRYKV"
FT   gene            complement(681784..683085)
FT                   /locus_tag="WRi_006320"
FT   CDS_pept        complement(681784..683085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006320"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95401"
FT                   /db_xref="GOA:C0R3A9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3A9"
FT                   /protein_id="ACN95401.1"
FT                   /translation="MGQHFKLTGQEFCDNADLFNVLEVEAKQVVDKNYEELSAILKKQH
FT                   KQLILVNHPDKGGDKNRFDQIYKAYQELKKYIEPLESGNPCVKVSIGAESDGRLTAREF
FT                   HYRKNLFNKLKVSEEEAVGKDFDGLISILKRNDYSFEKDLEKRIELEDKIERILQNPNL
FT                   DDFEKNVKSAGLMEELYQYIAKPSIQLFNYVTPLGKKRSLIEEDKKTLALKFIERKNAL
FT                   LFIRTLSVLPLGLLTTITIGCYFSWWIIALNIIISNASRLLIGHYMKKYANSEISTDEF
FT                   MSKINYIALGSKLLINYPLAAFSVYLLTTNFIANRLTVGGTILGSLLLLAVLIEMLAPV
FT                   FSKGCEIYAEKHTKDLLEEDPRDRVQKETDLLGWYDPRKLLMPIVMPLVKKCFAEVASE
FT                   FAERNFDEVKTDMSDVNAKGLSKPKGIEFAQQPV"
FT   gene            complement(683169..684605)
FT                   /locus_tag="WRi_006330"
FT   CDS_pept        complement(683169..684605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006330"
FT                   /product="isocitrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006330"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95402"
FT                   /db_xref="GOA:C0R3B0"
FT                   /db_xref="InterPro:IPR014273"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="InterPro:IPR040978"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3B0"
FT                   /protein_id="ACN95402.1"
FT                   /translation="MSTPITVAYGDGIGPEIMEAVLSILRGAEAKISIDIIEIGERVYS
FT                   KEWSHGISPSGWESIERTKILLKSPTTTPQGKGHKSLNVALRKNLGLYANIRPCISYHP
FT                   VIENKFGKFDIVVIRENEEDVYTGIEHRLTGDSYQCTKIITRSGSEKICRYAFEYAKKH
FT                   NRKKVTCLTKDNIMKMTDGTFHAAFDRIAKEYQDIKAEHYIVDIGMARVATEPENFDVI
FT                   VTENLYGDILSDIVAQTSGSVGLAGSSNIGNEYAMFEAVHGSAPDIAGKNIANPSGLLN
FT                   AAVHMLIYIGQVGTAKLIYDAWLKTLEGGIHTADLYKEKRSKQKVGTKEFAEAVIDNLG
FT                   KKPAELTIGSGSDSKINLDSKINKVQDNYEQDYKVKKLVGSDITLAWDKSSNVDQIVGL
FT                   FESSNPQIIAIYSKGLAIWPGSSKSSSDQITCRFIANSEKKPITNSDVNDLLIKLEENT
FT                   FDVVRMDKLYLYDGKEGFFS"
FT   gene            684749..685228
FT                   /locus_tag="WRi_006340"
FT   CDS_pept        684749..685228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006340"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95403"
FT                   /db_xref="GOA:C0R3B1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3B1"
FT                   /protein_id="ACN95403.1"
FT                   /translation="MDTKVSYAGILRRVSACAIDGVLWMIIALVSLLFLNYDVDDISTH
FT                   RIILMATLLITYIVFNILTITKYGCTPGRLLCGVRIKDANTFKNVTLMQATIRYIFREG
FT                   IWVIYNFLSYLLPSYVSGCLFIILTLVLMFAIFDQRKQTFYDKVANTVVIDYKPS"
FT   gene            685251..685727
FT                   /locus_tag="WRi_006350"
FT   CDS_pept        685251..685727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006350"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95404"
FT                   /db_xref="GOA:C0R3B2"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3B2"
FT                   /protein_id="ACN95404.1"
FT                   /translation="MDKNVNYSTMTRRILAFIVDCILFIAIPFALMAVGFSLTHAIQGI
FT                   MGAIIVITTIVFSLFLMIPCIFHIFMLVKFGGTLGHLLFSMRVRDKDTLEQITLIQAIK
FT                   RTIAFFIIYCISLYNPILLLAILILVLVCAVDDEHKQAFHDKIANTVVIDYKPS"
FT   gene            complement(685893..687296)
FT                   /gene="rho"
FT                   /locus_tag="WRi_006360"
FT   CDS_pept        complement(685893..687296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="WRi_006360"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006360"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95405"
FT                   /db_xref="GOA:C0R3B3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3B3"
FT                   /protein_id="ACN95405.1"
FT                   /translation="MTTINEDVLAKGKVTAQPEKSEQIYNNDTVKQMVNEGTEKNRKTL
FT                   DLSELKEKTAEELLELAEERKISTNGKSNGRMLKQEIIFSLMKKMSEEGGITTGSGIVE
FT                   ILPDGFGFLRSASANYAPSTDDVYISNGQIKKFNLRTGDMAYGEIRPPGDKERYFTLTK
FT                   VQSINSTEVSELRKYVHFDNLLPLYPEESIVLECNNGDDKKGLSMRAIDIVAPLGKGQR
FT                   ALVVAPPRTGKTVLLQQMANSIAINHPEVELIVLLIDERPEEVTDMIRSVKGEVVSSTF
FT                   DEPAYRHVQLAEIVIEKAKRMVEHKKDVVILLDNITRLARAYNAVIPSSGKVLTGGVDS
FT                   NALQRPKRFFGAARNIENGGSLTIIATALIETGSKMDEVIFEEFKGTGNAEIILDRKLS
FT                   DKRIFPAIDITKSGTRKEELLVDKAILNKIWVVRRILNPMGPVEAMEFLRDKLLLTKSN
FT                   ADFFNSMNH"
FT   gene            complement(687496..688098)
FT                   /locus_tag="WRi_006370"
FT   CDS_pept        complement(687496..688098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006370"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95406"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3B4"
FT                   /protein_id="ACN95406.1"
FT                   /translation="MGDAFLMSMESSKGNNDRNKQFLVQIVAWLVDNTGLTFNQIAQCC
FT                   RLALEEVQDIADEEIEVEKYNPIISGIITEKEIDDCKKNPNRVPNLIIKNIKKRSKAIG
FT                   SILGFASTARRRDKPDAIYYLVKKFPILDNNVIAKLISTTNYTVEQVRDGSHHNMQNIK
FT                   PQDPVLLGLCSQENLEAEVEKAKVEEEKQERLKKYKE"
FT   gene            688406..690205
FT                   /locus_tag="WRi_006380"
FT   CDS_pept        688406..690205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006380"
FT                   /product="peptidyl-prolyl cis-trans isomerse D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006380"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95407"
FT                   /db_xref="GOA:C0R3B5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3B5"
FT                   /protein_id="ACN95407.1"
FT                   /translation="MNVKNFFTKVTVVLLACLLIFVGVGNLLSGDDEKEEVARVGKEVI
FT                   TSDEYKSLYQNYGKQISGSDASREQVKKLKYDLLNALIEQKLLFNLTSELGLTVGEESI
FT                   KNHIKNTKYFQNDKGEFDKNKFHETLNDLHMTEKEYIAKLEKILPAMMFMTSLFKDNYP
FT                   VTFGEKIDEQIYNSRYQTRVVDIVKITEDAVTNIPEPDDQTLLDLYERNKSHFYYPEYR
FT                   TAQYISLEQKYFEDQIKISDEEVDGIIEQQELRDQRDIFNIIFSTKEEAETARRAFEEG
FT                   KTSFEQIVEEFGKAELEETRVNNITKDFLPEDMREKVFALKVGEVSEVLASSFGWHIIK
FT                   VESAHQISDEDLVDLKKDIKSVLTNQKSFERVNDFINQVNYKIYNGSAIEEILSEYNLP
FT                   IQTIGPVDASGKDQSGNNVGDSSDLISFIFSREKDQKGYFKGVGDAVVSVKIIDIVPPK
FT                   SQSFEEGRASAVELWQSEFIKERMFKIGQEFAVQLREKTDWEKIQGVELVEDQQMHRNE
FT                   QNYPFSFVEEIFNMKTTGSVTDPIQYNNEIIIGVLKEMHSSNGKLNMLDTGKRVMISLK
FT                   EQLISYLESKYKVEVNHAILDDI"
FT   gene            complement(690541..691563)
FT                   /locus_tag="WRi_006390"
FT   CDS_pept        complement(690541..691563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006390"
FT                   /product="transposase"
FT                   /note="ISWpi7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006390"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95408"
FT                   /db_xref="GOA:C0R2Q0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q0"
FT                   /protein_id="ACN95408.1"
FT                   /translation="MINNFLGIDVSKERFDVSLSFISKKGKRETRKRKFKNDDTGFQGL
FT                   LNFLQKHNVEEVKACMESTGCYSEALAEFLHNAGYFVSVVNPACIRFYAKSKLTRQKND
FT                   QTDAEIIADYCQRQEPSRWTPPSPEKKKLKHLYRCSNALKDELTLANNHLEKKERLPKE
FT                   VANAWEDLAMNIEQKIETIKNSIRELLKQHKELLEDFQLLLTIPGIGEETAIAILAEIP
FT                   GIKAFINARQLAAYAGTIPQNITSGSSVHAKPRLSKTGSRTLRKAMYFPAIAAKKHNPI
FT                   IMASCERLKEKGKHAMAIVGAAMRKLLHIVFGVLSSKKAFDPDHIKNYRAKRLTEGLVL
FT                   "
FT   gene            691789..692469
FT                   /pseudo
FT                   /locus_tag="WRi_p06400"
FT                   /note="hypothetical protein, truncated; disrupted by
FT                   IS-insertion"
FT   gene            692991..693747
FT                   /pseudo
FT                   /locus_tag="WRi_p06410"
FT                   /note="transposase, degenerate; disrupted by frameshift"
FT   gene            694055..695071
FT                   /locus_tag="WRi_006420"
FT   CDS_pept        694055..695071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006420"
FT                   /product="transposase"
FT                   /note="ISWpi2"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006420"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95409"
FT                   /db_xref="GOA:C0R2M9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M9"
FT                   /protein_id="ACN95409.1"
FT                   /translation="MSQACKVMGYSRDTFYRFKELYENGGEEALHEISKKKPLLANRVS
FT                   DDIERAVIGIATEFPAYGQERAANELRKRGIIISQGGVRSVWLRNDLETLKKRLKALET
FT                   KVAQDGIILTEEQLAALEKVKEQREAHGEIETQHPGYLGSQDTYYVGNIKGIGRIYQQT
FT                   FVDTYSRVAMVKLYTDRTAITAADLLNDRVIPFFDEQKIPLLRILTDRGTEYCGKPENH
FT                   AYQLYLGIENIDHSRTKANSPQTNGICERFHRTMQDECYNIIFRKKIYSSLEDLQIDVD
FT                   HWLRSYNETRPHSGKYCYGKTPMQTFLDSKYIAFQKNISSITQEPDISFDYLNSSVS"
FT   gene            complement(695237..696244)
FT                   /locus_tag="WRi_006430"
FT   CDS_pept        complement(695237..696244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006430"
FT                   /product="peptidase, M22 family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006430"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95410"
FT                   /db_xref="GOA:C0R3B8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R3B8"
FT                   /protein_id="ACN95410.1"
FT                   /translation="MKTILAVETSCDETAVAIVNSDKQVLAHEILSQAEHKKRGGVIPE
FT                   IASRAHMEHLSGLIKSAVEKSNLNFCDLNAIAATSGPGLIGGLIVGTMMAKAIAHVAQK
FT                   PFIAVNHLEAHALVIRLLHEVKFPFLVLLISGGHCQFLIAQDVGKYIKLGETLDDSLGE
FT                   AFDKVAKMLGLSYPGGPLIEKLAKKGNGARFKLPRAMIKRYGCNFSFSGIKTAVKNLVQ
FT                   ELKMSEQDVCDVCASFQECISDILLDRVSNAIIMAESLNIKINDFVITGGVAANNFLRE
FT                   KLKQHINLNIFFPPNDLCTDNAIMVGWTGIERLQKNYIDPLNFAPRPKWELESY"
FT   gene            complement(696720..697457)
FT                   /locus_tag="WRi_006440"
FT   CDS_pept        complement(696720..697457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006440"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95411"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3B9"
FT                   /protein_id="ACN95411.1"
FT                   /translation="MLIRNLIKQATQVGSSENAIRYVEYLYQFEKFRNTLNLTLSLIKQ
FT                   NRLSFEIYQEGLVDMEEGVCKTIRSSSVNRYVIVLRKSNPYIIVHELSHMVENELNLNL
FT                   EQEFLHKVYQDIEQNLKQANILVQKIIGQVIFKEIQAYQTAKSRASELFARYFELFAWA
FT                   QEVYPKDKEYLIRTQDLNKVFLATGQWKKSYLDSQMMERIDKEIKEYSNKTATKDVTKV
FT                   QSSWTNKFSPGGKKISSIFGDDD"
FT   gene            complement(698327..699463)
FT                   /locus_tag="WRi_006450"
FT   CDS_pept        complement(698327..699463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006450"
FT                   /product="aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006450"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95412"
FT                   /db_xref="GOA:C0R3C0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3C0"
FT                   /protein_id="ACN95412.1"
FT                   /translation="MSPFSLENSGCVYADYNATAPISENVKKSIFEVLLKQTLNPSSLH
FT                   KRGQEARKILQDARDNVRGAIGVSSDKEIVFTSGATEANNLVMRGIAGYLHVISAIEHP
FT                   SILNSACNPYIIPVNQEGIVDFLELEKILSELKGNKAIVSVMMANNETGVIQPIEEIAE
FT                   IAHKFGAICHTDTAQSVGKIKVNMEDLGVDLLTLSAHKFGGVAGSGVLIFNKELAIEPI
FT                   IIGGGQEKGFRGGTENIVAIAGLSAALQNIPDLLSKMDEVKELRDQLECELLNFASDIR
FT                   IFGKNSKRLPNTSFIYMPGVKSDVQLMHFDLNYIAVSNGSACSSGKVEPSHVLLAMGAT
FT                   KEQAECSIRISIGPETKPQDIKKIVDCWYNIYKQNTLV"
FT   gene            699619..700317
FT                   /locus_tag="WRi_006460"
FT   CDS_pept        699619..700317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006460"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95413"
FT                   /db_xref="GOA:C0R3C1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3C1"
FT                   /protein_id="ACN95413.1"
FT                   /translation="MVEVFLNNATRKIEGEYHQSKDANAPVVLVLHHHPQYGGHMDSKI
FT                   VHSTYTSFIDNNFSALKINFRGVGKSTGTFDKGIGELTDAAVAIDWLQEHNPSNVPIWI
FT                   AGFSFGAWVAMQLTMRRPEIVGFIALSLPVTKYDFSFLSPCPVSGLIIQSSNDTISEES
FT                   DVTELAKRLINSVRSDHMKYHIIDDTNHFLKDKEEEVTQIVDNYIKLRLNSATISSQKV
FT                   KKEVRVKEYA"
FT   gene            complement(700556..701230)
FT                   /locus_tag="WRi_006470"
FT   CDS_pept        complement(700556..701230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006470"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006470"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95414"
FT                   /db_xref="GOA:C0R3C2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3C2"
FT                   /protein_id="ACN95414.1"
FT                   /translation="MGGNVALELTSVDKSFKNNSAVVKDINLSVTRGQVVALIGDSGAG
FT                   KTTILQIAGLLDKPTSGIVTIDGINCTQASNKHKTHVRRNFLSFVYQFHYLLQELSVLE
FT                   NIMLPQLIAGKSKAEAKKNSQAMLEKFGLENKASSMVSEVSGGERQRVAIARSIVNSPK
FT                   LLLADEPTGNLDPTNSFKVFLLLHSYVKENNSSMLIVTHNHLLAEKADCIFQLRDRSLV
FT                   KL"
FT   gene            complement(701270..701737)
FT                   /locus_tag="WRi_006480"
FT   CDS_pept        complement(701270..701737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006480"
FT                   /product="HesB/YadR/YfhF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006480"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95415"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3C3"
FT                   /protein_id="ACN95415.1"
FT                   /translation="MSTNYNINLTDNALKKIHSLAEQEGDKSSILRVAVSGGGCSGFKY
FT                   NFLMDQMNKNLSLDDEDDDYDDEFDDEDEDDDYDYEESEDYRSHSSFSEKGKDIVINDE
FT                   NGNPVLMVDNCSAKFLNNSVIDYTEDLSGSGFQIKNAFAKSQCGCGNSFSV"
FT   gene            701785..702984
FT                   /gene="dgt"
FT                   /locus_tag="WRi_006490"
FT   CDS_pept        701785..702984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="WRi_006490"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006490"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95416"
FT                   /db_xref="GOA:C0R3C4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3C4"
FT                   /protein_id="ACN95416.1"
FT                   /translation="MSNNNFLLNYACFPSKTKGRYFKEPEDENRSCFQRDRDRIIHSNA
FT                   FRKLEYKTQVFINYEHDYYRTRLTHSLEVAQIARSIARRLGLNEDITECIALAHDLGHP
FT                   PFGHAGEDALKKSVQDLNLDNEKYEFDHNVQAIRILTYLEQKHADFDGMNLSWEVIEGV
FT                   AKHNGPLLGQNAESSTSNQLLLEYNKKYDLKLEEFSSIEAQVASIADDIAYSVHDLDDA
FT                   LRANLVTIEDLLNVPLIEKMFKDIRSRYSELPQSKLIHESLSGTIGTMISDVVSQTERN
FT                   IEDHKIKSVEDVRSLNKMLVTFSPEVASATKEMKRFNMEKIYRSYKLSRTMNKAKRIIQ
FT                   ELFQCFYENPGLLPTEWSKLACESQRSVIICDYISGMTDRFAIHEHRRIFDTSYEMTSF
FT                   "
FT   gene            702984..704066
FT                   /gene="ribD"
FT                   /locus_tag="WRi_006500"
FT   CDS_pept        702984..704066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="WRi_006500"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006500"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95417"
FT                   /db_xref="GOA:C0R3C5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3C5"
FT                   /protein_id="ACN95417.1"
FT                   /translation="MTDDHFMSIALRLAEKNLGNVAPNPAVGCVIVKDGTIVSEGYTGI
FT                   GGRPHAEVVALQNAKDSTHGATIYITLEPCCHHGVTGPCTAKIIKASIKRVVIATIDPD
FT                   SRVSGRGMKALKEAGIEVEQGIMQKEAKELNVGFFTTKELHRPFIACKVATTLDGKIAT
FT                   FTGDSKWITSENTRNWVHELRTKYDAIMIGSNTLINDDPLLTCRLPGLGSRSPIRLIID
FT                   SQGRLKEEHNIAKTADKVITWVITNKEVEKKIKNINYLVVNSSNAGKVCLKDMALKLVS
FT                   EIGITRLLVEGGGVLITELLKCNLIDRLIICRSGKILGNDATPFVGDLGIQFINNCYQF
FT                   KKTKIIEFSEDIVEVWDRSS"
FT   gene            704179..705494
FT                   /pseudo
FT                   /locus_tag="WRi_p06510"
FT                   /note="transposase, degenerate; ISWpi5"
FT   gene            complement(705678..706358)
FT                   /gene="rpe"
FT                   /locus_tag="WRi_006530"
FT   CDS_pept        complement(705678..706358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="WRi_006530"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006530"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95418"
FT                   /db_xref="GOA:C0R3C6"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3C6"
FT                   /protein_id="ACN95418.1"
FT                   /translation="MSIKIAPSILSADFAKLGEEVRKISDLGVDYIHIDVMDGNFVPNI
FT                   TIGPSVVSAIRKYSNLPFDVHLMVTSPGNHIESFINAGADIITVHAEAEIHLERLIRKI
FT                   KSYKNVNDEKKPIQVGVSIVPSTSPSVLEYIIHELDIVLIMTVNPGFGGQEFIHSQLNK
FT                   ISTIKKMIQERNLKTQISVDGGINFSNAADIIKAGADILVAGSAIFKAEDIKKAVNDLK
FT                   NLLL"
FT   gene            complement(706470..706898)
FT                   /locus_tag="WRi_006540"
FT   CDS_pept        complement(706470..706898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006540"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95419"
FT                   /db_xref="GOA:C0R3C7"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3C7"
FT                   /protein_id="ACN95419.1"
FT                   /translation="MKIQCYNCTKTYLVSPKQIGASGRKVKCTHCNHIWHEYLEEVSNK
FT                   SHSANIQEKKVSGRNFLQNLAFTTLAFATATGLCIVIANGIFPREMNKAYKTISSYKDS
FT                   ISYKLGYKKEQTESPNVKKLAVNKFYQDYLFLSNLRSS"
FT   gene            706974..707804
FT                   /gene="dapD"
FT                   /locus_tag="WRi_006550"
FT   CDS_pept        706974..707804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="WRi_006550"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006550"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95420"
FT                   /db_xref="GOA:C0R3C8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3C8"
FT                   /protein_id="ACN95420.1"
FT                   /translation="MEGLQLKKTQSEIKDIWKNREKFNDCNLKKTARIAIKEVIELLDS
FT                   GKIRVAEKLSSGEWVVHKWIKQAILLHFLTEENKIIDNTNCWFDKIGNKFSEWNEEKFR
FT                   RLKIRAVPGCFVRRSAYIGTNVVLMPSFINVGAYVDSGTMIDTWSTIGSCAQIGKNCHI
FT                   SGGVGIGGVLEPIQASPVIIEDNCFIGARSEVAEGVVVREGSVLGIGVFIGASTKIIDR
FT                   ETSKVFYGEVPPYSVVVPGSIPSKNNISTYCAVIVKKVDEKTRSKISINEILRD"
FT   gene            complement(707811..708095)
FT                   /locus_tag="WRi_006560"
FT   CDS_pept        complement(707811..708095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006560"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95421"
FT                   /db_xref="InterPro:IPR021277"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3C9"
FT                   /protein_id="ACN95421.1"
FT                   /translation="MAESIKKFTVQCDFKGQSSPFAIYIGNPKSDAHPIHHQDSWLVKE
FT                   RGGNIPNKVKESLQKLYKLSQENGVSFSELCAYAITVVSNNDKKSDDKQ"
FT   gene            complement(708096..708488)
FT                   /locus_tag="WRi_006570"
FT   CDS_pept        complement(708096..708488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006570"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95422"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3D0"
FT                   /protein_id="ACN95422.1"
FT                   /translation="MSNSASVMDDKNTDYVALIPQDDSIEYKFEEAVNFIENKVINADG
FT                   LTLAEVFQVLVQMLNGDLELVKKVLACANIMAKHGMKVAKESQLSRADVRRALEGRESV
FT                   VNRQDFIKKPPLPPAIKSTKKKSRGL"
FT   gene            708569..709618
FT                   /locus_tag="WRi_006580"
FT   CDS_pept        708569..709618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006580"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95423"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3D1"
FT                   /protein_id="ACN95423.1"
FT                   /translation="MLTYIHELIDKSQGSISISDFMNAVLYHEKYGYYTSKLPLGKDGD
FT                   FTTAPEISQLFGEVIAVWIMHTWEKLGKPSKFSLVELGPGKGTLIHDIIRVTKKYSSFF
FT                   NSMLIHLVEISPTLRKIQKEKLKSLDVNWHKNIDNLPEQPTIFLANEFFDALPIDQFVY
FT                   HDEGWYENMVTKQDDGSLLVSCQCVTLESRKKESWIPVSATQMTNGKFFNGAVVEICSV
FT                   GVEILKKLEKKIYNNKGAALIVDYGYVYPAYKSTLQSIKQHKYANFLENVGNSDITALV
FT                   NFQALRDSLKHVDCEILTQREFLYLFGIKERTQALMKSASDEQKNRIFSEFLRLTENMG
FT                   TLFKAMLLI"
FT   gene            complement(709996..711447)
FT                   /locus_tag="WRi_006590"
FT   CDS_pept        complement(709996..711447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006590"
FT                   /product="phage uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006590"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95424"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3D2"
FT                   /protein_id="ACN95424.1"
FT                   /translation="MNFLKFIELCFQTVVPGCEYNDYQYIKVIADRLEAASAGEVKRII
FT                   FNMPPRSMKSLCASVAWPAWILGNQPTARIIVASYSQRLSEKHSLDTRCVMQSSWYRAL
FT                   FPEIELSKDQNTKYKFQTVQRGYRIATSVGGTLTGEGGDFIIVDDPLSSAQALSETLRK
FT                   RATNWFDQTLVTRLNDRKKGVIVLVMHRLHQEDLTGHLLSKPKNIWHHICLPMISENKQ
FT                   VIYSIKKPIPPVPIIRVAQHCATRRLYNKPASPVRILYSREEGQLLYPLDGGKEEVEII
FT                   KAELGSYAFAAQYQQNPLPLSSGIIKPEWLKRYKKFPDNLSHITQSWDTAVSTSNMSNF
FT                   SVCTTWAKIDNKFYLLDVYRAKLEYPKLKEQVLSLAARWTPHAILIEAKTSGQQLVQEL
FT                   KTNSDLPIIEIVPHDDKLTRFHRIAPMIESGKVFLPHQAVWLNDFEYEILMFPETRHDD
FT                   QVDSTVQYLQWVRNSTSRVAAIRAL"
FT   gene            complement(712437..714011)
FT                   /locus_tag="WRi_006600"
FT   CDS_pept        complement(712437..714011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006600"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006600"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95425"
FT                   /db_xref="GOA:C0R3D3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3D3"
FT                   /protein_id="ACN95425.1"
FT                   /translation="MWTKNKVFNRRAFILGGIQLTISAVFSCRLYNLQIRNRQKYEALS
FT                   NSNRIRVATIMPKRGKILDRNSIELAVNKISYVVLFDGSGKEVDLQTLSEVESKIAKSS
FT                   EKITALYKRYYPFGSMCSHVIGYTKRQQGISEVGISGIEYTYDHILKGKSGKSEQEINS
FT                   KKRVIKELSSIPQQDGQDVQLTIDINLQEKTAEVFKDHQGSAVVIDVNNGEILALYNSP
FT                   SYDNNLFASRLSNETWESLNAPSLPLVNRALSYQIPPGSIFKVIVALAGLKDGIITPEE
FT                   KFSCKGYMKIGERKFRCLKSKVHGYVSLNEAMALSCNTYFYNIGKKISVDSLVEMARKF
FT                   GIGSGPLIGTFKEEAPGLLPDRDWRTRKLYSQWYLGDTINLVIGQGYMLTTPLQLAVLA
FT                   ARIATGKEVIPRIKMNETIQDFPDIDVDCEHLSIVRKAMFDVVNSKTGTYKKGLSGIQI
FT                   AGKTGTPEINSKGESHKLFIAYGPYHNPRYAISVFIEHGKAPRQDVAIANEIFQYMLET
FT                   MSIKLLA"
FT   gene            complement(713966..714805)
FT                   /locus_tag="WRi_006610"
FT   CDS_pept        complement(713966..714805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006610"
FT                   /product="polysaccharide deacetylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006610"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95426"
FT                   /db_xref="GOA:C0R3D4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3D4"
FT                   /protein_id="ACN95426.1"
FT                   /translation="MFIRIITFFLLYSSTAFCSDCNFNLPYCGLSCNLDLSYRNLSNIK
FT                   KLLNNDDKFVALTFDDGPSNNRINDIINVLESYEAKATFFVLGERINEKTSEIVKKIHE
FT                   SGHELGNHSWSHRKLTSLSSEEQLQELEKTNTAIKNAIKQDVKWFRPPYGCYDDNLIEN
FT                   TDQLNMYSILWTVDSLDWQGDKPETLVERVLSNVHNGAVILFHDHNNRSNTIEALPHII
FT                   KILKKSGYKFVTLSEWEKRVCNTVKARSVTIKEGKKVRFEGMLCGQKIKSLTAEHSY"
FT   gene            715135..715794
FT                   /gene="radC"
FT                   /locus_tag="WRi_006620"
FT   CDS_pept        715135..715794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="WRi_006620"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006620"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95427"
FT                   /db_xref="GOA:C0R3D5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3D5"
FT                   /protein_id="ACN95427.1"
FT                   /translation="MNNSERKEKLETRILSSRGRSLLDHELLERTLSECEEGREVAKKL
FT                   IELFSSLGRVINADFHELKNVTGMNDGAIASIFCLKEIFDRILKGKLKKLSILDNREEL
FT                   LKYFKTAIGQSRKESLRVIYLDRSGHLIYEYIQDCGTIDRVPLYVREIIKQGLLIDASS
FT                   IAISHNHPSGDTEPSKEDEDNTLTLAATCENVGMKLIDHIIVTQKSHFSFYDSGLL"
FT   gene            715898..716636
FT                   /pseudo
FT                   /locus_tag="WRi_p06630"
FT                   /note="transcriptional regulator, putative; disrupted by
FT                   frameshift"
FT   gene            complement(716773..717855)
FT                   /locus_tag="WRi_006640"
FT   CDS_pept        complement(716773..717855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006640"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95428"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3D6"
FT                   /protein_id="ACN95428.1"
FT                   /translation="MKKINGKKLSSKMLKAVERIAKEGLLPNFIKAAPTANKKISKLPV
FT                   LTYPEELNPFRSALCKIRLSEYENVKLNEFLEKAIAAENLDKLSKIVDEALDLGIRVNA
FT                   RNEDGFSFTNVTMFKMYRDEFKENKQEDIIRKLALHGADFNVQVDKKIAEMYQKVQKEI
FT                   EPQIYSRLKKLREVGEDATIEGTVEDVEIDNKTFYIEFSHSCIVDVAKVVEGAKNLGLS
FT                   KGDLNLGGSIIKIGDGEVEVKTGKDGKRNYVDISDNSAFTVTLCTSLGELNLMVYHDTE
FT                   DYHQVQVEVEDEEMWNELQEIGEIVGKGCLFGGMSVKEVVEKGSFTRCGRWGDQNSKSS
FT                   ETFSWVSKLKDTKTTSVGRS"
FT   gene            718054..718977
FT                   /locus_tag="WRi_006650"
FT   CDS_pept        718054..718977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006650"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95429"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3D7"
FT                   /protein_id="ACN95429.1"
FT                   /translation="MDILSYSTEKLKKHCQLLDDEEKIVLYEQLLDKAKDILENSRDDI
FT                   AKLKEVSKAVVAIEETTDKQLLEKFNDDHPLREVDILIYSPQGNTEYLFSIDNSSELYD
FT                   LKEDKEKALYNAVKLNDVELVKKLLMILSPTEVSNFDTKYLEELKILLSGIHKELQLSQ
FT                   DMKNYLEKTIKFYSFLCSNFNLLVTNPTDVKAIIDLFAAQPNIDYQIDKLLLSFIVRDV
FT                   EEKKLNSEISHMIELLEQHERFAELEYKVRRLRSEFASGKSRYSAEVIRNSIAEREKEM
FT                   REIEKKYVRPNDLISERQKLLKQLLC"
FT   gene            719029..719755
FT                   /pseudo
FT                   /locus_tag="WRi_p06660"
FT                   /note="transcriptional regulator, putative; disrupted by
FT                   frameshift"
FT   gene            720346..720633
FT                   /pseudo
FT                   /locus_tag="WRi_p06670"
FT                   /note="ankyrin repeat domain protein, fragment; no start
FT                   codon"
FT   gene            720684..720803
FT                   /pseudo
FT                   /locus_tag="WRi_p06680"
FT                   /note="putative site specific recombinase, fragment; no
FT                   start codon"
FT   gene            complement(721256..724036)
FT                   /locus_tag="WRi_006690"
FT   CDS_pept        complement(721256..724036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006690"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006690"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95430"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3D8"
FT                   /protein_id="ACN95430.1"
FT                   /translation="MVIAEAINGQSKQASKKLEEKLSPGQEWSETDKLLDEEYELIKKY
FT                   LWVPSELNGGRSLVDGQCSFEELVCIWLAHTTNLNENQKKLNKELLKTLKGIGSYLHEY
FT                   DTKKLENFLKNNKDDQDLKVVLNLKRGESGLTLLHAASRLNDDQSGPTLVNLLLQAGAD
FT                   PNIESNEGKTPLHYAADSNYRYLTINLLLEGKADPNIRDNKRKTPLQTAIDNNNCHILE
FT                   CFLTDNQKKLSKELYDILLGILSPEYYKKPHVIGEVFNRQAIENLGKFLDKHKNSQDLK
FT                   MIFIVQDRVGMSKVLSYARATCKEAVDLLLKAGATDPKKDANMCNKKKKCLLPPRTLWS
FT                   IPNQQIVLGGFLNDISQVESMDQLEKVVDRAIDFGVMLNFAKKSSQGEKYNFTDYVIKE
FT                   ISRLEKNPKVASDIVCKLVSWGAACYTKNSIDVIGELELEFKDHKANMIKAHEKYVNCT
FT                   QKFLKIAKNATNGKLNRAKMDNATFYLEYSEDSTIDVAQITDGTRDLGLTHGDVKCGRN
FT                   IVKIGNSEVEIITKDGVRNYTDLTEGGDIVLTFYTIQGELEVRLYPDTQNKDLIRVEVN
FT                   DQDLLEELKNCNEKIGKNCLLGGLPVDQAIERGFFTRSGKLCQYSETVSSAAQTVNEKQ
FT                   QLLQDLRYIESNIVKKEKNFDIKTHLVEIFKTLSRFCEEKGDISKTDLAKAAEKESKKL
FT                   GLEGKYNWSKIFGLEKGVIEKAEKQGDKEQKSNIPDNFYLGQAIEDGNCFFDSFRQELE
FT                   QQLGIKATVEQLRQYCKEFARNNPPEWFINAITNSHDNNGVVRRETPDFYAKNILNNNR
FT                   WGDPEVEGRILCGKYGVKLHVVESNPLHATDEQQDPSLHQLIDSLGSRSTGEYNRIDYD
FT                   DNNVLHIVNKGHDHFEPLFNSNKILAKCYSSLPRCSMDELKIESHQHKSLLVSGS"
FT   gene            724654..725675
FT                   /pseudo
FT                   /locus_tag="WRi_p06700"
FT                   /note="transposase, degenerate; disrupted by frameshift;
FT                   ISWpi7"
FT   gene            complement(725963..728227)
FT                   /locus_tag="WRi_006710"
FT   CDS_pept        complement(725963..728227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006710"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95431"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3D9"
FT                   /protein_id="ACN95431.1"
FT                   /translation="MHGLVRSLINGNCGEFTEKFEYFLDSCPSFLHSVGKDHFFPAFFF
FT                   GMFATAHDSGVANNDERIFFRFDNDPGSPGRGNLKVAILTTDGNNRRVVRCYTIADREN
FT                   SYGSRFSQQEREQLEGILRDEELEWQEYKTFIWADNQGEDEEEEAVRCRIFQAGQGPFT
FT                   GNHASYLTRRHSFQEITRTPGLQNNYLPDLMNQLESDDADDVHDTTEEVFQHIIGVYDR
FT                   YSQALDFYGRESDYHGFVSGVLMHFRYRNVANIYLELFVGGGYADITSIVRGTQRLINS
FT                   VPCVTELKAGRRADRNAGRALEQAGNYVNGCPVSSISIPTLSPRAVSAGVNFDFGNPGR
FT                   LQLGVRAFLAKGSSLMERLFEPVEDEEIGENVRDYLLHPAFGVPAVPGIRNRGGVNARD
FT                   RRIFLYTSGFAFASIAFAKGTVPIEGNRAIVDKHLFHYDGNAKMLDEQRYNTQVNIGDR
FT                   ALTMVLHVSRGRDQKEEVIVFHVRHVLANQLFPDNGLDLSRWPNAMVHEVVCNLTINRR
FT                   TRGVNDNLGLTVNVETFDSPADYLLDRGNQPFQGELLRIGGVSNVHRAANVMMNTGWEN
FT                   EDPDSHERFYQAISNVLNPPQPNNAGLQSLAWVVNRDNAREAGFHAALHGLFYTCDNPA
FT                   RVVSEFQVGGGGKLDLVLSRAIGRMGGTYPIGTELKFAATEADVQNREEEADEQVEGYL
FT                   QSRGFDRITDGDKMVFSYAVFNDQAPAPAQNVPNTLIAVSNVLRIKDNLGIDTVDDFPY
FT                   R"
FT   gene            complement(728237..729607)
FT                   /locus_tag="WRi_006720"
FT   CDS_pept        complement(728237..729607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006720"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95432"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3E0"
FT                   /protein_id="ACN95432.1"
FT                   /translation="MPKKMERHAAVLSKLKSVIQHTDSKVMAERRSAIERWVKTYIRQV
FT                   EYLKDDKLQFLYNIFRDESCWSGTRLNNTILGQRFTEEKIGEIKNPLPIYDMACRYCVI
FT                   DKIPLLFQKQFESYKSSFSSEEIDDDGKPATSNNKYVKSELLGYMKSQDPVFSFWVDKK
FT                   SGEFKKHVSATEGFKKAIELKWSEGVEYFYSLLNEKERERERKITDAVTILSSVQCDHN
FT                   GAVTLDFCLSKMSDQAKNKLFKDSELSKKDKGVYSLFSALIHQGFFDTMQAILPMFKDK
FT                   ILEDKILSPRSYTLLLSSLSDMMLENSESTIQAREAIMNLIKCGNFNNHEGREEKAAVF
FT                   FSNGRVPIKRALAGLIVDWQLGCTKKEEVLKVLQFAKEFCAVESFMYFKKSVVDNLKMV
FT                   GRDGMRKNIDYGKLAEKLFAELDTVSVPNGRGDFGGAGDPQSTLGSTEVSSFSGRNK"
FT   gene            729751..730215
FT                   /pseudo
FT                   /locus_tag="WRi_p06730"
FT                   /note="hypothetical protein, fragment; no start codon"
FT   gene            730607..731224
FT                   /locus_tag="WRi_006740"
FT   CDS_pept        730607..731224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006740"
FT                   /product="Ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006740"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95433"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3E1"
FT                   /protein_id="ACN95433.1"
FT                   /translation="MLKVERSIDYLEKEKNNSEASKILEKVQRIGQAYKSSELKRYRRF
FT                   DSDGEREKNTELFSAIRNGNLQKVQDLLKAGVKLNIIDKNNKDNTPLHYAVERDKKEIV
FT                   RKLLQEWKADVNAKNNKGDTPLHIAVSRNNKKLVSLLLDKQARSDIKNNEGKEPYELAK
FT                   NQEVSYIFKHRSSHSSDYNDIMSQANLNEELIKIVKSSTSEK"
FT   gene            731249..731581
FT                   /locus_tag="WRi_006750"
FT   CDS_pept        731249..731581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006750"
FT                   /product="Ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006750"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95434"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3E2"
FT                   /protein_id="ACN95434.1"
FT                   /translation="MKKGANINFQDANYELNTPLHAAVRKQEPKVVKLLVKNGAIQIKN
FT                   SKGKMPLDIAKSLNNEGIIQELGRASLLKRANTGENKPEIGSSKKPRISVIAHRDKVIY
FT                   KVNIKV"
FT   gene            731613..732884
FT                   /locus_tag="WRi_006760"
FT   CDS_pept        731613..732884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006760"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006760"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95435"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3E3"
FT                   /protein_id="ACN95435.1"
FT                   /translation="MTKVLQEKIVAENANLKEEIKALIRENDSLKAKIVELQDKLGLNS
FT                   QNSSLPPSRDIYRKKAKKKSDKKPGGQPGHKGHKRELMAADEVVSCTIDTICMCGGKVT
FT                   LEDEIIHQKAELPEIKPTVTEYRLQRGHCRVCNKRITANLPEGVARDLLGSNAKTIISS
FT                   LSGFFINSKREVQQILGSIFNLNISLGLVSNTERRASKKCASEYEKMKEELQGSEYLHI
FT                   DETGHRNQGKRGWSWVITNKALTLLKVSESRGKKVLKSLLPEYDGIVVSNRYAVYNYFN
FT                   RENRQICWTHLARDFERFAHSKNVEVSKTGQALKSLSNKVFVVDKEKKHNSIDNLRFYR
FT                   LMRKIRKRVKHFLRKMTRVVNSTQASRMAAKMLRSEDMMWKFLRKPEVIETTNNLAERQ
FT                   IRRYVIYRKNSFVSVQESGLRNNR"
FT   gene            complement(733007..734389)
FT                   /locus_tag="WRi_006770"
FT   CDS_pept        complement(733007..734389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006770"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006770"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95436"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95436.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            734645..735356
FT                   /pseudo
FT                   /locus_tag="WRi_p06780"
FT                   /note="hypothetical protein; disrupted by frameshift and
FT                   in-frame stop codon"
FT   gene            complement(735447..736526)
FT                   /locus_tag="WRi_006790"
FT   CDS_pept        complement(735447..736526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006790"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95437"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3E5"
FT                   /protein_id="ACN95437.1"
FT                   /translation="MSEANPIVTLKAKIKEFGFSELKAGESNKSANSGETMYFDFPRMN
FT                   FVINGKIIDTVLTSALIEGAQYRKSNLFNSYDIYSSETAREKQREIDTDYGRAFVDSVL
FT                   KDLEKELAHNALCELWKSHCKNSEIPDYQKTTSYGKDFERFYNAGREHLHLLLKVGDEN
FT                   KNYRPFVKEVFKEMFQYAEASVPNDPILEEIITNCNQAGYEFAVSIPILESSLLEYGLK
FT                   GEYSKNKTMCIDCADPISTKVKSDMLVFVTKFDNPGEKICDLSTSLEFVLESQDGVTYK
FT                   DGKLLLTIPKELKNYKGESRNLFDVIKEYFQKFCEKLGFKFEIKTQKIEHDLDDSLKVN
FT                   SHLESLRPPICSNNYALGH"
FT   gene            complement(736739..737194)
FT                   /gene="hspC2"
FT                   /locus_tag="WRi_006800"
FT   CDS_pept        complement(736739..737194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspC2"
FT                   /locus_tag="WRi_006800"
FT                   /product="Small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006800"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95438"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3E6"
FT                   /protein_id="ACN95438.1"
FT                   /translation="MSNIVHSNKNNKCDNFSVRGLQRAVDNIFDSFFTGWDSELSRRGS
FT                   SLLPACDFYETKESYCLSLELPGISKESIDISISSDSLIVKGEKTCNNESKDKQFYHRE
FT                   RYYGSFYRSIQLPVNVEQDKVSANFSDGILHVTIPKSEKHIKRIDVK"
FT   gene            complement(737637..738647)
FT                   /locus_tag="WRi_006810"
FT   CDS_pept        complement(737637..738647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006810"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006810"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95439"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR018272"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3E7"
FT                   /protein_id="ACN95439.1"
FT                   /translation="MLLNKGANANAKQKDGITALHIATQKGHKEVVKVLLECGAKVGSK
FT                   IKSDITPLHLAAQKGYQEIIETVLKFGADINSRDEYGRTALHIASKEGHEEVVTTLLEY
FT                   GSDINITSRNNHTPLDSAMAGIRSFYSQLNNYDSDDDGYYDPDRGVCSCEVTAEALKRH
FT                   IVKMKTANLYVSEKNLLSMSISGEISGFQDECEEEIARMKSEKINNPNISFYDILAKGT
FT                   SSLAIYMRNENIVQVLKSDDYKTKFPIYASMIESHFRKGMERKELLEQGNKIFHFLFNN
FT                   FPELPYDCTEKIFSYLSNEDLRILIDACNPLSISNPNTNINNVVITSSTSQVQYV"
FT   gene            complement(738683..739515)
FT                   /locus_tag="WRi_006820"
FT   CDS_pept        complement(join(738683..739141,739141..739515))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="WRi_006820"
FT                   /product="transposase, IS5 family"
FT                   /note="ISWpi1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006820"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95440"
FT                   /db_xref="GOA:C0R2R0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R0"
FT                   /protein_id="ACN95440.1"
FT                   /translation="MRKKYPTDLSEREWARIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKKVKGRKRHIITDTQGFILGCYVGAANENDRDGIKIALN
FT                   NMRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFWVHKDTPPELLPTR
FT                   EQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMSRVMLKREYA"
FT   gene            complement(739576..741396)
FT                   /pseudo
FT                   /locus_tag="WRi_p06840"
FT                   /note="ankyrin repeat domain protein, truncated; disrupted
FT                   by IS-insertion"
FT   gene            complement(741777..749201)
FT                   /locus_tag="WRi_006850"
FT   CDS_pept        complement(741777..749201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006850"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006850"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95441"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3E9"
FT                   /protein_id="ACN95441.1"
FT                   /translation="MHVPKQQTSFYQEDKQFLSRSYTSKEEFIREYKKLYRRKAKAEEL
FT                   YLLVLTELEEAISDGNVDSLKKLSNFIDYISDAEDQVTLRDYYDNANNPVKSTNLVILA
FT                   CKHNKVKILEYLLGNNSKILSNLSVGIRETTILPDDEDETCHNAFYYAIRSGNVELLDT
FT                   LINKWPGNYFAVHFRELDEILSRSYEELKLKNVFLSEEIEIFVENKLINLRFFSSASGQ
FT                   DQNVKSYLNNIRERIELVLQNISLLKAEYSNTEKVDEKFLFIAKFIAQNIHILKRQLKS
FT                   TYNRLPWEEMEFCLISFVSSHIKRQEMNLFYNATLNKSKILNHLENFAKKLKEEKDIIE
FT                   GVDIGKFADLPKLKRERVVAEIVRNYPQFGELYSDYQQIRDIHSLEKISDYIKLALSAD
FT                   PKQREGQLIITRVLQVIGEYLKNTLESPKLSSTTSELLLLSLPRNTREVIIDLRNSLSH
FT                   AYSLSKRTEIEENTDVSFFIGVQNDTKRIDNVITDILYNNKIKIVIMLLKKITSSENLD
FT                   EIKEVAGIFSNVELDEMITESFKVMEHYKLEKLIKELSNNITEKTNYEKELFNKIDNII
FT                   NFAKTKSKNIRTDYVTAFISLKSLDVGLNDNKIDHNVIRGIKFFANKTLENIPSQIESH
FT                   NLKEIAELSMKISHSVRSRIQDDNLDKVNRLTCEIFYIAELGTGDLKWIEELRNKLNEK
FT                   GSFIPIHKQRKAYNITEEKYNNQLELKLSELKSILRNNALSGKLTEKLPSYKRNKELQA
FT                   VVEMLVLDIMSILGRSEKHLENNLLFLDDNTPLLTGKCLRNHLAHDNTLVDVLLSDPSI
FT                   AVILNAKKLISENVIKSKKKIGKSVRDDPSKLKDKYDQNLITITNQEKMFAALEEGNLE
FT                   DLKSYLKKGADINARSINSWTTLHFAAKGPSLEIIKFVLNQNLDVNVKDINGQSPLHIA
FT                   AAYGRKNIVEFFIGKTGVYVDDLDNSGKTSLHIAAKNGHKDAVEILLKNNANTNTKDIA
FT                   GFSPLHYAIKNNHIDVAKIMLEKEANVDINETMGGFTSLHIAAESGYLGLVNFLLKNEA
FT                   NVNARNDKEGIPLHTAALNGHLEVVNALILKGADVNSRVIDGCTPLHYAIENGHEKIAN
FT                   ILLKHGANVNVVDKTYNNTPLHYAAKDGHEKIVKALLTNKANASIATVEGITPLHFAVQ
FT                   SGHLKIVVALLEHGVNIRAKDKNNATPLHYAAESGHKAVAELLIKNGVEINDKANNNLT
FT                   PLHVAALKGHKDIIELLIRNKAEVRAQGIKVSTPLHAAAMNGSKDIIDLLIKNKAEVDA
FT                   RTNDGMTPLHVAALSGHKDAIAFLIKSKAEVNTSANYGLTPLHAAIVGGHKDIVNLLIK
FT                   NKAKVNTEGIAGSTPLHVAVEGGHKEIVGILVANRASVNVKSNNLTPLLSAIKHNHKEI
FT                   VEVLVENGASVNAEGGEPLSLAVLAGYRDIVEILLKNKAHIDIKGPEDATLLHLAAKRG
FT                   HKGIVNALIERGANVDAMTINSITPLYLAAQEGHEEVAEVLIANKANVNFVNVEGTPLH
FT                   IAAGHGHVNVVEVLLSNGAKVNVKDNKSRTPLELAVAHGHLQVVKMLLQYKKVDMNAKG
FT                   NDDWTILHIASQESNLEMVKCLVDEGSNINAKNASGSKPIHIAAREGYKDTVEFFLSKG
FT                   LSINELGTANQTLLHYAAMKGRLEVVKYLIAQGADVNAKDTNGLTPMHIAANFGYKDVI
FT                   EVLLKNGAVYNAVDKLCRRPLEMTNDKDVINLLASTEKLFEAVKRNSSSEVENYIKAGA
FT                   FVNAKNADSVTPLYYAAWKGYDGVVNILLQNKANPNVVGNKGFTPLHYAAKFSHLKVVK
FT                   ALLSNGAVYNAVSDSGKTPSDFTVDKSITSLFKLVSESFKKVKDGNAQVINDLNKIKDI
FT                   DTVKAVMSARNRENKTLVVAAVHSNFSKVEQLKQISQSDVSAQIDTALVLLNQGNYQKA
FT                   LSIFRSAFERRKEILGTDNPGTLDIQTYIAKVLYKQGIYQEALNMLEEIFQKQKEMLGS
FT                   NDKDTLSTRSTIALVLHRQGKDEEAFNIYQEVYQRQKEILGSNHSDTLNTQFHMALVLD
FT                   KQGKYEEALNINRAVFEKRKETLGTHDLATVSAKNNIAMVLANQGKYEESLKIYKEVFE
FT                   KKKIILGINHADTLRTLHNIAGVLFNQNKYHEALKAFQEVLNIQKKALQQNHPEALNTQ
FT                   YNIANVLFAQGKWISALKVYRESFDQRKAVFGPSHPSVLDILKKIEMINFRFKLEGSEA
FT                   SEVLQHLQKDINIAASKGDIRTVQRLLKDGADANDKDIDGRTPLHYAVSNGHIDIVNIL
FT                   LTNGANVSQVTNKGNTPLHTATSKCYKEIVEVLLQHISRDKLNDFVNAKTTSSGTTSLH
FT                   VAAKGGSLEVVKSLLKHGAIYNIENKEGKIPIDLSKDQKVTNLLKLIEELFGDAKKGNV
FT                   EIISKLKAVKPDEFIAVTNARNNQGNTLLQVAIANKHKNIATKLLKMLKEPDQNLQDVN
FT                   IESGVKSLKL"
FT   gene            complement(749574..750653)
FT                   /locus_tag="WRi_006860"
FT   CDS_pept        complement(749574..750653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006860"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006860"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95442"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3F0"
FT                   /protein_id="ACN95442.1"
FT                   /translation="MLNNNINKELEKAVYERNLEKVKALLSAGANANLRVERNRDTLLH
FT                   TTSSVEITKELLLGGAEVNSRNMYSETPLHSAITLGKELELVRELLKHGADVNATNRKG
FT                   NTALNHAVKKSGKNLGVVKELLEYGADINIRNRERRLYDNCSTSLDNAVSDLACTKLLI
FT                   KFTLVRNFNKDYGKIIDLSPYKGCSNYSKLSSYLDDCVCEILQMKTDEIKDSLPLYEFV
FT                   TNNFNIHVLYNNQLSVRLAKIDYSIRYPIYNDIILDKVKPFLERADLLNKLSKIQFYTK
FT                   LDVADQDAKEKKIILDHDSTYNITEYLYNDNLLNFIVAFDDSNKRTFQSLSPLNNLVEP
FT                   GTRLYETSISNDTKRARLE"
FT   gene            complement(750749..753349)
FT                   /locus_tag="WRi_006870"
FT   CDS_pept        complement(750749..753349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006870"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006870"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95443"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3F1"
FT                   /protein_id="ACN95443.1"
FT                   /translation="MFTNRISNNLDQLQFFVEFLNENYETQKHLSLTPLHLAAGNGQLD
FT                   LVNTLLGEGLDINSEIKYDGFTPLYFAIAKNRLEMVNFLIAHGADVNHRAILGFTPLSF
FT                   ASQQGYLDIVNTLIANGADLSTKTDKLNTPLHLAAENGHLDIVNVFIEKGLDVNAVNND
FT                   RARPLHSAVQNGNLEVVKALISQGSNINAGSSGIGNHKVDANITPLHLGTQTGRLDIVK
FT                   VLLEAGANVNAKTDDKITPLHLASQNGFLELVDILLKAKSNVNAKDYENLTPLHLAAER
FT                   NHFGVVKSLLLVKGIDVNAKGHDNSTALHIGSQNGHLEVVKLLIEKKANVNAKKNEGFT
FT                   PLHLAIQQSHFEVSDFLIKNGANINTVDDQNWTPLHNAAYNGFSLKIVESLIAKGANIN
FT                   AKMDDGRRALHLAAEHNHLEIMNFLIENGADINALDNRSWTPLHCAAYDGSLEVAKSLL
FT                   DKGADINAKTVKSTTPLHFAVDHDHLEVVELLLEKEADINALDHTNWTPLHFAAEKGYD
FT                   QIATVLLKHGADVNVKENQNKGTALHLAAQYGHPKVVKTLIINGADVNAKMDKNATPLH
FT                   LGAQIGNLDIVRSLLMSGAYFNARAEGGRYVLPLHFAERRGNPEVIKLLKLVEKLFKAI
FT                   EDNNYLGIESFIRDGAIIDSKNVDGRTPLHYAVNNGHIKVVNILLANGADATKVTNKGN
FT                   TPLHTAASKGHKEIIEALLQRVSHNKLSDFINAKTIVKGTASLHVATENSFFEAVKSLL
FT                   KHGAIYNIKNKEGKIPLDLSRDQNITNLLKLVEELFENAKNGNVEIISKLKAIKPDERV
FT                   AVTNARNDQDKSLVQVAVINKHSNLASRLLEILKSPDQSLQDVSVENRVKSLKL"
FT   gene            complement(754223..755143)
FT                   /locus_tag="WRi_006880"
FT   CDS_pept        complement(754223..755143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006880"
FT                   /product="patatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006880"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95444"
FT                   /db_xref="GOA:C0R3F2"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3F2"
FT                   /protein_id="ACN95444.1"
FT                   /translation="MTKYILSVDGGGIRGIIPAIILAEIESRTKKPISQIFDLMAGTST
FT                   GGIVVAGLCESNKLQYSANDLVELYQEYGAYIFQASLWRKSIASWLSGSQYSYKNMEFI
FT                   LNKYFGESTMADVASNLLLTSYDIHNSCEFFFKSWKEENIKLKDALRATTAAPTYFTPK
FT                   RLKISQTERVLIDGGVFANNPAACAYASGKRLFPNDEIILLSIGTGGTNRSIKYANSRR
FT                   FGKIGWIKPLLNVMFASGLDCVDYQLEQVIDDKYIRIQSQLKVASTEMDNITLKNIKFL
FT                   QQEASKMIEDNQKVIDKFCKQNPKL"
FT   gene            complement(755153..755371)
FT                   /locus_tag="WRi_006890"
FT   CDS_pept        complement(755153..755371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006890"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95445"
FT                   /db_xref="GOA:C0R3F3"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3F3"
FT                   /protein_id="ACN95445.1"
FT                   /translation="MTNTGKIPVAVIATMVIQTIALIWWLAKLDLRVHMHDKFIEQNQR
FT                   TTEIIYRLEERVKNLAEEVNELEQRQK"
FT   gene            755496..756032
FT                   /locus_tag="WRi_006900"
FT   CDS_pept        755496..756032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006900"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006900"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95446"
FT                   /db_xref="GOA:C0R3F4"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3F4"
FT                   /protein_id="ACN95446.1"
FT                   /translation="MKSSLFWKLLTSSIIPIICVIVLYQHFSTDQLSKDVPIKSKASGN
FT                   DLETLSTAAEKCNLDTVRSLIKNVVDINATHHFGATSLHYATSGGCLEVVKFLIEEGID
FT                   VNTTDAFSWTALHYAARKGHLEIAKFLLKNGANPSAKNKDKKTPLDLAVEELNNNKEDI
FT                   YEEIINLLSNYQLFP"
FT   gene            complement(755998..756978)
FT                   /locus_tag="WRi_006910"
FT   CDS_pept        complement(755998..756978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006910"
FT                   /product="tail protein D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006910"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95447"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3F5"
FT                   /protein_id="ACN95447.1"
FT                   /translation="MTPDFSISVEGISITELVKSRLVSMHITDEAGVISDTAVIHLDDR
FT                   DSLFEIPRTGAKLNILLGYKETGIVPMGDYIVNEITLQGPPQSLKIKSHAADLKESLKE
FT                   QVFNEWHQITLNDLVKKIADKHGYQAKIAAEFVNIMISHIDQTAESDMHFLTRLAQIYG
FT                   AIAKPAGGYLLFVSKGKAKSVTGKTLSTVTLTPRDITNWKVKFNERNQYGSVIAYWYDY
FT                   EKAETITEKVGDQEPSYILRDIYASSDLAQSAASAKLNQLMSNAATLNVTMPGNPELFA
FT                   EAKINLSGFRKGVYGKWIINRAEHVIDNLGYRTIVTGIIDSWKVN"
FT   gene            complement(756980..757186)
FT                   /locus_tag="WRi_006920"
FT   CDS_pept        complement(756980..757186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006920"
FT                   /product="tail protein X, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006920"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95448"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3F6"
FT                   /protein_id="ACN95448.1"
FT                   /translation="MMMYYKTKENDMLDLICWNYYGFSSGAVEIVLRANPGLAEYELLP
FT                   AGLIIKLPVIQKETQKQVVKLWD"
FT   gene            complement(757164..757580)
FT                   /locus_tag="WRi_006930"
FT   CDS_pept        complement(757164..757580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006930"
FT                   /product="tail protein U, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006930"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95449"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3F7"
FT                   /protein_id="ACN95449.1"
FT                   /translation="MLSLGPYRFSLIEQGFTRRSEYRWPALERIGEKPLLQSIGPGEDI
FT                   VELAGVIYSGGLKQINNMRNSSKPLLLIDGQGNILGHFVIVKIEETQKYFFPNGEPRKI
FT                   EFHLSLKHYDNVLSDGSLNNPVDNIQLDDDVLQN"
FT   gene            complement(757584..759764)
FT                   /locus_tag="WRi_006940"
FT   CDS_pept        complement(757584..759764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006940"
FT                   /product="tail tape measure protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006940"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95450"
FT                   /db_xref="GOA:C0R3F8"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3F8"
FT                   /protein_id="ACN95450.1"
FT                   /translation="MKAISIVIGATLQSSFNSTIAGSTKQLSRIGSTIKQLESSSKSVS
FT                   KFKELSRDALLARRSWDELEIKTKSLAKQIKNTEAPSKKLQNEFTRSKAAALKAKTAYL
FT                   QKRSALHLLRTEFSKSGRDIKSLIGDQVKLGSSIEKLKNSYTALNSVMQKRKGVLAQRA
FT                   NFRAQIMDTVALGLTLAAPLKAAISFESAMADVKKVVKFEDTDVNGLTKLGETLKEMSR
FT                   TIPLSAAELAQITASGGQLGIKAKDLTTFTDTVAKMATAFDMSAEEAGDAIAKLSNIYQ
FT                   IEIGEMKGIGDAINHISDNTAAKAKDIVPALNRIGGTARQFGLTAVEAGALASSFISLG
FT                   KTPEKAGTAINAMLSKLQTASKQGGNFQKSFQQLKINAKEFEKAIGKNAQGTLLKFLET
FT                   VAKLDKQERSSVLFDLFGLEYQDDIALLTGSLDEYRKSLRLINEEYHGSMQREFENRAN
FT                   TTANNLQLLKNSIAEVGMNLGYVLLPPLNFTVNLLRSATTQVALYAKEYPVLTTVIMST
FT                   TTALISIKIAAISLGYAWTFVKGSLFALLSTWRMFGSVITLVKIGLYSTSAVFPAIIAG
FT                   FKALTIAVMSNPMGLIIGGIAVAATLIITKWQAVKNFFVTIWESVKIVWKSFSDWVGKF
FT                   WNNITQPFRTISNLWNKRNESKLEVKSVNNVISDSLKYPIAAHSKAIENKTQNNHFSIN
FT                   IHSTPGQDTRSIADEVMERIREQFSGALYDIN"
FT   gene            complement(759761..759880)
FT                   /locus_tag="WRi_006950"
FT   CDS_pept        complement(759761..759880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006950"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95451"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3F9"
FT                   /protein_id="ACN95451.1"
FT                   /translation="MRLSILSLSSVVGGGINQWLDMDIEEFFTWFESSRKLYK"
FT   gene            complement(759877..760128)
FT                   /locus_tag="WRi_006960"
FT   CDS_pept        complement(759877..760128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006960"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95452"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3G0"
FT                   /protein_id="ACN95452.1"
FT                   /translation="MQKIKLTEPIKIDGILVSEITLRRPKVRDRLAVERMSNNDAEKEV
FT                   ALIANLASISREAVEELDLADYSKIQEALQGFLSQQKS"
FT   gene            complement(760145..760645)
FT                   /locus_tag="WRi_006970"
FT   CDS_pept        complement(760145..760645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006970"
FT                   /product="contractile tail tube protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006970"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95453"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3G1"
FT                   /protein_id="ACN95453.1"
FT                   /translation="MLPKILKNFNVFVDGRGYAGKIDEITLPKLTIKTEEYRAGGMDIP
FT                   INIDMGMEKLEAELTFAEYDSELFRLFGLINNNAVSLTLRGGLQGSSDTESVVINLRGL
FT                   FKELDFGSWKPAEKAMLKCTVAANYYKLTIDGKELIEIDAENMIRKIDGVDQMTSMRTA
FT                   LGI"
FT   gene            complement(760667..761818)
FT                   /locus_tag="WRi_006980"
FT   CDS_pept        complement(760667..761818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006980"
FT                   /product="phage tail sheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006980"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95454"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3G2"
FT                   /protein_id="ACN95454.1"
FT                   /translation="MAEEFLHGVNVIEVTSGAKTVRTAKSSVIGVIGTAPEADEQKFPL
FT                   NSPVLIAGSLKEAAKLGKSGTLPSAINGIFSQIGATVVVIRVEESETIQNIIGGVDKET
FT                   GEYQGIEAFLSSESIVHVLPRILIAPQFTHQLPEDGKNPAVAALVPIAEKLRSIIVADG
FT                   PNTNDEEAIKWRKSVGSSRVYVVDPWVKVFIEGKEEILPPSSFVAGLIAKVDSEQGFWH
FT                   SPSNKEINGIIGTSRPIDFTLGNTNCRANHLNENEVTTIIHQNGYRLWGNRTCSNDAKW
FT                   TFLSVRRTADLINDSLLRAHLWAVDRNITKTYIDDVIEGVNSYLANLKAQGAIISGKCY
FT                   ATPELNTPANIASGKVSFDFEFTPPYPAEQITFRSHLVSGTIL"
FT   gene            complement(761811..762371)
FT                   /locus_tag="WRi_006990"
FT   CDS_pept        complement(761811..762371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_006990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_006990"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95455"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3G3"
FT                   /protein_id="ACN95455.1"
FT                   /translation="MPIYIRFEHNKQVETTTLKSKPAGNDWYEAPENFEWQKSYCLTEG
FT                   GEIAQRTKEDIQKELLDNAKLCAFDNIRTHFNNFTSRFSGHSHQKAKSYEIQAKTAENI
FT                   LTTQESIDEKDAAIIEPLARVRGISVVEMAKIIEEKAEKAVKAIIKCEELEDLAKRKIE
FT                   EAKSEEELEDLLNNFKQKMQRNG"
FT   gene            complement(762386..763852)
FT                   /locus_tag="WRi_007000"
FT   CDS_pept        complement(762386..763852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007000"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95456"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3G4"
FT                   /protein_id="ACN95456.1"
FT                   /translation="MKEAIYQRIKDLAVSSTADQLAYLAKSLELIADKKAISNVVQMTE
FT                   VKGIIDALQKRLKDLVANSTPDQLAYLAKALESIVDKSAVSEIVQMTDGKLKELLDSAK
FT                   KHLSDINSNKTNSISSITAVKTESVNEINKLRDNSLNTLKASSDSHISLLDTRKNANIA
FT                   AINSISNSHKDGLKGLVEDFRAVNNVPSGSSIIREIETRDNQLKTSLINEVKTRDEQLK
FT                   ASLINEIRKRNMAEPGSLPFLFGVLGRKNNYFGHGTFTTELGKWSSDITKTDYMLQLLA
FT                   GSHTYNTDYVSFYRPRQLSFIEGSKGTFIYGELCTKSFSGSYDEIYYYPYAALGVVFVK
FT                   NTTNVNINKTIEFIGSSYSSTEYGGAGLFVGTPDNTNSNKSSISKIVWKNVYQYTSSDS
FT                   KLAGSGNVEIPAGKTVAILLYTSSYLCSRTQVSQGMLASNYVYNYGQFIQWGIYNIRSN
FT                   FLTTGLEVDVERTLRAWQCPGLDATHKIWN"
FT   gene            complement(763849..764043)
FT                   /locus_tag="WRi_007010"
FT   CDS_pept        complement(763849..764043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007010"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95457"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3G5"
FT                   /protein_id="ACN95457.1"
FT                   /translation="MPNDKTSREYPLPHPENIAVEDVVRIRKAIEKIDEDMSKGENKHN
FT                   QLKSNFERFRFETFLNFWE"
FT   gene            complement(764049..765236)
FT                   /locus_tag="WRi_007020"
FT   CDS_pept        complement(764049..765236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007020"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95458"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3G6"
FT                   /protein_id="ACN95458.1"
FT                   /translation="MEKRANNQGKLKGKVKVPANIPAGTKLVQFYGDKGSYGEATYTGK
FT                   KTITIEERRRVIAARRVDPLAQTFTLNESRHIGGLELWFINKGKKRVVVQIRETAVGMP
FT                   SQTVIAESYIEPKDIKIDGTATRITWSPVFCHAGEEYAIVLLTDDPGTAVKIAELGKYD
FT                   AVNSRWVTSQPYQVGVLLSSSNASTWTPHQNLDLTFRLLAAKFSEVSHVVDLGKVTVNN
FT                   VSDLIVLTNVEKVAFDTNVEFILTDEEGKENFLSDNLPLALRERLSGELTVKANLKGSK
FT                   EKSPVLYPGLQLVMGNIGEKGDYVTKSITAGTNTKITITYDALIPGTADVKAYVQKNVD
FT                   WQLVNLTSGKPIGENWVERTHVLTNFNANETRIKLVLSGTVVYRPKVKNLRIVIT"
FT   gene            complement(join(765248..766363,767283..768095))
FT                   /pseudo
FT                   /locus_tag="WRi_p07030"
FT                   /note="hypothetical protein; disrupted by IS-insertion"
FT   gene            complement(766390..767222)
FT                   /locus_tag="WRi_007040"
FT   CDS_pept        complement(join(766390..766848,766848..767222))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="WRi_007040"
FT                   /product="transposase, IS5 family"
FT                   /note="ISWpi1"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007040"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95459"
FT                   /db_xref="GOA:C0R2R0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2R0"
FT                   /protein_id="ACN95459.1"
FT                   /translation="MRKKYPTDLSEREWARIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKKVKGRKRHIITDTQGFILGCYVGAANENDRDGIKIALN
FT                   NMRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFWVHKDTPPELLPTR
FT                   EQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMSRVMLKREYA"
FT   gene            complement(768102..768788)
FT                   /locus_tag="WRi_007060"
FT   CDS_pept        complement(768102..768788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007060"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95460"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3G8"
FT                   /protein_id="ACN95460.1"
FT                   /translation="MSILTQSGRAAIAASIKEQPIHLAWGSGDSTWESSYKVEKTFTAG
FT                   GKISLDHHTIKDVKVYTGQTIYQSSIDYIVDGSSGAIERVENGAIIADSVITIEYTQDT
FT                   PPELITSATLIKEVGRRVVDEVLFCSGDENGELVTPSGRFKPSNVPINNLYLKFTFDFT
FT                   DAANQVIRELGVMVGTKIKEGLPEGQRYFEPKDVENPGILLVLEHTVPLIRTSATRETF
FT                   SFVVTF"
FT   gene            complement(768809..770026)
FT                   /locus_tag="WRi_007070"
FT   CDS_pept        complement(768809..770026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007070"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95461"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3G9"
FT                   /protein_id="ACN95461.1"
FT                   /translation="MILPPNASKQEQILTDIINYSLDANSLRGFKFNPQTEMLPWLVAE
FT                   YGLGEILSWGKKATKSALKEWVLAKQNGIRFQRLRGTPQSLKMALKWANIDNITIQEEP
FT                   PGEHFAEFQIGISDVPNDFFVDSVIALAKLSAPARSRLMRIFNDYYNAQRFMLDESIFG
FT                   DLLSDYSGVRIAKEGPVLSFGRKNSFELKIGNPRFKFSTFRSHYDRSYSNDLYRLDVAV
FT                   LGETEPHTKNYNGIYERSHEWYNLKALYPLPQGLLPEIKFAKALIVLSDSWNLGDINAC
FT                   FAPTAYKEIEHTFYLSEDKLSEQIWNFRRTPILERFSITYYYEAKSFTDQRIIESNLRE
FT                   YHIDCQNDSDLKQKDPIHELENYVAVFYPGMVTWHEHRHLNRPWKNFEPIITKKLDVFS
FT                   TNLVYI"
FT   gene            complement(770033..770830)
FT                   /locus_tag="WRi_007080"
FT   CDS_pept        complement(770033..770830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007080"
FT                   /product="baseplate assembly protein J, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007080"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95462"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3H0"
FT                   /protein_id="ACN95462.1"
FT                   /translation="MKTPNIVETLKFEEIFSRMKEELVRRNASFSALTESDPAIKILEV
FT                   AAWRELLLRQRINDAAQANLLAFARGNDLDHLAEFYGVLRKESENDESLRKRVKAKIVG
FT                   WSTAGSKEHYRYHALSADTRVKDAQVVSPIPGSVQISILSTENDGVPSEELLEIVRNHV
FT                   IRDDIRVLTDTLTVIGCGIIPITIHAKVHIYPTASKDVIEAVKEQFIKDLESAKGLGWN
FT                   VTRSWIIAHLFIEGMQNIELTEPIEDIVVQDNECVTLNNLSVR"
FT   gene            complement(770840..771175)
FT                   /locus_tag="WRi_007090"
FT   CDS_pept        complement(770840..771175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007090"
FT                   /product="baseplate assembly protein W, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007090"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95463"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3H1"
FT                   /protein_id="ACN95463.1"
FT                   /translation="MRGMNSETGKTISGIEHLKQSIVDILTTPIGARVMRRDYGSRLFE
FT                   LIDHPIVPGFAQELYAAVAEALEKWERRFKLKRVQITEIKEGKVTLILEGIYLPNGKLI
FT                   RLDGIIV"
FT   gene            complement(771181..771435)
FT                   /locus_tag="WRi_007100"
FT   CDS_pept        complement(771181..771435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007100"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95464"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3H2"
FT                   /protein_id="ACN95464.1"
FT                   /translation="MNKSVVRLGDHCEEALPHFCISGSRDVFINGRPVCRQGDSLSEGK
FT                   VMTQGSKAVFANSKAIARTGDLISCGAVAEQGSNDVFAG"
FT   gene            complement(771444..771899)
FT                   /locus_tag="WRi_007110"
FT   CDS_pept        complement(771444..771899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007110"
FT                   /product="baseplate assembly protein V"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007110"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95465"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3H3"
FT                   /protein_id="ACN95465.1"
FT                   /translation="MLESNFAISELRRKLANIVRIGIVEKIDYEKAKVKVKIGELVTDF
FT                   LPWITNRAENWLPPNIDEQVIVLSPLGELSLGVVLPAIYQEKYPPPENKKEVNSIKFQD
FT                   GTKFTYDKGKHHLEIEVVDKITLKVGESSIEIAKNEIKLKAKRINLN"
FT   gene            complement(771886..772359)
FT                   /locus_tag="WRi_007120"
FT   CDS_pept        complement(771886..772359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007120"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95466"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3H4"
FT                   /protein_id="ACN95466.1"
FT                   /translation="MTAFWTNLHEVICNTLKAEIPAIQTCEVYPAIRKELAAPAVFIEL
FT                   SSLEQGKDPGTEELALRAKFEARIVIDSTIENAPIIVRSLAAEVARVVNKNTWNVKNVS
FT                   PGEFISGGGDDFRPELDAYLVWMVDWAHELHVGRSIWEVSKIKPHLIDVNVGK"
FT   gene            complement(772340..772837)
FT                   /locus_tag="WRi_007130"
FT   CDS_pept        complement(772340..772837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007130"
FT                   /product="minor tail protein Z, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007130"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95467"
FT                   /db_xref="InterPro:IPR010633"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3H5"
FT                   /protein_id="ACN95467.1"
FT                   /translation="MFNIEVNENIERIIHNIDANKAKIELAAVRALNKTALWLKSQAVR
FT                   EISEEKQIRLKVIRKRLRIIKARKSTLKVLIRAYLYDVRMRNIKQAKIRTAFNDAFMAT
FT                   MPRGYRGIFKREGKTALPIQEVKLPLEPEASRIIENLVNYEVERIFEKYFTHELFYDGI
FT                   LD"
FT   gene            complement(772830..773150)
FT                   /locus_tag="WRi_007140"
FT   CDS_pept        complement(772830..773150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007140"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95468"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3H6"
FT                   /protein_id="ACN95468.1"
FT                   /translation="MQENIKRLFKDCFAHLGEVACYKSKDKSYMVQVLKQQPDKLYEIG
FT                   EGQFVGEMLFLEVSIFDVLRPMVGDIFVIDDRKYKVYSPPLRDNSGVVWNIKCTVFGEK
FT                   DV"
FT   gene            complement(773234..774238)
FT                   /locus_tag="WRi_007150"
FT   CDS_pept        complement(773234..774238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007150"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95469"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3H7"
FT                   /protein_id="ACN95469.1"
FT                   /translation="MQNPFTNTAFSMTALTNAMNILPINYGRVENLNLFPSRSVRFRHI
FT                   TIEEHNGVLSLLPTQVPGAPATVGKRGKRKVRTFTIPHIPHDDVVLPEEVQGIRAFGSE
FT                   SELKALADVITDHLQLMRNKHAITLEHLRMGALKGIILDADGSELLNLYNEFEITPKVV
FT                   NFALGTATTDVKRKCLEVLRHIEDNLSGEYMTGIHALVSPEFFDALTSHAKVKEAYERW
FT                   QEGAALRNDMRSGFTFCGITFEEYRGQATDPEGTVRRFIERDTGHCFPLGTASTFTTYF
FT                   APADFNETVNTLGQPLYAKQGPRRFDRGTDLHTQSNPLPMCHRPATLIKIVAT"
FT   gene            complement(774264..774635)
FT                   /locus_tag="WRi_007160"
FT   CDS_pept        complement(774264..774635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007160"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95470"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3H8"
FT                   /protein_id="ACN95470.1"
FT                   /translation="MSCISEQNNLGDLLKYEVSSLYSRDQITVAKGQNIKLGAVVAKKT
FT                   EDGLIRVLNPAGTDGTQTAIGVIVSDVNAIENTKAVIVTRVAILADHAVVWPANITEEQ
FT                   KAEVIKQLEGRGIIIRKGV"
FT   gene            complement(774703..775740)
FT                   /locus_tag="WRi_007170"
FT   CDS_pept        complement(774703..775740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007170"
FT                   /product="minor capsid protein C, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007170"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95471"
FT                   /db_xref="GOA:C0R3H9"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3H9"
FT                   /protein_id="ACN95471.1"
FT                   /translation="MKQQWLNRCVMVEPRSFELLSLQAGKQPIFKNIKHAVRNSERGII
FT                   PIHGILTKKSETFDGLLGMTSYEKIHEEIERALEDKSIETILLDIDSPGGEVNGVFDLA
FT                   DFIYESRAKKRIIAIANDDAYSAAYAIASSAEKIFLTRTSGVGSIGVIASHIDQSGFDE
FT                   KQGIKYTTVFAGSRKNDLNPHEPITSESLENLKSEVNRLYGMLVELIARNRSLSVEAIK
FT                   NTEAGLYFGEKAIEMGLADGMTILSSINKNRSITMNEQTTNDLETDNLTKYRTEVLELI
FT                   RLCNISKMPEKIGEFIEQSVSVEQAREVLMELLAERTKKTEILSAVPQNSGEELMMQVA
FT                   KSRRS"
FT   gene            complement(775737..777158)
FT                   /locus_tag="WRi_007180"
FT   CDS_pept        complement(775737..777158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007180"
FT                   /product="portal protein, lambda family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007180"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95472"
FT                   /db_xref="GOA:C0R3I0"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3I0"
FT                   /protein_id="ACN95472.1"
FT                   /translation="MLLKSFKQLFNKPKIKSSAWDAAGSGRRFLHFQPELGSINNLLSQ
FT                   SLETLRSRSRDMVRKNPYAANIIDTIVSNSIGTGIKPQSKARDGEFRKKVQELWLKWTD
FT                   EADSNGISDFYGLQALVCRSMIEGGECFVRLRTRKLEGYVPLQLQVLESEHLDSKSNQK
FT                   LANGNVIRNGIEFNRLGQREAYYLFREHPGEGSFGESVRVPANDVLHIYRPLRPGQIRG
FT                   EPWLSNILLKLYELDQYDDAELVRKKTAAMFAGFITRLDPEANIMGESESNEQGVALSG
FT                   LEPGTMQLLDPGEDIKFSEPSDVGGSYEAFIRQQLRAIAIGTGITYEQLTGDLTGVNYS
FT                   SIRAGLIEFRRRCTMLQHNIMVFQFCRPVWDRWLELALLSGELDIGEEWTKGKEGAKKE
FT                   VKWIPQGFDWVDPLKDQQAQQMAVRNGFKSRSEVVSEMGYDVEEIDQEIAEDQRRASEL
FT                   GLSFDSDVTANQEVL"
FT   gene            complement(777158..778216)
FT                   /locus_tag="WRi_007190"
FT   CDS_pept        complement(777158..778216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007190"
FT                   /product="phage uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007190"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95473"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3I1"
FT                   /protein_id="ACN95473.1"
FT                   /translation="MIKIVERNFMTKVIAKEYTEFLEQLKEQIATSRYKAALAVNSKLI
FT                   VLYHHIGTEILKRQKEHGWGAKIIDQLSRDLRDAFPDMKGFSIQNLKYMRRFAEEYSEN
FT                   EIGQQAVDQLPWGHNIVIMYEVKNKEERFWYIKKSCEHGWSRNILSMQIETNLYKREGK
FT                   AITNFRNNLISPQSDLAQQTLKNPYVFDFLSLGKKAHEREIEKALVAHIERFLLELGEG
FT                   FAFLGRQYHLRVGDRDFYLDLVFYHIKLRCYVVIELKAGKFRPEYTGKMNFYLSAVDDL
FT                   LRQPGDNQSIGLILYRSKVGVIAEYALRDINKPIGLAEYRITENLPENIKTALPTIEEL
FT                   EAELSKVSDQEK"
FT   gene            complement(778216..778452)
FT                   /locus_tag="WRi_007200"
FT   CDS_pept        complement(778216..778452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007200"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95474"
FT                   /db_xref="GOA:C0R3I2"
FT                   /db_xref="InterPro:IPR004174"
FT                   /db_xref="InterPro:IPR036626"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3I2"
FT                   /protein_id="ACN95474.1"
FT                   /translation="MRSKMYNEEYLIQVEEAIKKLQSGERVVSIAYGDHVVRYAEVQIN
FT                   DLLNLRQRIKAELKVAGMKPKRKIVFSTSKGII"
FT   gene            complement(778442..780283)
FT                   /locus_tag="WRi_007210"
FT   CDS_pept        complement(778442..780283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007210"
FT                   /product="terminase large subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007210"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95475"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3I3"
FT                   /protein_id="ACN95475.1"
FT                   /translation="MQIMIYARAFSEGLRPDPQLKVSEWANEYRVLAPTAASEPGKWRT
FT                   ERTPYLKEIMDSLSPSSQAEKVVFMKGAQIGGTEAGNNWIGYIIDQTPGPMLVVQPTVE
FT                   MGKRWSKGRFAPLIESTPCLKSKVKDPRSRDSGNTVQSKEFPGGIVVITGANSSVSLRS
FT                   MPVKYLFLDEIDAYPGDSGGEGDPVLLSIARTNTFAHRKIFLVSTPTIHGISRIEKEFE
FT                   ATDKRYFFVPCPHCNYYQVLKWSQIKWENNDSRTAHYVCTECSGKIENHQKTEMLDRGE
FT                   WRATNQVHNSKVIGFHLSSLYSPVGWYSWQQAVEDFLHAKESEQLLKVWINTTLGETWV
FT                   DKGEVPDWKQLFNRREFFPVGTVPRREVVLTAGVDVQKDRLEVEVVAWGKSRESWSIDY
FT                   RVFEGDTGGGEVWGKLSELLNHHFIGQNGLEYMISMMAVDAGYATQEVYNWVRGHQGAG
FT                   RVMAVKGVNKALVPLSSPSRVDITVGGQKLKRGIKLWPVGVSILKSELFQLLNILKEEE
FT                   GKALPGYCHFPEYAPEYFKQLTAEQLVSKVVKGYTKQEWQKVRERNEVLDCRIYARAAS
FT                   IALGIDRWPESKWNSLSEKPESKKPKKVRQSKWLNEK"
FT   gene            complement(780274..781401)
FT                   /pseudo
FT                   /locus_tag="WRi_p07220"
FT                   /note="ankyrin repeat domain protein, truncated; disrupted
FT                   by IS-insertion"
FT   gene            781626..782649
FT                   /pseudo
FT                   /locus_tag="WRi_p07230"
FT                   /note="transposase, degenerate; disrupted by frameshift;
FT                   ISWpi7"
FT   gene            782943..784439
FT                   /locus_tag="WRi_007240"
FT   CDS_pept        782943..784439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007240"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007240"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95476"
FT                   /db_xref="GOA:C0R3I4"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3I4"
FT                   /protein_id="ACN95476.1"
FT                   /translation="MPYRNGVAYYGAYGGGDNTASQARNPTTSRQLSESTKQLFKAIDD
FT                   GNLEDFKEALAEGADVNAFDKEGMTPLMSIVTNLSAGSETEKEYQNMIRLLLLHRSIDV
FT                   NISEQNNNNTVLHLAMCFQQKKTLQLLLSHPNINTYLTNKNHQNPEECARQNRAGHLII
FT                   EIQKAQKGKELLAALSSGNICQAKRLLNQELHPNCWRRTQDGRIKTPLSLIIRLCLRTI
FT                   TEDEKEVLTKLLKHKDLDFSYEQYAQLKQTIEQAIQSRLTDTINRKDLDDVKKLVEDNC
FT                   FINRAVVTAALGGVDNPVNSIKDYLNEKFPANTNNIPEDFEKFLQGLERTKAQLVEKEQ
FT                   ELTNKTGKISQLEKDLVQVRQEKSAQQSELIEFKRIVCGRASDTVEISRLKRDLKQVRE
FT                   ERDRLSSENRLLRSNKNEKSSQAISSGRKLSNYASACFILLGVYTVVACLVIEDYPGII
FT                   SAFFTAVALAFFLLGCCNLYKANTILSDVESTQLGGLERS"
FT   gene            complement(784436..785356)
FT                   /locus_tag="WRi_007250"
FT   CDS_pept        complement(784436..785356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007250"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007250"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95477"
FT                   /db_xref="GOA:C0R3I5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3I5"
FT                   /protein_id="ACN95477.1"
FT                   /translation="MDLGSIIEKWYEWLRCNRSYSPNTLESYMRDLKDLISFLNTHIGG
FT                   EVNVGTLKNLSIPELRSWLTSRYARGVNARSNTRALSVIRNFFKYIKNNHNIDNEAVFS
FT                   LSRPIQRRTLPKALSIPNIKTLLKEMKLSDLGEPWVVKREIAIIVLLYGTGLRISEALN
FT                   LRVSDINNESLIVTGKGDKQRQVFILPVVKKCIQEYIKACPYLDEAQHLFVGVRGKKLG
FT                   RTYVANRLQKIRRMLNLPEILSPHAFRHSFATHLLQEDIDIRSIQQLLGHSSLETTQIY
FT                   THLNYQDVFNMYKNFQQGLEKKSKL"
FT   gene            complement(785359..786729)
FT                   /locus_tag="WRi_007260"
FT   CDS_pept        complement(785359..786729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007260"
FT                   /product="Dihydrolipoamide dehydrogenase E3 component"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007260"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95478"
FT                   /db_xref="GOA:C0R3I6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3I6"
FT                   /protein_id="ACN95478.1"
FT                   /translation="MTDYDLIVIGGGPGGYKCAIAAAKLGLKVACIDKNSIFGGTCLRV
FT                   GCIPSKALLHSSYQYAHTKNDLSKLGIKIKDASFDLKEMLGYKDARVQELGKGIEYLFN
FT                   LHKITKINGLASFDQGNLEVSVEGKVLKTKNIVIATGSDVISLPGINIDEKNIISSTGA
FT                   LSLTEVPKKLVVIGAGAIGLEMSSVWSRLGSEVTVVEFFDRIAAAMDGELSKSLLSSLQ
FT                   KQGIKFLLSTKVEEIKQSSNSLSVKVCSVKDNQTNTIEADKVLVAVGRKPCTESLEKIE
FT                   KDSRGFVQVNNRYETNVKGIFAIGDVIGGAMLAHKAEEEGVAVAEIIAGQVPHVDYEII
FT                   PSVIYTHPAVSSIGKTEEELKSVGRKYKVGKCQFAANGRAKITDDAEGFVKVLTCSRAD
FT                   TILGVHIIGAYADTLINEAAVAMAYGAAAEDIYRICHSHPDINEAFRDACIDAFFKK"
FT   gene            complement(786722..787831)
FT                   /locus_tag="WRi_007270"
FT   CDS_pept        complement(786722..787831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007270"
FT                   /product="PQQ enzyme repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007270"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3I7"
FT                   /protein_id="ACN95479.1"
FT                   /translation="MKVIIVMIMLLCSSYTMASERISLVDKKLSQGYVAPVLIENSVIL
FT                   SDKHGALYSFDIDNSKAMNWKLHLSHRKKIGNMSLSHYEKNVFFIVDNTLHAIGAKTGK
FT                   IEWEKELRAPVRGKAAVINNKLVVLTIDNYLYVFDIKDGSSAWAYQNGINEVRGLYSIS
FT                   PTISNDKIIAPFSNGELIAFNEDGKKLWSQKLATNLLDTQLTDVTTTPRVLGDTLIATN
FT                   NSYIYGIDVKSGNILWSKSLQVKSVSDIESYYSPLIPAEKQKEGGRIFIVTKDDKIIGL
FT                   DIKNGETVWASDLIENTQLFAPIMHAHTLWVTSNKSSMFAFPGSESAGKVVKVPGNVFH
FT                   TPVFTRNKIYVTTEKNGVYSLENRFVFYD"
FT   gene            788189..789115
FT                   /pseudo
FT                   /locus_tag="WRi_p07280"
FT                   /note="transposase, degenerate; ISWpi9"
FT   gene            complement(789222..789308)
FT                   /locus_tag="WRi_t07290"
FT   tRNA            complement(789222..789308)
FT                   /locus_tag="WRi_t07290"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCC"
FT   gene            complement(789340..790146)
FT                   /locus_tag="WRi_007300"
FT   CDS_pept        complement(789340..790146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007300"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95480"
FT                   /db_xref="InterPro:IPR011928"
FT                   /db_xref="InterPro:IPR018964"
FT                   /db_xref="InterPro:IPR019228"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3I8"
FT                   /protein_id="ACN95480.1"
FT                   /translation="MQTTLKNHLAGELLTTATCWKLTLAGGEVMGFTDYDEDLNIDNIL
FT                   YKSSSGFTASSIILNSNLKTDNLEIEGILNSVDIKKKDVLSGKYDFANIEIFLVNYKDL
FT                   TQGTMNLHSGIFGKVTLSSGRFIVEIRGLSAKLERSIAELYSPACRAQFCDDKCKADTK
FT                   KFSKISTITKVIDERRFEDTNLTESDEYYKHGVVKFFGSIAFEGVVKEYKNKVVTLFTS
FT                   PPYQIFAGDKYSILAGCDKTFPTCRSKFNNTVNFRGEPYIPGFYIV"
FT   gene            complement(790583..792562)
FT                   /locus_tag="WRi_007310"
FT   CDS_pept        complement(790583..792562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007310"
FT                   /product="Putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007310"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95481"
FT                   /db_xref="GOA:C0R3I9"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3I9"
FT                   /protein_id="ACN95481.1"
FT                   /translation="MKKSMYTRTALVSLLTLCSFSSFAADFPDESMKEIKKQESTKTSG
FT                   KTEVMKTSNKKLKEKMDRICNADPRKKAEELKKKEELRLAAEQKKKEEIRLANEKKAKL
FT                   IEDSKAKALNAKNSNIEKGKVSKTKRSKTKNAKVEAKDVKKDIKVVNKNTEEKGKASPV
FT                   VSVGGVDIIDTNQGQSNLRITFGGVVDAQGYGKAGPSGADYKRYNVMPNRSTEYYNATP
FT                   DITKGANPIFYEGIGNIGDYSNDMGMIADAILHLRAENKNEDLGLLYGADVQFHVPVTE
FT                   GKGASQGVYAAKGRSAHVFVNSKYGDVKLGYQFGPEALMRLDATRIATVDGAADSDWFR
FT                   KVNLEGSAASFPFYVTPRLYTESFSSESEKFSFRMAGKYNKGVMTTLPFRVAYYSPNYM
FT                   GARFGISYSPRYDSGLFTVKETVSEDKGGKIEHKETIKHVGPDYEHIVSAGASYEYDFD
FT                   KHNIKVKTSAVGEYGFPKQPSKDKHLYKEFVEYNDLMGVNFGVSADYKINEDQGVKFAA
FT                   SFAYLGKSGQPKGIKKLIGDTYTEIDSKDATDGKRVEGLKAQFGKDSIDTMYWTVGAGY
FT                   QHENIYTSLTYFGSRMNDKDMLHDGALGVQYDLSPACSKNKFVPYAALHYFMTNETGKL
FT                   KDESDADVPSNQGILLLTGVKFSF"
FT   gene            complement(792770..793591)
FT                   /locus_tag="WRi_007320"
FT   CDS_pept        complement(792770..793591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007320"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95482"
FT                   /db_xref="GOA:C0R3J0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3J0"
FT                   /protein_id="ACN95482.1"
FT                   /translation="MLNSLLVFDIETIPDVNSCKNLLNISDDSSVEEKRDALTKYHLEI
FT                   TNGQNSFLRQPFHLVVVISFLLCNISYQSGYEVFTLQEIRSGGTLNSSEKELVKGFFNY
FT                   ISEKKPRLVSFNGRTFDIPVLKYRAMVHGIQAEYFHKAGDKWNSYNQRYSSDWHCDLLE
FT                   SLSDFGASARVKMNEVCAAFNLPGKIGVDGSQVMGLYDSGKIQEIRDYCETDVINTYLI
FT                   YLRFMHHQGRITTESYNKSVEELLLECEKKEYLKKFKEEWQITCGGKILLP"
FT   gene            complement(793584..794468)
FT                   /gene="era"
FT                   /locus_tag="WRi_007330"
FT   CDS_pept        complement(793584..794468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="WRi_007330"
FT                   /product="GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007330"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95483"
FT                   /db_xref="GOA:C0R3J1"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3J1"
FT                   /protein_id="ACN95483.1"
FT                   /translation="MKEQKCLFVTIAGLPNAGKSTLINSIIGKKIAIVTPKVQTTRTQI
FT                   RGVATCNNTQVVFTDSPGIFSAETKLEKALVKSAWSAVKDSDITLLLVDVSNYLKNIER
FT                   IKTIFMRLQRTKGRCILVINKTDLVKRPELKMAHEHLNLLYKFEKVFMISALKNDGLSD
FT                   LMNYLSEVASVSPWFYEEDQITDSSTNFLSAEITREKLFLNLREELPYSTAVITEQFEE
FT                   KKDKSLVIKQIIFVLKDSHKKIVLGKDGSNIKKINIEARAELEKLFECKVHLFLFVKVR
FT                   PWIDRPEEYIGNA"
FT   gene            complement(794599..794703)
FT                   /locus_tag="WRi_007340"
FT   CDS_pept        complement(794599..794703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007340"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95484"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3J2"
FT                   /protein_id="ACN95484.1"
FT                   /translation="MVKTLPLNQAVVQAMASTQEPSLANPPMDFLKSF"
FT   gene            complement(794719..795741)
FT                   /gene="cydB"
FT                   /locus_tag="WRi_007350"
FT   CDS_pept        complement(794719..795741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="WRi_007350"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007350"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95485"
FT                   /db_xref="GOA:C0R3J3"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3J3"
FT                   /protein_id="ACN95485.1"
FT                   /translation="MFDFSSLINLPLIWGLLIAIAVLLYILMDGFDLGIGILLPFAPSD
FT                   KCRDHMISSIAPFWDGNETWLVLGGGGLFAAFPLAYSILMPAFYIPIIIMLLGLIVRGV
FT                   SFEFRFKAEGKYRRLWDYAFHFGSLGAAFCQGMILGAFIHGVEVNGRNFSGGQFDWASA
FT                   FSVMTGIAVIFGYALLGSTWLIMKTENITQEWARKVASYTLGFVGIFMGLVSVVTPFLN
FT                   ERIKNFWFSMPNFYYLFSIPLLTSWLFFMLWFDLQNTKREYRPFFLSIAIFFMGYLGLG
FT                   ISIYPWIIPFQYTILDAAASGPSLSLMLIVIIPLLPIILTYTGYCYYVFRGKSNYEHTY
FT                   "
FT   gene            complement(795734..797140)
FT                   /gene="cydA"
FT                   /locus_tag="WRi_007360"
FT   CDS_pept        complement(795734..797140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="WRi_007360"
FT                   /product="cytochrome d ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007360"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95486"
FT                   /db_xref="GOA:C0R3J4"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3J4"
FT                   /protein_id="ACN95486.1"
FT                   /translation="MFKFDPLLLARIQFAFTIGFHIIFPAFTIGLASFLAFLEWCWLKT
FT                   GDTRFRDVYKFWIKIFAVAFGMGVVSGVVMSYQLGTNWSIFSDRIANVLGPLFSFEVLT
FT                   AFFLEASFLSIMLFGWNRVSSRMHFASTCIVAVGTLISAFWIIAANSWMQTPAGFTIGE
FT                   NGLLYPTNWLEIIFNPSFPYRFIHMVTAAYLTTAFVVGGVGAFYLWRKRHAPQARIMLG
FT                   MATIMVALAAPFQLFMGDRHGLNTLKHQPAKIAAMEGIWETEKGAGLLLFAYPDQQNEI
FT                   NHYEIKIPNLASLILTHDFLGEVKGLKEWKKEDRPPVVWVFWSFRIMVGVGILMIIIGS
FT                   VSVIQYLRGKLFQSCFLHGWWISMMPSGFIALLAGWFTTEIGRQPYTVYGIMRTIESFS
FT                   SAITGPQVAWSLIAFIVMYTLIFGAGSYYILKLIYKGIPVIKEEEQFYKHGIGASVIDA
FT                   GTSGKDNNHV"
FT   gene            798042..798659
FT                   /locus_tag="WRi_007370"
FT   CDS_pept        798042..798659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007370"
FT                   /product="superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007370"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95487"
FT                   /db_xref="GOA:C0R3J5"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3J5"
FT                   /protein_id="ACN95487.1"
FT                   /translation="MSFTLPELPYDKTALEPYISAKTLDFHYDKHHKGYLNKLNELVEN
FT                   TDYQHVKIEELITEVHGNSSNLPIFNNAAQVWNHTFYWNSMKKNGGGKPKDSSLLAKKI
FT                   QDDIGGFDKFYEEFSNHGVSQFGSGWVWLVLEKGRLGKLKITKTPNADLPIIYGQVPLL
FT                   TMDVWEHAYYLDCQNRRIDYIKVFLDHLINWDFAEENLKKNT"
FT   gene            798661..799935
FT                   /locus_tag="WRi_007380"
FT   CDS_pept        798661..799935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007380"
FT                   /product="peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007380"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95488"
FT                   /db_xref="GOA:C0R3J6"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3J6"
FT                   /protein_id="ACN95488.1"
FT                   /translation="MNVPRVTKLDNGLRIITEQVRDIDSVALSIRVGVGSRAESAKQNG
FT                   ISHFLEHMAFKGTKTRTAFEIAKAFDDIGGVFNASTGRESTTYYAKVLKKDIKTGIDIL
FT                   IDILMNSTFPEDELEREKGVVIQEIFQTNDSPSDIVFDKYFEAAYKDQPFGRSILGTQD
FT                   TVKSFTRGDLDNYINEHYFGENMLFAVAGNVEHEEVVALTKDFFSKIHSKKLKKSQNAT
FT                   SHTGGEYLEHRKLDQVHLLIGLPSVSRHDDKYHTFQVLDSILGSGMSSRLFQEVREKQG
FT                   LAYSVYSFNSSYTDTGMFSIFAGTDSSNLDKLLKSITTELKKLSTDDLREEEVNRVKER
FT                   VKSQILMSRESVSSRAETLGHYYGNYNRYISKNELIEKISAVTTANVKKAAEELLSQHE
FT                   KATLAAIGEIKSLPSYDKVVSMLKA"
FT   gene            complement(800235..801830)
FT                   /locus_tag="WRi_007390"
FT   CDS_pept        complement(800235..801830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007390"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95489"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3J7"
FT                   /protein_id="ACN95489.1"
FT                   /translation="MAKGNNTLLIFDFDNTITNGHMHNALSRLSKSDFNSTQNNAATDN
FT                   DIKNFLENTDGIKNKEGLKSVLQSALSSGIEVNIASYTKYPDAVKEVVKDHLGLFEEQT
FT                   GSISVFGGFPGDYDNQLQELDVREQQSQVGKNLHICEAIVKYKNKHGELPKTVMLVDDD
FT                   VKNIQKINEFVASMSKRGGWLKENGLSVEDIKNIKFEGARVPKEDKNVGYLERVQEFIS
FT                   PRKEESPQLPPKLKNLNAVSQNNEEPPQLLPKKRKSSDGMVADGENKKQDIKGMLSSET
FT                   QANPTRSKRHAMMLDPQQIESIHQNAEEPPLGKKYAHTETISLSKAFDTIRDFFQDCGQ
FT                   KIINTIHRLLKKEVITGVKEQGYDVNSEKGKSEITIYGNKLIDIDKIKTDFIDTSLIRI
FT                   MELGEEKIKDLNNNYKGDQLGREISKLLNAGSQKENINSNYNDGEPIFQTRKEALNYPP
FT                   QKKDINSNSVRGNYNGGEPTHQTVQEARNYHRQKKGIDSNPVSKKPLAPPVPPKNYTEK
FT                   VTQSRNAGGIKIGK"
FT   gene            complement(802555..803772)
FT                   /gene="tgt"
FT                   /locus_tag="WRi_007400"
FT   CDS_pept        complement(802555..803772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="WRi_007400"
FT                   /product="Queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007400"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95490"
FT                   /db_xref="GOA:C0R3J8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3J8"
FT                   /protein_id="ACN95490.1"
FT                   /translation="MKEEFAFKIIKQSGSARVGIIKTPNGNIETPAFIFCATKAAIKAA
FT                   DIERIREEGTQIILSNTYHLMLQPGENTVAKLGGLHKMMGWNGPMLTDSGGYQIFSLGH
FT                   GSVSEEIKGIRKKQKTLIKINEDGAIFRSYINGKTYCLTPEKSIQIQQKLGADLILVLD
FT                   ECTPFHVSKEYTAKSMLMSHRWAERSLNEFEKNNNGKQALYGISQGGIYHDLRRESCDF
FT                   INNLPFFGQAIGGSLGQSKEQMYDVVSFTMDHLKKDRPTHLLGIGGIVDIFHGVSLGID
FT                   TFDCVHPTRLARHGGALIKVKNRDSISSKCKEHINLRNQQFELDDNPIESDCLCFTCRK
FT                   HSRAYIHHLLKAKELLAYTLVTIHNIFFMNKLMASIRQAILDDRLDQEKNNWISEIPLH
FT                   FDLASL"
FT   gene            complement(803773..804273)
FT                   /gene="nuoE"
FT                   /locus_tag="WRi_007410"
FT   CDS_pept        complement(803773..804273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="WRi_007410"
FT                   /product="NADH dehydrogenase I, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007410"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95491"
FT                   /db_xref="GOA:C0R3J9"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3J9"
FT                   /protein_id="ACN95491.1"
FT                   /translation="MIEKEEQFSFTSENLKKAGKFIEMYPKGREGSAVMPLLYLVQEQC
FT                   GWVSESAMRYVADMLHIPHIRVYEVANFYTMYNLKPVGKYLIQICRTTPCWLCNSEEVL
FT                   NTFKKKLGINIGETTKDNLFTLKEVECLGACINAPVVQINNDFYENLTPEKVENIIAEL
FT                   SGK"
FT   gene            804498..806600
FT                   /locus_tag="WRi_007420"
FT   CDS_pept        804498..806600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007420"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95492"
FT                   /db_xref="GOA:C0R3K0"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3K0"
FT                   /protein_id="ACN95492.1"
FT                   /translation="MSILRRLLGINSNTPEIKEAIGFNPTNVELIEGNGVAYGLSYQDN
FT                   GNGSSKVKLLISPLYQSKTYECGTNISVANEFKDQLSLTLIEDSAEIDKVGVIFPEEGI
FT                   SEEGEKCVKGLSFNTYGIKQSVNTPSVEHLDKRKLQKNIDNNSLANVGNSYFQPRAVKV
FT                   GNGDVIVIAHNLKDQTLVSWYLKSSESGKFKVLTGEKGVTERKLFNFDNQGQLALNGNT
FT                   MLYSQVSKRITKENQEVRKTRIFKFDMAKVIQGLKDGVNGFLLGNRKGQIDNKALSLSR
FT                   EHEISFLQYVEQTEGNDLVAFLENDQSANEQRLHIATPLKNGSVSDFPIYQFTDPIEQL
FT                   YIKGNGQGGFIVTAVSGENIVTFNQNGSGKSSEATIIPANSIKTLSDFVNIINGRLTPD
FT                   IISSSTVAPITVAETVVTSKKTPTAAITSTAETDAVKTTKLTTEAVAPTSTISKPSTES
FT                   TTVAKTTTTSQATTVATTSTSVPIVTSGTETSTVKPTAATGASTSTMSKPSTESTTQTS
FT                   TVTVKPTTEAVAPTSTTNKPSTESTTQTSTVTVEPTAPTTSSEKTTQTVFSIPSTRTKE
FT                   STTPIFTTTLLPQSTSSPQPTQLAIGSNKAGMIGGSLVGAIGIVGIIGFIAYRYVKGRN
FT                   AAPVLELTDLGYRRRSSSSSDEEIFTTGNRMRTIYQSETVLNSISVESSSRSRSSSSSS
FT                   SGGPGS"
FT   gene            806759..807106
FT                   /locus_tag="WRi_n07430"
FT   ncRNA           806759..807106
FT                   /locus_tag="WRi_n07430"
FT                   /product="RNAse P"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(807159..807929)
FT                   /gene="ctrA"
FT                   /locus_tag="WRi_007440"
FT   CDS_pept        complement(807159..807929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctrA"
FT                   /locus_tag="WRi_007440"
FT                   /product="two component transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007440"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95493"
FT                   /db_xref="GOA:C0R3K1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3K1"
FT                   /protein_id="ACN95493.1"
FT                   /translation="MRILLIEDDQVSAKTVVNALTSDGHFCDVVTSAQDYNNNMVSSNG
FT                   DYYDLVILDIHLPGDIDGYDILLRLRSAKIKVPVLILSCISAVNHKAKGLGYGADDYLT
FT                   KPFHKSELLARIKAIVRRTKGHPESVIKIGNININFDHRIVEVKGKTVHLTNKEYSMIE
FT                   LLALRKGTVLTKEMFLNHLYNGLDEPSDNKIVDVFMCKLRKKLESANDGKSHIETVWGR
FT                   GYVLKEYIDDDEYSNVNVGESSDGYQAEQVKDNA"
FT   gene            808255..809238
FT                   /gene="gpsA"
FT                   /locus_tag="WRi_007450"
FT   CDS_pept        808255..809238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="WRi_007450"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007450"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95494"
FT                   /db_xref="GOA:C0R3K2"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R3K2"
FT                   /protein_id="ACN95494.1"
FT                   /translation="MAISILGAGAWGTAIAISLGSKKDVILWTRNETTFESINGKRESD
FT                   KLPGCRISDNVSVKLAIEDTINASVTILAVPTQSLRKVCQQLHNCNLKKDVAIILACKG
FT                   IEKSTLKLPSEIVNEILPNNPIAIFSGPSFAVEVARKLPYSMVLACQNNTLGSKLVSEL
FT                   QQENVKLEFSNDIIGVQICAALKNVFAIACGIVLGSKLGFNAHAALITKSMSEIKALYS
FT                   AKIGDGSVDINTLLGPACLGDLIMTCTSLNSRNLSFGFKIGNSDNGFNVQQILSEGKSV
FT                   IEGFSTAESIFNLAGKLKIKMPICEAVYRLLYESASIEDTISVLIS"
FT   gene            809258..809740
FT                   /locus_tag="WRi_007460"
FT   CDS_pept        809258..809740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007460"
FT                   /product="phosphatidylglycerophosphatase A, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007460"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95495"
FT                   /db_xref="GOA:C0R3K3"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3K3"
FT                   /protein_id="ACN95495.1"
FT                   /translation="MKFLYKLISTWWLSGTVKKMPGTVGSLASFPLVPVILSNKILGAA
FT                   IISFLFLIGLWSTGNYIKHYKTSCDPKEVVIDEVVGQLLTILLVSILLSQEMNCSSLLL
FT                   CFFSFRFFDIIKTWPINLIDKNTKGPLGIMLDDVIAAILACVLIGAFYCLLLVYAG"
FT   gene            809730..810509
FT                   /locus_tag="WRi_007470"
FT   CDS_pept        809730..810509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007470"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007470"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95496"
FT                   /db_xref="GOA:C0R3K4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3K4"
FT                   /protein_id="ACN95496.1"
FT                   /translation="MQDKKIYYSSLIVQNLKDYILYTANLSEWEVHDEFDNIIFTINGT
FT                   RESLFNFVFCGDQCTELSIQKTLDYLRTRDIEATWVINSHMKIRDILEKCEIKHVSTPK
FT                   KALLNMKNYFLPADVIPNLRLNAVNGSNLLEQLDLHTSKIFYHGVGIVSTFFRGLSNYD
FT                   DKNSRLRFFLVTLNNEIIGTCGLYVQDSVAGFYSDGVLPIYRNRGIGTQMVLERIKIAK
FT                   QLECKYIVAHCMKSSVNLYKRLGFQMLGNLYLYTSSA"
FT   gene            810552..811688
FT                   /locus_tag="WRi_007480"
FT   CDS_pept        810552..811688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007480"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95497"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3K5"
FT                   /protein_id="ACN95497.1"
FT                   /translation="MFFLYEVVLILILILFFLSYSKLKISNKIKNLQHQNVIINNLIDT
FT                   VNDGFYIWDAKKRIEKFSPNLLILLNTVFYSFNEFVNFFEQSESLIKNFVEAKEINKSF
FT                   TLDLKSKDSEVYCICYGRSIIDDSNNVIGVLLWIRNVSDCKIKANGLELENSKLTQEVE
FT                   SYKNVFNSLPFPILRYNKSRKVEFYNLFYDKYVDGSKKFAITGSAHSTKPGRHVITYKN
FT                   EPKVFDFVKIPIQGSGSIVMYGKDVSDAEKLYTELNSDLATQKNLLERLPVAIVIYSKN
FT                   QKLKFYNNAFIKTFQFDPKFLASYPTYHEVMLYLFESKKLLEKEDFQTISNQRHELFKK
FT                   LFESYDDTMHFTNGKAFRVLTIPYASEGLLFSYEECKR"
FT   gene            complement(811692..812480)
FT                   /gene="sdhB"
FT                   /locus_tag="WRi_007490"
FT   CDS_pept        complement(811692..812480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="WRi_007490"
FT                   /product="succinate dehydrogenase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007490"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95498"
FT                   /db_xref="GOA:C0R3K6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3K6"
FT                   /protein_id="ACN95498.1"
FT                   /translation="MVQFSLPKNSKINQKGKIYPIPARAKNIRRFQIYRWSADDEKNPR
FT                   IDTFFIDMDSCGPMVLDALIKIKDEIDSTLTFRRSCREGICGSCAMNIDGTNTLACTRS
FT                   IHDIKGDVKIYPLPHMYVIKDLVSDLSQFYEQYKSIKPWLQADKPALPNKEYSQSSEDR
FT                   KKLDGLSDCILCACCSTGCPSYWWNSDKFLGPAILLQAYRWIADSRDNKTGERLDVLND
FT                   PFKLYRCHAIMNCTKTCPKGLNPARAIAKVKQLMVEREGV"
FT   gene            complement(812567..813019)
FT                   /locus_tag="WRi_007500"
FT   CDS_pept        complement(812567..813019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007500"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95499"
FT                   /db_xref="GOA:C0R3K7"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R3K7"
FT                   /protein_id="ACN95499.1"
FT                   /translation="MLEVNILDKKWCSIIENPKNFVLGVINASLKELKIDHYKPNISIA
FT                   LADDDLLHQLNLKFREMDKPTNVLSFPYEQLSNECDLGDIAISIDTIKRESHEYYIPIL
FT                   AHIAHMLVHGLLHLLGYDHQKKDEEIIMKNLEREILASLGYNMCAI"
FT   gene            complement(813404..813802)
FT                   /locus_tag="WRi_007510"
FT   CDS_pept        complement(813404..813802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007510"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95500"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3K8"
FT                   /protein_id="ACN95500.1"
FT                   /translation="MQFWLLKSEPSEYSWQKMEKEQVVEWDGVRNYQAQNYMKIMKASD
FT                   LAFFYHTGKEKAILGIVEVFKEYYHVNDPKFGLVNVKFLKPLNNQVTLNNIKQNPLLKN
FT                   MTILKQPRLSIAPVSEIEWNEIIRMSDV"
FT   gene            complement(813802..814998)
FT                   /gene="ftsZ"
FT                   /locus_tag="WRi_007520"
FT   CDS_pept        complement(813802..814998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="WRi_007520"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007520"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95501"
FT                   /db_xref="GOA:C0R3K9"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3K9"
FT                   /protein_id="ACN95501.1"
FT                   /translation="MSIDLSLPELPILHPRITVVGVGGAGGNAVNNMIQSNLQGVNFVV
FT                   ANTDAQALEKSLCDKKIQLGINLTKGLGAGALPDVGKGAAEESIDEIMEHIKDSHMLFI
FT                   TAGMGGGTGTGAAPVIAKAAREARAAVKDRAPKEKKILTVGVVTKPFGFEGVRRMRIAE
FT                   LGLEELQKYVDTLIVIPNQNLFRIANEKTTFSDAFKLADNVLHIGIRGVTDLMVMPGLI
FT                   NLDFADIETVMSEMGKAMIGTGEAEGEDRAISAAEAAISNPLLDNVSMKGAQGILINIT
FT                   GGGDMTLFEVDAAANRVREEVDENANIIFGATFDQAMEGRVRVSVLATGIDGRNNKSET
FT                   SPISQSEDSEKEKFKWPYSQSESTQDKTLETKPAEQVSEGAKWGSNIYDIPAYLRRKK"
FT   gene            complement(815247..815696)
FT                   /locus_tag="WRi_007530"
FT   CDS_pept        complement(815247..815696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007530"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95502"
FT                   /db_xref="GOA:C0R3L0"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3L0"
FT                   /protein_id="ACN95502.1"
FT                   /translation="MALTNYEYGKGDGIFYAIPQGYIQAEKYWGIPGAASGAGQYAMHN
FT                   KGRTALFPLAVASVVFTAMHMKAGFVSAAEASGFLAKTASYFVGTNQAIAASLPGFIGT
FT                   GVAGQIVAGAIMAIAAVAAVYGTYQVASKLKDVAVEALKGKGQEV"
FT   gene            complement(815780..817243)
FT                   /locus_tag="WRi_007540"
FT   CDS_pept        complement(815780..817243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007540"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007540"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95503"
FT                   /db_xref="GOA:C0R3L1"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3L1"
FT                   /protein_id="ACN95503.1"
FT                   /translation="MIKIGIIELCNVVLAVNIVGLPDKTVAESKERIRAALNSINLLLP
FT                   PKRITVNLSPADLLKEGSHYDLAIAIGLLVVMNVIPVEKVQSYIIMGELALDSRVIPVS
FT                   GVLPTAINAKKDNKGVICPRGNGVEAVWVKNVSILAIEKLTDIIRHFKGEQLIQPVIFN
FT                   YSDAPKEKRLVPDMKDIKGQVVAKRAAEIAAAGGHNMLLVGPPGTGKSMLAKRFIGLLP
FT                   DLTEQEMIDVNIISSITKTGNEIFKVTRPFREPHHSCSMPAMIGGGKNAKPGEITMAHN
FT                   GVLFLDELPEFPRLVLDSLRQPLEDRKVTVARANAHITYPANFQLIAAMNPCRCGYLGD
FT                   ASRSCNKAPKCGTDYKNKISGPLLDRIDICIEMPNVSILSPEISVEGESTKIIRERVIA
FT                   ARKVQTERYSELNIRCNSEVSGEAFNKFTEPDQAGLELLKYVLKENYISNRGYTRVLKV
FT                   ARTIADLAKSEEVKRAHIAEALNYRIKVY"
FT   gene            complement(817173..818804)
FT                   /locus_tag="WRi_007550"
FT   CDS_pept        complement(817173..818804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007550"
FT                   /product="Putative cassette chromosome recombinase
FT                   resolvase, CcrB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007550"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95504"
FT                   /db_xref="GOA:C0R3L2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3L2"
FT                   /protein_id="ACN95504.1"
FT                   /translation="MVTVSLYARVSSRQQAQENTIESQIVELERRISSDGHELLDEHRF
FT                   VDNGYSGSNLERPGLESLRDRVAEGKIDKIYIHSPDRLSRKFSYQMILLEEFKKAGSEI
FT                   VFLNHKFDDNPDSHLFLQIQGAIAEYERAKIMERNRRGKLHAAKAGCISVMGRAPYGYR
FT                   YIAKHVGEGSAQFEVDEEEANIVRKIFSRVGQERASIGEVVHELNKIPIITRTGKRYWK
FT                   RSTIWNMLKNPAYIGQAAYGKTRTCSKPQVKKSKKGTCGKLKSGRFNSDKENWTYIPVP
FT                   KIINENLFDSVQTQLAENRQRARVRQRRETYLLQGLMVCQRCQYTYCGTNHVHKKSTYY
FT                   YYRCSGTNSSKFNGNKICDNKSIRTDVLDTVVWEEVKSILKEPDRIANEYQRRLSENKK
FT                   PLHNQTREKQESKLRLSIKKFIDSYAKGFISQEEFEPRITTMKQHLKEIEEEKEKVLDQ
FT                   KKLQQELSLVTDSLKNFSSSVESKLDQVDWQTKQNIIRMLIHQIEINHNHLYIVFRIKS
FT                   LANFDQNRHNRIMQCCTSSQYCWIAR"
FT   gene            819117..820313
FT                   /locus_tag="WRi_007560"
FT   CDS_pept        819117..820313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007560"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95505"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3L3"
FT                   /protein_id="ACN95505.1"
FT                   /translation="MNVYPSNEFWESDLEVPVNLLLERFQDSNVRQSWLDSLSGKQLSI
FT                   IFQHCFKNHLNGQLFQDGNYDDRSTQQKRKILTSYSDSLFDYYLISYFDRTKLEATVSE
FT                   VARFALTEKLMRSYLVKNNTKYDKRSLLFLLFHINCELLKSVYHFDKVQKRGFVSFALQ
FT                   KSPRQINTSFKEFMSQEAVEQILKFENQLQGFFHHQDRIYMFVRRGSDMDLLLNSNKVV
FT                   HGHKPEWMILDFSIDGTKVNLCAKNTNKAVEIANSIVSGYFNCECTFVNIQDKNFPLQV
FT                   YKFLQACIDGSDPDICIFELNFKSDYFKNSNTYLTLSVKPYDPIAPELHILKPAIGNIL
FT                   QSIQSAKVMFQNKKVTFSFKISGEVYYSEHPLNKKEREDLKKHMEQSYGLKILSRANC"
FT   gene            820279..821388
FT                   /locus_tag="WRi_007570"
FT   CDS_pept        820279..821388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007570"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95506"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3L4"
FT                   /protein_id="ACN95506.1"
FT                   /translation="MVLKSFHEQIADLLSLNNSWINPSQNHIKAARYLFDLGLIKMQER
FT                   CYIVCSREEDHLDWPNVIDPSCSNEIFIDPDFDEACDDAICENCSRHILPNTYKKQRFH
FT                   LLSIYLNTERIIDWFEIKLNDSRLMWEKVEKGVYYICNQGRIVNLIILDFCTDAIFLTI
FT                   DKLRVHPTVLITLKKDIPNLLLSLYVVPMVKLFCQLKTLTEIFQEAAKRGVPEVVENTS
FT                   LQVLPASYISLKRIEPIIPTKLLELQVVKGMVYVNSIEVINKKAASCLNIFRILFRQFL
FT                   HDCEKELPPEKHTLLNINQLEKLLGLNLEADLEQQIRKPLNKMQRTIKSILAEKLGLSI
FT                   ERDDVIQTLGWQRSSHGYRINPFTLTIKK"
FT   gene            complement(821404..823419)
FT                   /locus_tag="WRi_007580"
FT   CDS_pept        complement(821404..823419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007580"
FT                   /product="regulatory protein RepA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007580"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95507"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3L5"
FT                   /protein_id="ACN95507.1"
FT                   /translation="MVELKTQLLQNIRSCLFHLLPRGTFRGDKFYVGDVQGNKGKSTVI
FT                   ELTGERAGLWKDFATGEGGDIIDLWATVHGKNAKIEFPEVMASISEWLGLKKQNNIRNL
FT                   EQYLTCSWNYYDENNQLIVIVYRYDPPLEKKQFKPFDVKRQKFKEPEIRPLYNIPGILK
FT                   SDKVILVEGEKCAEALIEKGITATTAMFGANAPIDRTDWTPLRGKHVIIWPDNDEAGNK
FT                   YAKNVEKKLLELGVASLAMLKIPPNKPKSWDAADCLLEGINIEEFIEKNSRKIIIKPPL
FT                   DIFSWSVERFVGPVPKQRFLVEGLFPLGVTSILAAMGDTGKGMLLLDLALKVAGSVDQV
FT                   CGFGQLVTEHGSVVVFSAEDDTNEIHRRLERLDPKCERLKYKDRLFIVPLPNIGGSFTI
FT                   LKNVRGKVVEISPEFESVVKQLSKVKDLKLIIFDPLASFIHADLNADPAVGDYLMCLLS
FT                   DLACSTGASIITAHHMRKLKGEKPISTVEQARDAIRGTSALVNGVRCSFAFWPVEDMTK
FT                   PMIFRSIGKIPRQNALFYGAVVKANGLADRTIRTYLRNEETGLLEDITEQLKAQNISDK
FT                   DLKIYLTDSIARAASSGHPFTHTGSAGIHKQRHRLPEVFHSMGRDRLERIVQELLQAKQ
FT                   IVKGMANGSKEDKWLDVKTGPFARGVGKFTHGAENF"
FT   gene            complement(823443..824669)
FT                   /locus_tag="WRi_007590"
FT   CDS_pept        complement(823443..824669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007590"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95508"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3L6"
FT                   /protein_id="ACN95508.1"
FT                   /translation="MKYDEEKLWSAVVTRGIQDAVGKNPKLREEAINWLNSKSFETVCE
FT                   LANLNFTRMKNMYGSFMSKKQEKIKALLIDNIKECVSYLLPNGEFYRDKTYIGNLNGNT
FT                   ITVKIVGKEAGDWRNFTEGTGGDIIDLWILIKGDIYSARKWLNKKSKSGEKKGGKREEK
FT                   IFSVKQYLSDQSPIPEDIIAPRILTPGGLLVIGGTPKVGKSYFLLSLLAHLAAGVSFLK
FT                   MKSARPLKIIYLQNEMEYNYIRERIQQIITNQRLPNLAEENLIVTTKMRLTLNDEGIER
FT                   IKEIIGEKFKTIDLIVLDSLDYENMFSGLQSRVEKLRSIINPMAGIIITRHTRKVSTAT
FT                   LAKSPFQALIGANALRSFYTSGMVMFQPSKRANVLQVVYELRNGKSIPAKFISRVNGRW
FT                   QNSKIIATA"
FT   gene            complement(824666..825166)
FT                   /locus_tag="WRi_007600"
FT   CDS_pept        complement(824666..825166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007600"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95509"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3L7"
FT                   /protein_id="ACN95509.1"
FT                   /translation="MLEDLLTDFNTVKPQSRLIPKCTIVKVKMTIKPGGYENWFTKSYA
FT                   TGSIYLNAEFIVTEGPYAKRKIFQVIGIKSGKASVEGDTWGESGRSMLRSILESARNIH
FT                   AHDTSEKAVIARKINSIADFNGLEFTAKVGIEADSRYGDRNRITAVVTPEQNNSIESDW
FT                   VPF"
FT   gene            complement(825190..825987)
FT                   /locus_tag="WRi_007610"
FT   CDS_pept        complement(825190..825987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007610"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95510"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3L8"
FT                   /protein_id="ACN95510.1"
FT                   /translation="MVLKILNNNERLQTISTVKMVIFGPYGIGKTSLLKTIDEPTLCLD
FT                   FEAGLLAVQDWKGDSTEIRTWNEARDIACLIGGPNPALKSDQAYSQRHYEHVSSKYKDF
FT                   SSEFSKYRCIFVDSITVASRLCLLWAKMQPEAFSERSGKQDMRVAYGLLAQEMMAWLNQ
FT                   FQHIRDKDIIIVGTLGQYLDDCNRPVWLPQCEGTKTASEIPGIVDEVISMVGIKKDDGT
FT                   EKRSFVCHTLNPWGYPAKDRSGRLSMVEEPHLGKLLTKIKSKF"
FT   gene            complement(826039..826530)
FT                   /locus_tag="WRi_007620"
FT   CDS_pept        complement(826039..826530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007620"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95511"
FT                   /db_xref="GOA:C0R3L9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3L9"
FT                   /protein_id="ACN95511.1"
FT                   /translation="MKLQNYHIVIKNVKYQAYRLKLAKCFINEAHEDLEQELFCEIWPC
FT                   LDQYDEDKSSFNTFVARLTENKAINLLKKQRCAKRDINNYISTDVTELLESEITKRIDV
FT                   DYMISVLPKEWQNICEQLKFFNLHEVAKMNNVSRTTLNNIIKKIRAKLSSIYYAGKKKN
FT                   "
FT   gene            827414..827884
FT                   /locus_tag="WRi_007630"
FT   CDS_pept        827414..827884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007630"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95512"
FT                   /db_xref="GOA:C0R3M0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3M0"
FT                   /protein_id="ACN95512.1"
FT                   /translation="MLTLDLGKQTGWTILNDGIVQSGSKSFHVSRFSGGGMQFLNFRNW
FT                   LNSLKYKFPGIEVVYFEEVRRHLGTDAAHIYGGFLAHLSAWCEESNIPYQGVSVKTIKR
FT                   FITGKGNASKADVIEAVQKKGFCPTDDNEADSLALMFYVMNFSKDFNTLEIS"
FT   gene            827963..828499
FT                   /locus_tag="WRi_007640"
FT   CDS_pept        827963..828499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007640"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95513"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3M1"
FT                   /protein_id="ACN95513.1"
FT                   /translation="MLTTYEIIAEKCLSSAKKGEKKVRITQAEWAREKGFSRQYVCSLV
FT                   KKGIVELEDGLIDREQANEAVAAIRDPSQPLRRKERGETLSTILLKTRIKNETERGKLL
FT                   EAKVKAEIGKFVSIEEVKTEAFNVARVVRNNLLNIPNRVSALLASLSDTEKIHMVLTEE
FT                   ITNSLQELSNTKFQI"
FT   gene            828519..828854
FT                   /pseudo
FT                   /locus_tag="WRi_p07650"
FT                   /note="ankyrin repeat domain protein, truncated; disrupted
FT                   by IS-insertion"
FT   gene            complement(829098..830120)
FT                   /locus_tag="WRi_007660"
FT   CDS_pept        complement(829098..830120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007660"
FT                   /product="transposase"
FT                   /note="ISWpi7"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007660"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95514"
FT                   /db_xref="GOA:C0R2Q0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2Q0"
FT                   /protein_id="ACN95514.1"
FT                   /translation="MINNFLGIDVSKERFDVSLSFISKKGKRETRKRKFKNDDTGFQGL
FT                   LNFLQKHNVEEVKACMESTGCYSEALAEFLHNAGYFVSVVNPACIRFYAKSKLTRQKND
FT                   QTDAEIIADYCQRQEPSRWTPPSPEKKKLKHLYRCSNALKDELTLANNHLEKKERLPKE
FT                   VANAWEDLAMNIEQKIETIKNSIRELLKQHKELLEDFQLLLTIPGIGEETAIAILAEIP
FT                   GIKAFINARQLAAYAGTIPQNITSGSSVHAKPRLSKTGSRTLRKAMYFPAIAAKKHNPI
FT                   IMASCERLKEKGKHAMAIVGAAMRKLLHIVFGVLSSKKAFDPDHIKNYRAKRLTEGLVL
FT                   "
FT   gene            830654..830974
FT                   /gene="rpsP"
FT                   /locus_tag="WRi_007670"
FT   CDS_pept        830654..830974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="WRi_007670"
FT                   /product="ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007670"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95515"
FT                   /db_xref="GOA:C0R3M3"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R3M3"
FT                   /protein_id="ACN95515.1"
FT                   /translation="MAVKIRLARFGAKKRPFYRIVVADSRAPRDGRFIEKIGQYDPMLP
FT                   KDNKNRVVVKADRLKHWLSVGAQATERVLWFIKKGIVTLETEPKKTEKKKVENEKAQGQ
FT                   EA"
FT   gene            830985..831962
FT                   /gene="ispB"
FT                   /locus_tag="WRi_007680"
FT   CDS_pept        830985..831962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="WRi_007680"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007680"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95516"
FT                   /db_xref="GOA:C0R3M4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3M4"
FT                   /protein_id="ACN95516.1"
FT                   /translation="MLITNSDKLDDIVSSDLSAMNDFVFKNVNDEDAKLATDIISHLVR
FT                   SGGKKIRPKLVFIICKMLNYSGENRINVAASVEFIHNATLLHDDVLDESEARHGVKTAN
FT                   KIWGNKSSILVGDLLLTLAFRWLIECGNLNILSILSKASHLLVKGEIKQMTARFDPHTV
FT                   RENYFDIIGEKTASLFSACCEAASTVSGATNDETERLKNFGFNFGMAFQIVDDMLDYTA
FT                   NQGTSGKQVGKDFFEGKVTLPAIIAYEKGSPAEQKFWEKCFSSARHNFDQALHYINHHN
FT                   AIQLSMEKARHYINMAQNDISTFSDSFYKTTLINFLNASIERRM"
FT   gene            832024..832593
FT                   /gene="grpE"
FT                   /locus_tag="WRi_007690"
FT   CDS_pept        832024..832593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="WRi_007690"
FT                   /product="heat shock protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007690"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95517"
FT                   /db_xref="GOA:C0R3M5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R3M5"
FT                   /protein_id="ACN95517.1"
FT                   /translation="MSDSSKEKKKKFADMVSRQKGDDQQSDNHKQTDDLNEDLNTLKER
FT                   AVQLEDHLRRAVADNENVKRIMQKQISDASDYAVTKLARDMIDSCDNLKRVMEILKDGD
FT                   PVHEGIKVAYQKIINDLKKHGIEEVDPLGELFDSNLHQAVVEREDNEKKPGTIVEVLQT
FT                   GYTIKNRLLRPAMVILSKKSADCGSD"
FT   gene            832611..833609
FT                   /gene="trpS"
FT                   /locus_tag="WRi_007700"
FT   CDS_pept        832611..833609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="WRi_007700"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007700"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95518"
FT                   /db_xref="GOA:C0R3M6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3M6"
FT                   /protein_id="ACN95518.1"
FT                   /translation="MTSIVFSGIQPSGVLHLGNYLGAIKQWIDLQDKYKSLFCIVDLHA
FT                   ITANKLPASELKSNIFKTAAAYIACGIDTEKSIIFSQSTVSGHAELGWLLGCYTPIGWL
FT                   NRMTQFKDKAGSDKQKASLGLYSYPVLMAADILLYQTKYVPVGDDQKQHLELARDIASA
FT                   FNNHYKLDYFIVPEILTLDCTSRIMSLRDGTSKMSKSDPSEHSCINLDDTDDLIVKKIE
FT                   KAKTDSILGFATLKCRPEISNLINIYSVLSNVNAEKVCEEVNKHDMKHFKKELADLIIS
FT                   VISPIREKMNDLLKDQFHLHEILKKGTKKAAEIATHNIKEIKDIIGFAQYL"
FT   gene            complement(833785..834546)
FT                   /locus_tag="WRi_007710"
FT   CDS_pept        complement(833785..834546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007710"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007710"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95519"
FT                   /db_xref="GOA:C0R3M7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3M7"
FT                   /protein_id="ACN95519.1"
FT                   /translation="MDYCKLFDGNNGHIAYRKLQGKKASVVFFGGFASNMDGTKATAIY
FT                   KFCQENDVALVLFDYFGHGHSSGNFIDYTISDWQKNCAKVMSELTSDKQIIIGSSMGGW
FT                   LMLLTALQFPEKIAALIGISSAPDFTEDLIFKQLSGKQKEELDSKGVIDFTSEHCTYKI
FT                   TKNLIEDGRKNLLLNKKTIDINCPVRLLHSINDKDVPYQTSLNLAEKIKSTDVEVHLIK
FT                   SAEHNMSDNHSLEVLFKTIREFCNQTAFCDF"
FT   gene            complement(834548..835075)
FT                   /locus_tag="WRi_007720"
FT   CDS_pept        complement(834548..835075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007720"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007720"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95520"
FT                   /db_xref="GOA:C0R3M8"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3M8"
FT                   /protein_id="ACN95520.1"
FT                   /translation="MELNKIAASILLSGLIIMIVSNVVDMLYSPEEYKIEHQTIVAAGS
FT                   NEFQQKIEQVALDIGALMQNASFEKGKSAAKKCIACHSFEKGGMNKVGPNLWNIVGNKK
FT                   AHLGNSFNYSKAVLERGGKWGYEELFAFLKNPKAYIKGTRMAFAGISNPQEIADLVSYL
FT                   HQLSDSPVALPK"
FT   gene            complement(835516..835992)
FT                   /locus_tag="WRi_007730"
FT   CDS_pept        complement(835516..835992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007730"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95521"
FT                   /db_xref="GOA:C0R3M9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3M9"
FT                   /protein_id="ACN95521.1"
FT                   /translation="MLATSLMDEQKFQTGGFKELYFLRWGVETFFAKLKGRLSLENFTG
FT                   KSVESVKQDFWSAIFISNLESVMTEDVEEALNMDLTDDKLKRSINKSVSFNAIKNLAFD
FT                   IFATESDTDCIMDQLSKLFLMNTLAVRKGRKVDRHKVPYLRSFNYQKRVRKHIF"
FT   gene            complement(836000..836119)
FT                   /locus_tag="WRi_007740"
FT   CDS_pept        complement(836000..836119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007740"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95522"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3N0"
FT                   /protein_id="ACN95522.1"
FT                   /translation="MNAMFEEKSPSSVEVTICAQRKIKQENSGITLQSGTAIW"
FT   gene            complement(836190..836315)
FT                   /locus_tag="WRi_007750"
FT   CDS_pept        complement(836190..836315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007750"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95523"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3N1"
FT                   /protein_id="ACN95523.1"
FT                   /translation="MLNNVAIRSVLDRGNTHEINLADEMLKVVNTNDLLICIFIL"
FT   gene            complement(836319..836750)
FT                   /locus_tag="WRi_007760"
FT   CDS_pept        complement(836319..836750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007760"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95524"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3N2"
FT                   /protein_id="ACN95524.1"
FT                   /translation="MASLEFIESHKSSSKDFMRKRKLSFIDIFILILRKSVKSLQVILN
FT                   EFILYRKKDYTVTASAFSQARKKMKHSAFSEINEGVVSLYYQDQKFKTCFGFRVLALDA
FT                   SKIILPTSVEIKNEFGSRKIRNQKPKDLGDYASATFAVC"
FT   gene            join(837533..837758,839384..839809)
FT                   /pseudo
FT                   /locus_tag="WRi_p07770"
FT                   /note="WH2 domain protein; disrupted by IS-insertion and
FT                   frameshift"
FT   gene            837845..839227
FT                   /locus_tag="WRi_007780"
FT   CDS_pept        837845..839227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007780"
FT                   /product="transposase"
FT                   /note="ISWpi5"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007780"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95525"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C0R2M7"
FT                   /protein_id="ACN95525.1"
FT                   /translation="MVNLLELCKNLQQKIERLEAKIERLEKENESLKAENKALKIENAE
FT                   LRERLGLSSKNSSIPSSKELYKIKKNKPKSERNIGGQVGHKGSFRANMDADKVVKIELP
FT                   NTCECGGEIAICEKPYIHQKVDLPEIKPYVVEYQLEHGRCRRCGKRRSSKLPEGVTPDT
FT                   FGPRVKSIIAAFSGFYKNSKREIASVVNDIFNLNISVGSISNSEHRVASKCKKMYEQIE
FT                   QEISRSKVLHIDETSHYNKGKLAWCWMFASNTASFVKFTESRGMKVLQNSKFCNRNSLV
FT                   ITDRYAAYNYFADKNRQICWAHLSRDFERLAHSWNIEVKVLGCYLRNVATELFALKKAL
FT                   LKSEIDVLRFVRRARKLRKRTKYYLKEISRLPEAIGASRVAKNVLRSERMMWKFLDDPE
FT                   NIPLTNNHAERQIRHYVVYRKNSYFTQSKRGNTFLERIISLYLTWKQRGLNPFQNLLSI
FT                   VS"
FT   gene            839806..840342
FT                   /locus_tag="WRi_007790"
FT   CDS_pept        839806..840342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007790"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95526"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3N4"
FT                   /protein_id="ACN95526.1"
FT                   /translation="MKAKLESSGGTDKKERPEEFAARIDREQAERKKSDDNDSEWTKRL
FT                   KERAAVMRFSDSESEHSDSISDSDWTTGESKDTQKEIEQEKEEQTKHTNPPSSKEERSK
FT                   SSDSGIESRATSPIHPEQKTEESPSSCVDSPQVNNVDPVDNEVQDPPPLSVEDCIAQFG
FT                   GKALPWQKQFVARRQ"
FT   gene            840444..841712
FT                   /gene="proS"
FT                   /locus_tag="WRi_007800"
FT   CDS_pept        840444..841712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="WRi_007800"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007800"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95527"
FT                   /db_xref="GOA:C0R3N5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023716"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R3N5"
FT                   /protein_id="ACN95527.1"
FT                   /translation="MRLSKYYLPTLKEKPAHAKIISHQYSLRAGLIKQIASGIYSWLPL
FT                   GLLVLKNIEDIIRDEMDKSGAIEVLMPCVQPANLWRESGRYDDYGKEMLRIKDRHEEDM
FT                   LFGPTHEEVATDLIRDVVKSYKDLPLCLYQIQWKFRDEVRPRYGVMRGREFLMKDAYSF
FT                   DVDYEGALNSYNLMYKTYIKIFKRMGLTPIGVRADTGPIGGNLSHEFHILANTGESTLY
FT                   YDNKFSELLESEDVESLKSIYAVADDMHDPETCPISQEQLNVSKGIEIGHIFYFGDKYS
FT                   KPMKASVTSQDGKNVNIHMGSYGIGVSRLVGAIIEAFHDDKGIIWPESVAPFRIGLINL
FT                   QTKVTEAADKIYKALKSDEVLYDDTEGSVGVKFSRMDLIGLPWQIIVGKKAIDEKIVEV
FT                   KNRATGEVKEMQIEEAINHFSTK"
FT   gene            841709..842065
FT                   /gene="acpS"
FT                   /locus_tag="WRi_007810"
FT   CDS_pept        841709..842065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="WRi_007810"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007810"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95528"
FT                   /db_xref="GOA:C0R3N6"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R3N6"
FT                   /protein_id="ACN95528.1"
FT                   /translation="MIHGIGTDIVYIPRVSRILQKYGEKFLNRIYTEKEIELSRKYNSQ
FT                   EMRARYFAKRFAAKEAFVKARGSGQGIIMKDIEIYNDVRGKPYLTVSKDFISKIHLSLS
FT                   DDGDYATAFVVICV"
FT   gene            842576..844072
FT                   /locus_tag="WRi_007820"
FT   CDS_pept        842576..844072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007820"
FT                   /product="Multisubunit Na+/H+ antiporter, MnhD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007820"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95529"
FT                   /db_xref="GOA:C0R3N7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3N7"
FT                   /protein_id="ACN95529.1"
FT                   /translation="MDCVLTSLSLPFSITENYLLITALIPLLSALVIFFTGKWPRVNNS
FT                   ITVTSSVLLFTYTCLCTLYWVYGDHSQFILMDFGNNLHISLKLESTGVIFSLLISFLWI
FT                   LTSIYAICYMQNNYADSNHSSFLCFFSISISCAMFIAFSGDLLTTFVFYELLTISTYPL
FT                   VTYNSTNESMIAGRYYFGVLFFSSLVLFFPAIGLLYNEFHTLDFVSGGIFKFDTSLITF
FT                   IAVCFAMLIYGIGKAALMPMHFWLPKAMVAPTPVSALLHAVAVVKSGVFIIIKVILYTF
FT                   GVDNMQRFVQQNWFTGGWLPYVAGFTIITASLIALKQKELKKLLAYSTISQLSYIILFA
FT                   SIFSELSMRVAIFQLVCHAFAKITLFFIAGAIITRAGEKYIDKIYGIGRSMPISMTAFA
FT                   IGALSMIGVPPAPTFWGKFLIFQAVFNSGNVILSVFVTLVLIVSTILNALYFLPIIYNA
FT                   FFLKPSQNYFIKKTPILLVLPPVITAMCTLVIFFSYQVIF"
FT   gene            complement(844069..844731)
FT                   /locus_tag="WRi_007830"
FT   CDS_pept        complement(844069..844731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007830"
FT                   /product="type IV secretion system protein VirB8, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007830"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95530"
FT                   /db_xref="GOA:C0R3N8"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3N8"
FT                   /protein_id="ACN95530.1"
FT                   /translation="MEDKLLESVKNKSYFSKAVEWYCHRYLFCVAERSWMALIVSLLLV
FT                   CLCLLTLNIYLLFPVKKDLNFVKYMNHTEDEFSAMHKLSFSKKEDEYTSTARYLISKYI
FT                   EIYESIKTVEPKYQENFIRNNSIHKIYQGFQEKTNNEAGNLSLSKRKIANINVITLSID
FT                   RSTKDLVTFAGNATVVFTTEQNKEDTVEISFTLSNIKATLAGIIPFKFIVNGYKYRF"
FT   gene            complement(844790..845584)
FT                   /locus_tag="WRi_007840"
FT   CDS_pept        complement(844790..845584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007840"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95531"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3N9"
FT                   /protein_id="ACN95531.1"
FT                   /translation="MTDNKLTVWQSIEVLTKAILNMQKKLSLIKNIASDQDITLEKGKE
FT                   LLSGIYEANFKLNKTINIATLPKIGYHMLNGELVVRNHITEEEVKIPGDFHYLKVVKSD
FT                   HDNYKLTFCNFLGNEFFEYKKYDPQYSGISDEYKFVDFGSVKKTHNLKFKEYIGHAPKF
FT                   FAAEGPIEPGSQNHVIDLFELVKSGKGSKVGTFADEFGYFDDQNKLHYYNYHKSVESNT
FT                   YDPENFSVKMINIDVSKIDKFYLIAEQGDIIIHPILENLDIF"
FT   gene            complement(845658..846479)
FT                   /locus_tag="WRi_007850"
FT   CDS_pept        complement(845658..846479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007850"
FT                   /product="DNA polymerase III, delta' subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007850"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95532"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3P0"
FT                   /protein_id="ACN95532.1"
FT                   /translation="MKKVIGHNQAKKKIMNNLSVQSWLICGKKGIGKATLAKSFSNWLL
FT                   IKNYNEVALDLHIVEGDTIGIEKVREMKNFLHLSPIQSEHKIAIIDSLEAMTNNAKNAI
FT                   LKILEEPPKNSKIFIISHKPYDIQTTILCRCFQLNLLPLTYDETKQVVSSQCKFDNQTF
FT                   DEMITLFPGMPGMIINTISSDAYEAYKCFYKFLHDLKNPNMINKVINSEIELELASYII
FT                   QAFILESIKREVNGVEILLSQWKKIDELFVAAKQLHLDKKHVLANVVNIMT"
FT   gene            complement(846497..847084)
FT                   /locus_tag="WRi_007860"
FT   CDS_pept        complement(846497..847084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007860"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007860"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95533"
FT                   /db_xref="GOA:C0R3P1"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3P1"
FT                   /protein_id="ACN95533.1"
FT                   /translation="MVSKIINAIQNNLLVCFPTETVYALACNALDNESIGKIYQIKKRS
FT                   QNKPLSIFVSDIYNLTKIAKVKERYIDLINHFSPGPITYILPLKNNNILPNEFFKDSIG
FT                   IRIPEHPIAISILNKLKVPIVATSTNISGKESVCKANDIPQSIKQHLSVVIEDDELVSG
FT                   IESTIIDLTEDKIKVLREGAISLQTVNNAFSN"
FT   gene            complement(847203..847673)
FT                   /locus_tag="WRi_007870"
FT   CDS_pept        complement(847203..847673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007870"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95534"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3P2"
FT                   /protein_id="ACN95534.1"
FT                   /translation="MAENNDNNSFTKRFTNRTPGGTGEGFSSKYSSQNTKERALGEKGK
FT                   ISELAGKKTESKEAFSESGGIKSKSRTVNERSFADATKRSRSDLIYLVRGKDRGKSAWH
FT                   YVLVDKEKREMFLAKSRTGSIDVADYGEILYSGWGEDPPQAIIDKVNEEFGL"
FT   gene            847749..848633
FT                   /gene="miaA"
FT                   /locus_tag="WRi_007880"
FT   CDS_pept        847749..848633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="WRi_007880"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007880"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95535"
FT                   /db_xref="GOA:C0R3P3"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0R3P3"
FT                   /protein_id="ACN95535.1"
FT                   /translation="MKNNIVIITGITASGKSELCDNLIEKYGNISIINCDSKQVYEEIP
FT                   IITAQPPKQEVFYKLYGYVSAKENYSVGLWLEDLEKEVNHALENAQIPIITGGSGLYIS
FT                   SLIKGLSSMPQISQKVRKNVSELRKNLSKEEFYKLALSKDPRIQGKVFMNDSHRLSRAL
FT                   EVITETGKSIFVWQENRQPPLFNNFKIYTILPKREDVYRKINSRFITMIENGAIDEVKK
FT                   LLSMNLAPHLPAMKAHGVPEIIKYLKGEITLDEAIQIAQTNTRHYAKRQYTWFKKQFLN
FT                   AEVIDCANKLKIF"
FT   gene            complement(848630..849577)
FT                   /locus_tag="WRi_007890"
FT   CDS_pept        complement(848630..849577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WRi_007890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007890"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95536"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3P4"
FT                   /protein_id="ACN95536.1"
FT                   /translation="MSSPISEEKENPIVTLRAQAEKFDFSKLRADEKDISANSGKQMYE
FT                   DFDRMNFVINKKNIDTILIKALINRDKEEFDKFWEKYCEGLKVSNDKETDRYKEEVEKF
FT                   YNIGKGYTNLLTKEEDENKSYRAFAKEVFKEIFKYAEAQVPSDSILEELVINCNQAGYV
FT                   GALYAEDKPLFHVAMAYELVFGSSHTTHINCSDPSHATIRIEEKIAVCTLAKSEEELCK
FT                   LDSSLEFTLKSQGDKNVTYEDGKLSLTVPKRLKDYNIGDKNLFDVIKECFQKFCERLGF
FT                   FKIKIEHGLGDPLEVSDHLENMEPPIRSNEHGLN"
FT   gene            849882..851903
FT                   /gene="recG"
FT                   /locus_tag="WRi_007900"
FT   CDS_pept        849882..851903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="WRi_007900"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:WRi_007900"
FT                   /db_xref="EnsemblGenomes-Tr:ACN95537"
FT                   /db_xref="GOA:C0R3P5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:C0R3P5"
FT                   /protein_id="ACN95537.1"
FT                   /translation="MSNQIFLNSRLENIPKFHSTILPKLCGGDRVMDLLFYRPLSYVDR
FT                   SKSLPDAQVGEFITFIAKVYEHQSPTFRGRPYKIVVESESQYIFIVFFNYSVKYLYKLF
FT                   PIGASVIISGKLEKFAEHWQITHPDYVSLDINQFKKIACIEPVYQLCRGITNKRIGNII
FT                   SSNLKELPDLPEWIDDTLIKQKKWLSWRESIIKLHRPSSLAEAEVCRKRLAYDELFAYQ
FT                   LALKLARKNHVKERGREFIILSKYKEQVLNELSFQLTNDQTRAIDEISERQKSKYRMIS
FT                   LLQGDVGSGKTVVALFAMINVVENNMQAALMAPTTILAEQHYNWIEEVLSCTDIKVALL
FT                   TGKTSRKERKIIMNELASGVLNIVIGTHALFQANVTFKNLGLAVIDEQQRFGVMQRNRL
FT                   VGKGENADILFVTATPIPRTLQQAMYGDVECSILKEKPKSRLPIKTVTMNISRVPDVIE
FT                   KLKGAINRGEKAYWICPYIEENEETNIAAAEMRFQELQKTFLDKVGIIHGKLTQEQKDQ
FT                   VMFSFKRNEFSLLVATTVIEVGIDVPDATIMIIENAEQFGLSQLHQLRGRVGRGNKPSF
FT                   CVLLYDNLSKSSSSKLKIMCESQDGFYIAERDMMLRGSGDILGTKQSGCMEFKFADLYQ
FT                   DKELLNLAYNNAKGAMADFELLLDIFEYRSRLHFSKFQ"
FT   gene            852936..853223
FT                   /locus_tag="WRi_007910"
FT   CDS_pept