(data stored in ACNUC7421 zone)

EMBL: CP001392

ID   CP001392; SV 1; circular; genomic DNA; STD; PRO; 3796573 BP.
XX
AC   CP001392; ACCM01000000-ACCM01000017;
XX
PR   Project:PRJNA29975;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   02-JAN-2014 (Rel. 119, Last updated, Version 4)
XX
DE   Acidovorax ebreus TPSY, complete genome.
XX
KW   .
XX
OS   Acidovorax ebreus TPSY
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Acidovorax.
XX
RN   [1]
RP   1-3796573
RX   DOI; 10.1128/JB.01449-09.
RX   PUBMED; 20023012.
RA   Byrne-Bailey K.G., Weber K.A., Chair A.H., Bose S., Knox T.,
RA   Spanbauer T.L., Chertkov O., Coates J.D.;
RT   "Completed genome sequence of the anaerobic iron-oxidizing bacterium
RT   Acidovorax ebreus strain TPSY";
RL   J. Bacteriol. 192(5):1475-1476(2010).
XX
RN   [2]
RP   1-3796573
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Coates J.D.;
RT   "Complete sequence of Diaphorobacter sp. TPSY";
RL   Unpublished.
XX
RN   [3]
RP   1-3796573
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Coates J.D.;
RT   ;
RL   Submitted (22-JAN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 95a654f13fa0fa59680ee977a55c15a7.
DR   BioSample; SAMN00001444.
DR   EnsemblGenomes-Gn; Dtpsy_R0001.
DR   EnsemblGenomes-Gn; Dtpsy_R0002.
DR   EnsemblGenomes-Gn; Dtpsy_R0003.
DR   EnsemblGenomes-Gn; Dtpsy_R0004.
DR   EnsemblGenomes-Gn; Dtpsy_R0005.
DR   EnsemblGenomes-Gn; Dtpsy_R0006.
DR   EnsemblGenomes-Gn; Dtpsy_R0007.
DR   EnsemblGenomes-Gn; Dtpsy_R0008.
DR   EnsemblGenomes-Gn; Dtpsy_R0009.
DR   EnsemblGenomes-Gn; Dtpsy_R0010.
DR   EnsemblGenomes-Gn; Dtpsy_R0011.
DR   EnsemblGenomes-Gn; Dtpsy_R0012.
DR   EnsemblGenomes-Gn; Dtpsy_R0013.
DR   EnsemblGenomes-Gn; Dtpsy_R0014.
DR   EnsemblGenomes-Gn; Dtpsy_R0015.
DR   EnsemblGenomes-Gn; Dtpsy_R0016.
DR   EnsemblGenomes-Gn; Dtpsy_R0017.
DR   EnsemblGenomes-Gn; Dtpsy_R0018.
DR   EnsemblGenomes-Gn; Dtpsy_R0019.
DR   EnsemblGenomes-Gn; Dtpsy_R0020.
DR   EnsemblGenomes-Gn; Dtpsy_R0021.
DR   EnsemblGenomes-Gn; Dtpsy_R0022.
DR   EnsemblGenomes-Gn; Dtpsy_R0023.
DR   EnsemblGenomes-Gn; Dtpsy_R0024.
DR   EnsemblGenomes-Gn; Dtpsy_R0025.
DR   EnsemblGenomes-Gn; Dtpsy_R0026.
DR   EnsemblGenomes-Gn; Dtpsy_R0027.
DR   EnsemblGenomes-Gn; Dtpsy_R0028.
DR   EnsemblGenomes-Gn; Dtpsy_R0029.
DR   EnsemblGenomes-Gn; Dtpsy_R0030.
DR   EnsemblGenomes-Gn; Dtpsy_R0031.
DR   EnsemblGenomes-Gn; Dtpsy_R0032.
DR   EnsemblGenomes-Gn; Dtpsy_R0033.
DR   EnsemblGenomes-Gn; Dtpsy_R0034.
DR   EnsemblGenomes-Gn; Dtpsy_R0035.
DR   EnsemblGenomes-Gn; Dtpsy_R0036.
DR   EnsemblGenomes-Gn; Dtpsy_R0037.
DR   EnsemblGenomes-Gn; Dtpsy_R0038.
DR   EnsemblGenomes-Gn; Dtpsy_R0039.
DR   EnsemblGenomes-Gn; Dtpsy_R0040.
DR   EnsemblGenomes-Gn; Dtpsy_R0041.
DR   EnsemblGenomes-Gn; Dtpsy_R0042.
DR   EnsemblGenomes-Gn; Dtpsy_R0043.
DR   EnsemblGenomes-Gn; Dtpsy_R0044.
DR   EnsemblGenomes-Gn; Dtpsy_R0045.
DR   EnsemblGenomes-Gn; Dtpsy_R0046.
DR   EnsemblGenomes-Gn; Dtpsy_R0047.
DR   EnsemblGenomes-Gn; Dtpsy_R0048.
DR   EnsemblGenomes-Gn; Dtpsy_R0049.
DR   EnsemblGenomes-Gn; Dtpsy_R0050.
DR   EnsemblGenomes-Gn; Dtpsy_R0051.
DR   EnsemblGenomes-Gn; Dtpsy_R0052.
DR   EnsemblGenomes-Gn; Dtpsy_R0053.
DR   EnsemblGenomes-Gn; Dtpsy_R0054.
DR   EnsemblGenomes-Gn; Dtpsy_R0055.
DR   EnsemblGenomes-Gn; Dtpsy_R0056.
DR   EnsemblGenomes-Gn; Dtpsy_R0057.
DR   EnsemblGenomes-Gn; Dtpsy_R0058.
DR   EnsemblGenomes-Gn; Dtpsy_R0059.
DR   EnsemblGenomes-Gn; Dtpsy_R0060.
DR   EnsemblGenomes-Gn; Dtpsy_R0061.
DR   EnsemblGenomes-Gn; Dtpsy_R0062.
DR   EnsemblGenomes-Gn; Dtpsy_R0063.
DR   EnsemblGenomes-Gn; Dtpsy_R0064.
DR   EnsemblGenomes-Gn; Dtpsy_R0065.
DR   EnsemblGenomes-Gn; Dtpsy_R0066.
DR   EnsemblGenomes-Gn; Dtpsy_R0067.
DR   EnsemblGenomes-Gn; Dtpsy_R0068.
DR   EnsemblGenomes-Gn; Dtpsy_R0069.
DR   EnsemblGenomes-Gn; EBG00001142592.
DR   EnsemblGenomes-Gn; EBG00001142593.
DR   EnsemblGenomes-Gn; EBG00001142594.
DR   EnsemblGenomes-Gn; EBG00001142595.
DR   EnsemblGenomes-Gn; EBG00001142596.
DR   EnsemblGenomes-Gn; EBG00001142597.
DR   EnsemblGenomes-Gn; EBG00001142598.
DR   EnsemblGenomes-Gn; EBG00001142599.
DR   EnsemblGenomes-Gn; EBG00001142600.
DR   EnsemblGenomes-Gn; EBG00001142601.
DR   EnsemblGenomes-Gn; EBG00001142602.
DR   EnsemblGenomes-Gn; EBG00001142603.
DR   EnsemblGenomes-Gn; EBG00001142604.
DR   EnsemblGenomes-Gn; EBG00001142605.
DR   EnsemblGenomes-Gn; EBG00001142606.
DR   EnsemblGenomes-Gn; EBG00001142607.
DR   EnsemblGenomes-Gn; EBG00001142609.
DR   EnsemblGenomes-Gn; EBG00001142610.
DR   EnsemblGenomes-Gn; EBG00001142611.
DR   EnsemblGenomes-Gn; EBG00001142612.
DR   EnsemblGenomes-Gn; EBG00001142613.
DR   EnsemblGenomes-Gn; EBG00001142614.
DR   EnsemblGenomes-Gn; EBG00001142615.
DR   EnsemblGenomes-Gn; EBG00001142616.
DR   EnsemblGenomes-Gn; EBG00001142617.
DR   EnsemblGenomes-Gn; EBG00001142618.
DR   EnsemblGenomes-Gn; EBG00001142619.
DR   EnsemblGenomes-Gn; EBG00001142620.
DR   EnsemblGenomes-Gn; EBG00001142621.
DR   EnsemblGenomes-Gn; EBG00001142622.
DR   EnsemblGenomes-Gn; EBG00001142623.
DR   EnsemblGenomes-Gn; EBG00001142624.
DR   EnsemblGenomes-Gn; EBG00001142625.
DR   EnsemblGenomes-Gn; EBG00001142626.
DR   EnsemblGenomes-Gn; EBG00001142627.
DR   EnsemblGenomes-Gn; EBG00001142628.
DR   EnsemblGenomes-Gn; EBG00001142629.
DR   EnsemblGenomes-Gn; EBG00001142630.
DR   EnsemblGenomes-Gn; EBG00001142631.
DR   EnsemblGenomes-Gn; EBG00001142632.
DR   EnsemblGenomes-Gn; EBG00001142633.
DR   EnsemblGenomes-Gn; EBG00001142634.
DR   EnsemblGenomes-Gn; EBG00001142635.
DR   EnsemblGenomes-Gn; EBG00001142636.
DR   EnsemblGenomes-Gn; EBG00001142637.
DR   EnsemblGenomes-Gn; EBG00001142638.
DR   EnsemblGenomes-Gn; EBG00001142639.
DR   EnsemblGenomes-Gn; EBG00001142640.
DR   EnsemblGenomes-Gn; EBG00001142641.
DR   EnsemblGenomes-Gn; EBG00001142642.
DR   EnsemblGenomes-Gn; EBG00001142643.
DR   EnsemblGenomes-Gn; EBG00001142644.
DR   EnsemblGenomes-Gn; EBG00001142645.
DR   EnsemblGenomes-Gn; EBG00001142646.
DR   EnsemblGenomes-Gn; EBG00001142647.
DR   EnsemblGenomes-Gn; EBG00001142648.
DR   EnsemblGenomes-Gn; EBG00001142649.
DR   EnsemblGenomes-Gn; EBG00001142650.
DR   EnsemblGenomes-Gn; EBG00001142651.
DR   EnsemblGenomes-Gn; EBG00001142652.
DR   EnsemblGenomes-Gn; EBG00001142653.
DR   EnsemblGenomes-Gn; EBG00001142654.
DR   EnsemblGenomes-Gn; EBG00001142655.
DR   EnsemblGenomes-Gn; EBG00001142656.
DR   EnsemblGenomes-Gn; EBG00001142657.
DR   EnsemblGenomes-Gn; EBG00001142658.
DR   EnsemblGenomes-Gn; EBG00001142659.
DR   EnsemblGenomes-Gn; EBG00001142660.
DR   EnsemblGenomes-Gn; EBG00001142661.
DR   EnsemblGenomes-Gn; EBG00001142662.
DR   EnsemblGenomes-Gn; EBG00001142663.
DR   EnsemblGenomes-Tr; Dtpsy_R0001-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0002-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0003-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0004-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0005-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0006-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0007-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0008-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0009-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0010-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0011-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0012-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0013-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0014-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0015-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0016-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0017-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0018-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0019-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0020-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0021-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0022-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0023-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0024-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0025-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0026-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0027-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0028-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0029-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0030-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0031-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0032-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0033-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0034-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0035-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0036-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0037-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0038-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0039-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0040-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0041-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0042-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0043-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0044-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0045-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0046-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0047-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0048-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0049-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0050-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0051-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0052-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0053-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0054-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0055-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0056-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0057-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0058-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0059-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0060-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0061-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0062-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0063-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0064-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0065-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0066-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0067-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0068-1.
DR   EnsemblGenomes-Tr; Dtpsy_R0069-1.
DR   EnsemblGenomes-Tr; EBT00001558958.
DR   EnsemblGenomes-Tr; EBT00001558959.
DR   EnsemblGenomes-Tr; EBT00001558960.
DR   EnsemblGenomes-Tr; EBT00001558961.
DR   EnsemblGenomes-Tr; EBT00001558962.
DR   EnsemblGenomes-Tr; EBT00001558963.
DR   EnsemblGenomes-Tr; EBT00001558964.
DR   EnsemblGenomes-Tr; EBT00001558965.
DR   EnsemblGenomes-Tr; EBT00001558966.
DR   EnsemblGenomes-Tr; EBT00001558967.
DR   EnsemblGenomes-Tr; EBT00001558968.
DR   EnsemblGenomes-Tr; EBT00001558969.
DR   EnsemblGenomes-Tr; EBT00001558970.
DR   EnsemblGenomes-Tr; EBT00001558971.
DR   EnsemblGenomes-Tr; EBT00001558972.
DR   EnsemblGenomes-Tr; EBT00001558973.
DR   EnsemblGenomes-Tr; EBT00001558974.
DR   EnsemblGenomes-Tr; EBT00001558975.
DR   EnsemblGenomes-Tr; EBT00001558976.
DR   EnsemblGenomes-Tr; EBT00001558977.
DR   EnsemblGenomes-Tr; EBT00001558978.
DR   EnsemblGenomes-Tr; EBT00001558979.
DR   EnsemblGenomes-Tr; EBT00001558980.
DR   EnsemblGenomes-Tr; EBT00001558981.
DR   EnsemblGenomes-Tr; EBT00001558982.
DR   EnsemblGenomes-Tr; EBT00001558983.
DR   EnsemblGenomes-Tr; EBT00001558984.
DR   EnsemblGenomes-Tr; EBT00001558985.
DR   EnsemblGenomes-Tr; EBT00001558986.
DR   EnsemblGenomes-Tr; EBT00001558987.
DR   EnsemblGenomes-Tr; EBT00001558988.
DR   EnsemblGenomes-Tr; EBT00001558989.
DR   EnsemblGenomes-Tr; EBT00001558990.
DR   EnsemblGenomes-Tr; EBT00001558991.
DR   EnsemblGenomes-Tr; EBT00001558992.
DR   EnsemblGenomes-Tr; EBT00001558993.
DR   EnsemblGenomes-Tr; EBT00001558994.
DR   EnsemblGenomes-Tr; EBT00001558995.
DR   EnsemblGenomes-Tr; EBT00001558996.
DR   EnsemblGenomes-Tr; EBT00001558997.
DR   EnsemblGenomes-Tr; EBT00001558998.
DR   EnsemblGenomes-Tr; EBT00001558999.
DR   EnsemblGenomes-Tr; EBT00001559000.
DR   EnsemblGenomes-Tr; EBT00001559001.
DR   EnsemblGenomes-Tr; EBT00001559002.
DR   EnsemblGenomes-Tr; EBT00001559003.
DR   EnsemblGenomes-Tr; EBT00001559004.
DR   EnsemblGenomes-Tr; EBT00001559005.
DR   EnsemblGenomes-Tr; EBT00001559006.
DR   EnsemblGenomes-Tr; EBT00001559007.
DR   EnsemblGenomes-Tr; EBT00001559008.
DR   EnsemblGenomes-Tr; EBT00001559009.
DR   EnsemblGenomes-Tr; EBT00001559010.
DR   EnsemblGenomes-Tr; EBT00001559011.
DR   EnsemblGenomes-Tr; EBT00001559012.
DR   EnsemblGenomes-Tr; EBT00001559013.
DR   EnsemblGenomes-Tr; EBT00001559014.
DR   EnsemblGenomes-Tr; EBT00001559015.
DR   EnsemblGenomes-Tr; EBT00001559016.
DR   EnsemblGenomes-Tr; EBT00001559017.
DR   EnsemblGenomes-Tr; EBT00001559018.
DR   EnsemblGenomes-Tr; EBT00001559019.
DR   EnsemblGenomes-Tr; EBT00001559020.
DR   EnsemblGenomes-Tr; EBT00001559021.
DR   EnsemblGenomes-Tr; EBT00001559022.
DR   EnsemblGenomes-Tr; EBT00001559023.
DR   EnsemblGenomes-Tr; EBT00001559024.
DR   EnsemblGenomes-Tr; EBT00001559025.
DR   EnsemblGenomes-Tr; EBT00001559026.
DR   EnsemblGenomes-Tr; EBT00001559027.
DR   EnsemblGenomes-Tr; EBT00001559028.
DR   EuropePMC; PMC2789088; 19941653.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02227; sX8.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001392.
DR   SILVA-SSU; CP001392.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084098
CC   Source DNA and bacteria available from John D. Coates
CC   (jcoates@nature.berkeley.edu)
CC   Contacts: John D. Coates (jcoates@nature.berkeley.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Meta information:
CC    Organism display name:  Diaphorobacter sp TPSY
CC    GOLD ID:  Gi02057 http://genomesonline.org/GOLD_CARDS/Gi02057.html
CC    Sequencing Status:  Complete
CC    Phenotypes:  Iron oxidizer, Uranium oxidizer
CC    Diseases:  None
CC    Habitat:  Fresh water
CC    Oxygen Requirement:  Facultative
CC    Cell Shape:  Rod-shaped
CC    Motility:  Motile
CC    Temperature Range:  Mesophile
CC    Biotic Relationship:  Free living.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3796573
FT                   /organism="Acidovorax ebreus TPSY"
FT                   /strain="TPSY"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:535289"
FT   gene            70..1491
FT                   /locus_tag="Dtpsy_0001"
FT   CDS_pept        70..1491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: ajs:Ajs_4144 chromosomal replication initiator
FT                   protein DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator DnaA
FT                   domain; Chromosomal replication initiator DnaA; SMART: AAA
FT                   ATPase; Chromosomal replication initiator DnaA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31490"
FT                   /db_xref="GOA:B9M9R9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9R9"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACM31490.1"
FT                   /translation="MNEGLHSSSHDSDGASAGQGLWQACAEQLAQDLPEQQFNTWIKPL
FT                   VAQVAPDFSKVTLLVANRFKLDWIRAQYAGRISALLEGLYGQPVTLELALAQRESVVRT
FT                   YVRPTAPETPATGDAPSAHPTADEAPAGAFRTRLNPALTFETLVEGTANRMARSAAMHV
FT                   AGSPGHLYNPLFIYGGVGLGKTHLVHAVGNKLLQDRPDAKVLYIHAEQFVSDVVKSYQR
FT                   RTFDDFKERYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGL
FT                   ANIHERLVSRFDSGLTVAIEPPELEMRVAILINKARAEGSEMPEEVAFFVAKNVRSNVR
FT                   ELEGALRKILAYSRFNQKEVSIQLAREALRDLLSIQNRQISVENIQKTVADYYKIKVAD
FT                   MYSKKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIGAERQQLT
FT                   ELNQQLHVLEQTLKG"
FT   gene            1636..2742
FT                   /locus_tag="Dtpsy_0002"
FT   CDS_pept        1636..2742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ajs:Ajs_4145 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31491"
FT                   /db_xref="GOA:B9M9S0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9S0"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACM31491.1"
FT                   /translation="MIVLKATQDKVLAVLQSVAGIVERRHTLPILANVLLRKTGNAIQL
FT                   TTSDLEIQIRTTAELGGDTGDFTTTVGARKLIDILKTMPADQTVSLESNQSKLILKGGK
FT                   SRFTLQTLPAEDFPLVQEAASFGPAFSVPQKVLKSLLGQVSFAMAVQDIRYYLNGILFV
FT                   AEGTTLSLVATDGHRLAFASAQLDVEVPKQEVILPRKTVLELQRLLSDADGAIEMQFAN
FT                   NQAKFSFGGMEFVTKLVEGKFPDYNRVIPKNHHNSVTLGRAPLLASLQRTAIMTSDKFK
FT                   GVRLNIEPGLLRVASNNAEQEEAVDELDIDYGGDAIEIGFNVSYLIDALANMGQDMVKV
FT                   DLADGNSSALMTIPDNEHFKYVVMPMRI"
FT   gene            2860..5466
FT                   /locus_tag="Dtpsy_0003"
FT   CDS_pept        2860..5466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: ajs:Ajs_4146 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31492"
FT                   /db_xref="GOA:B9M9S1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9S1"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACM31492.1"
FT                   /translation="MTAEQSQPAPEQPISAPAEQPVASVAGSDGYGEGAIQILEGLEAV
FT                   RKRPGMYIGDTSDGTGLHHLVFEVVDNSIDEALAGHCDDIVVTIHTDNSISVVDNGRGI
FT                   PTGVKMDDKHEPKRSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSKKLRLT
FT                   VRRDGQTHQLEFSKGVVQNRLIEIVDGFEVSPMKVIGPSEKRGTEVRFLPDTEIFKENS
FT                   DFHYEILAKRLRELSFLNNGVRIRLIDERTGKEDDFSGAGGVKGFVEFINGTKKVLHPT
FT                   AFHATGARPAETYGGIPGTEIGVEVAMQWNDGYNEQVLCFTNNIPQRDGGTHLTGLRAA
FT                   MTRVIGKYIEQNELAKKAKVEVSGDDMREGLCCVLSVKVPEPKFSSQTKDKLVSSEVRA
FT                   PVEDIVAKALTDYLEEKPNDAKILCGKIVEAARAREAARKAREMTRRKGVLDGMGLPGK
FT                   LADCQEKDPALCEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARYEKLLSSN
FT                   EIVTLITALGTGIGKAAVESGKSGADDFDVAKLRYHRIIIMTDADVDGAHIRTLLLTFF
FT                   YRQMPELVERGHIYIAQPPLYKVKNGKEELYLKDAAALDTFLLRVALNHASITTSGDQP
FT                   RTLAGDDLAQLARTHQHAEQVIARLSAFMDAEALRAVADGVVFNLDTLQDAEASAVQLQ
FT                   AKLRELNTNGVPADVAGEIDPRTDKPILRISRHHHGNIKSSLITQDFVAGDDYAALAQA
FT                   AESFRGLIQEGAKVTRGEGEKAKEEKVGDFRQAMAWLISEAERTTSRQRYKGLGEMNPE
FT                   QLWETTMDPEVRRLLRVQIDDAIEADRVFTMLMGDEVEPRRDFIETNALRAGNIDV"
FT   gene            complement(5621..5854)
FT                   /locus_tag="Dtpsy_0004"
FT   CDS_pept        complement(5621..5854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_4147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31493"
FT                   /db_xref="GOA:B9M9S2"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9S2"
FT                   /inference="similar to AA sequence:KEGG:Ajs_4147"
FT                   /protein_id="ACM31493.1"
FT                   /translation="MIDWVPVVFITFKVLVFGTCMFFAIKWHYDQGNKGTDKRALLRTS
FT                   GKVVAVFMAALLAVLLFTFGLSKMLGMDLRLP"
FT   gene            6024..6545
FT                   /locus_tag="Dtpsy_0005"
FT   CDS_pept        6024..6545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0005"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ajs:Ajs_4148 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31494"
FT                   /db_xref="GOA:B9M9S3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9S3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACM31494.1"
FT                   /translation="MTVLTIRPATIDDTDLILHFVRELAIYEKAEHEALATPAHVHRTL
FT                   FCANPKVHGLICEAGGTAVGFAVYFFNYSTWQGRHGLYLEDLYVSPEHRGKGAGMALLR
FT                   QLARIAVDHDCGRFEWSVLDWNTPSIALYDSLGARPQSEWIRYRLTGDELHALAAQARP
FT                   LAPQPCTPAP"
FT   gene            6542..6955
FT                   /locus_tag="Dtpsy_0006"
FT   CDS_pept        6542..6955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0006"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   ajs:Ajs_4149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31495"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9S4"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ACM31495.1"
FT                   /translation="MRSPIAIVDVDRVDTWTRYRAGLCESCAANCCTMPLEVQLSDLVR
FT                   LGLVDAFEAEHEEPRHIAKRLQKARLIDHFNHKNTLFTLARRANGDCQFLDAATRLCTV
FT                   YEQRPETCRLHPQKKSPKPGYCAYGARERQRRG"
FT   gene            7062..7499
FT                   /locus_tag="Dtpsy_0007"
FT   CDS_pept        7062..7499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0007"
FT                   /product="OsmC family protein"
FT                   /note="TIGRFAM: OsmC family protein; PFAM: OsmC family
FT                   protein; KEGG: ajs:Ajs_4150 OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31496"
FT                   /db_xref="GOA:B9M9S5"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9S5"
FT                   /inference="protein motif:TFAM:TIGR03562"
FT                   /protein_id="ACM31496.1"
FT                   /translation="MSEKKASVHWEGGGKAGQGQISTETEALQKYPYGFASRFGDDRKG
FT                   TNPEEILGAAHAACFTMAFSFAADKAGFATERVDTTASVRLTQQGEGFLIDRIALTLKA
FT                   KVPGMDEATFQKLAADAKANCPLSKALAAVPEITLSATLVQ"
FT   gene            7511..8275
FT                   /locus_tag="Dtpsy_0008"
FT   CDS_pept        7511..8275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0008"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   ajs:Ajs_4151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31497"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9S6"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ACM31497.1"
FT                   /translation="MDTATGRPHIRVGISGWTFAPWRGSFYPPGLAQAKELHYASRQLT
FT                   AIEVNGTFYSTFRPATFAKWHDETPDGFMFSLKAHRLVTHRRVLATAGDAIARFVGSGI
FT                   AQLQGKLGPIVWQFMPSKRFEEADFEAFLALLPREVDGRRLRHALDVRHESFATPAFIA
FT                   LARRYGCVPVCTDSEKFPAMADPEADFAYLRLMRSQAGIPTGYTPEAIAQWAAGVRAWA
FT                   GGERPRDVFVYFINGAKERAPAGALELLRQLA"
FT   gene            complement(8362..8655)
FT                   /locus_tag="Dtpsy_0009"
FT   CDS_pept        complement(8362..8655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0009"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: ajs:Ajs_4152
FT                   acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31498"
FT                   /db_xref="GOA:B9M9S7"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9S7"
FT                   /inference="protein motif:PFAM:PF00708"
FT                   /protein_id="ACM31498.1"
FT                   /translation="MAESAASITRHLRIHGLVQGVYYRKSMTEAARRLGVQGWVRNRQD
FT                   GTVEALASGAAPAVQALIDWAHEGPPAARVERVEVAQAPACDAQGFEQRETV"
FT   gene            8696..8929
FT                   /locus_tag="Dtpsy_0010"
FT   CDS_pept        8696..8929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0010"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ajs:Ajs_4153 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31499"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9S8"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACM31499.1"
FT                   /translation="MTAPRKALPAIDPQRCTGCGWCVGVCPPHVLSLQMQGPERFGPKR
FT                   SVLHDAPGCTGCALCALRCPFDAIRMVRNSTQ"
FT   gene            8991..10586
FT                   /locus_tag="Dtpsy_0011"
FT   CDS_pept        8991..10586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0011"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   ajs:Ajs_4154 gamma-glutamyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31500"
FT                   /db_xref="GOA:B9M9S9"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9S9"
FT                   /inference="protein motif:PRIAM:2.3.2.2"
FT                   /protein_id="ACM31500.1"
FT                   /translation="MTWQLPYPSGRQPVLARNVVSTSQPLAAQAGAAAFARGGNAIDAA
FT                   LAAAITLTVVEPVMNGIGGDAFALVWDGAALHGLNASGRAPRAWSAERFAHLPQMPRIG
FT                   WDTVTTPGGVAGWVALSERFGALPFEDLFADAIRHARDGFPVSPVIARQWAQAAIDLKG
FT                   QPGFEAFTPGGRAPQAGEIWRFADQADTLADIARTRGASFYRGRLAQAMADYARQHGAG
FT                   LALEDLAAHAVEWVQSISVPFGDRTVHEIPPNGQGIAALMALGLLEHLPYRSTAAGSAA
FT                   RMHLEIEAMRVAFADLYAHVADPDHMRLTSAQLLDPAYLRQRAALIDPQRAGQYPAGQP
FT                   GSGGTVYLCTADSEGRMVSFIQSNFKGFGSGVVVPGTGIALHNRGMGFVTTPGHPNQVA
FT                   GGKRPMHSIIPAFVTRGGQPHMAFGVMGGNMQAQGHVQMVLREAVEGLNPQACSDAPRW
FT                   RINDAGALTLEHTVPAAVVEGLRALGHDPQVAAPGSLEFGSAQIIRRLEATPGTGFAYA
FT                   AGSDHRRDGQAVGC"
FT   gene            10940..12358
FT                   /locus_tag="Dtpsy_0012"
FT   CDS_pept        10940..12358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0012"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase; homoserine dehydrogenase NAD-binding; KEGG:
FT                   ajs:Ajs_4155 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31501"
FT                   /db_xref="GOA:B9M9T0"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9T0"
FT                   /inference="protein motif:PRIAM:1.1.1.3"
FT                   /protein_id="ACM31501.1"
FT                   /translation="MFVEPQFSPSPEVHASARRAPAPPPALRVGMIGTGTVGSGVWRVL
FT                   RRNRDLINARAGRAIEIVAVAARNTARAATALDGAPGVRLLTDPLQLAADPGVDVVLEL
FT                   AGGTGAARDWVQAALAHGKHVVTANKALLATHGEALAQTAARHGRVLAYEAAVAGSVPV
FT                   IKALREGLAANRITALAGVLNGTSNYILTRMQAAGLGFAAALTEAQALGYAEADPAFDV
FT                   DGTDAAHKLALLAANAFGMPVRLDAVHVEGIRDLQRGDVAAAAHLGYAVKLLAVAEQQE
FT                   CEGRMAIQLRVHPALVPARHPLALLDGATNGLLVRGDAAGSAFFSGAGAGGEPTASAVL
FT                   ADLIDLARLPAVSSPTPTGPGVPTLGTHRRAGDDPAVLPMAPVKTPHLLRLLPGAALCE
FT                   TAVLRALAREGVRVRRRTWAAPVTPGGAPELLLLTAPTPDALAAEATAHLQAYTGAQVR
FT                   RLRVELCSALTDEQ"
FT   gene            complement(12411..12719)
FT                   /locus_tag="Dtpsy_0013"
FT   CDS_pept        complement(12411..12719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_4156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31502"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9T1"
FT                   /inference="similar to AA sequence:KEGG:Ajs_4156"
FT                   /protein_id="ACM31502.1"
FT                   /translation="MPSHRDTPSPSNAPGAAPPSPGEHTDVHEQGVDLQTPPQQERAAA
FT                   TPAAPKLPHERDQSVTMTGGERHPEVEQAHRDVERGLQDTDRGPPADRTYRKLKDSE"
FT   gene            12968..15157
FT                   /locus_tag="Dtpsy_0014"
FT   CDS_pept        12968..15157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0014"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; DEAD-like helicases; KEGG:
FT                   ajs:Ajs_4158 ATP-dependent DNA helicase DinG"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31503"
FT                   /db_xref="GOA:B9M9T2"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039000"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9T2"
FT                   /inference="protein motif:SMART:SM00491"
FT                   /protein_id="ACM31503.1"
FT                   /translation="MSSTEWAAQALQSFEAVVQSTAGFRVREGQRRMAEQVAQTFSQAQ
FT                   LGKLEDDDALPQRAIAVVQAGTGVGKSLAYSVPAIAMALARGTRVLISTATVALQEQLV
FT                   HKDLPALAARMELPFQFALAKGRGRYVCKLKLERLAGGGAAGPGGDGDLPDDDLFADEE
FT                   AEQRGKRPRHESEARMKFYASMADALATSEWDGDRDTLATPPEPEAWSPVAAEASSCTG
FT                   KHCPVFNQCTYYERRKQLVAAQVIVANHDLLLSSLGARLLPELDNCLLVIDEAHHLPAT
FT                   ALDQFACEADLSRLTWIDRLASRALRIGQLVEVEEIADIPNHAARLRAALQDAARLVMD
FT                   VYGEQLRAPVPGRRQFASSLPTRARVAGGVLPEALVEPFSQAAHHAEGFLNALRAISKA
FT                   LRSEMRDKPDEARRLSQLYAQIGVLAPRLEAVHAAAQLLLQDAPEGAVPAAKWFTLEVE
FT                   GDFIVVRAHASPVLPGNTLRNHLWSAVRGAVLTSATLTSCGQFDFFLRESGLFGDEAVT
FT                   TLAVPSPFDYALQGTLVATETRAEPRDAQAFTAEMVDALLSDLALVEAGALVLFTSREQ
FT                   MRQAVDMLPTAMRSAVLVQNTLPRPQLLARHRERVAEGLPSIIFGMQSFGEGLDLPGRL
FT                   CESLFITKLPFAPPDDPVGEARAEWLRGAGRDPFSELVVPATAIRLAQWVGRAIRTEED
FT                   RAHVYCYDKRLVRTGYGQRLLQGLPPFTLARRAAG"
FT   gene            15342..15539
FT                   /locus_tag="Dtpsy_0015"
FT   CDS_pept        15342..15539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_4159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31504"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9T3"
FT                   /inference="similar to AA sequence:KEGG:Ajs_4159"
FT                   /protein_id="ACM31504.1"
FT                   /translation="MKRTNDNSGATDKVANDHNQQGHQPPTALNQARRTPDSRSDRTDQ
FT                   VGSGNQAQSRRGSKNQGGAG"
FT   gene            15687..16343
FT                   /locus_tag="Dtpsy_0016"
FT   CDS_pept        15687..16343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0016"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ajs:Ajs_4160 DNA polymerase III, epsilon
FT                   subunit; PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31505"
FT                   /db_xref="GOA:B9M9T4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9T4"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ACM31505.1"
FT                   /translation="MPSAPIAVIDFETTGMMPAQGARATEVAIVLMEGGRVVDRYQSLM
FT                   RTGVRIPPFITQLTGITNAMVEAAPDAAAVMREAARFVGDAPMVAHNAAFDRKFWQAEM
FT                   QHAGLAAPHPFACTVLLSRRVYPDAPSHSLGRLTDHLGLPRAGRAHRALADAEMAAALL
FT                   ACMQRDLCQRFGLAWPDHALLMQLQRCARPAIGKLLQRHRQAAPAEQPPTALQMG"
FT   gene            16551..17057
FT                   /locus_tag="Dtpsy_0017"
FT   CDS_pept        16551..17057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0017"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: ajs:Ajs_4161 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31506"
FT                   /db_xref="GOA:B9M9T5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9T5"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACM31506.1"
FT                   /translation="MSMPDDSPHATLWNRIKDIRFAMLAHRAADGRLHAHPLTTLNKDI
FT                   DAQSQLFFFIPRGSELHSRLQADSQVHLSYADPGEDCYVSLSGTAGFIEDPARKEALWT
FT                   PLAKAWFPDGPTDPNLVLLAVRIEHAEYWDVKDSKLSQLYQLATAALTGEQPKPLGEHR
FT                   ELSLD"
FT   gene            complement(17352..18680)
FT                   /locus_tag="Dtpsy_0018"
FT   CDS_pept        complement(17352..18680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0018"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   ajs:Ajs_4162 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31507"
FT                   /db_xref="GOA:B9M9T6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9T6"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACM31507.1"
FT                   /translation="MPSLSVEGSNAKDIAASLEYAMRRGALPSGAALPSVRHLAAELGV
FT                   NPNTVAAAYARLRSAGRVVTAGRRGTRVEGEPPRPAPSFAPPEGLRDLACGQPDPALLP
FT                   RPRGAAWAAALGQPAAVPHAPQAVAEALLSQARPWLESQGLPGDAVGVFSGALDAIERA
FT                   LRQHARPGDRVAVEDPGWPPLLALLHSLRLQPVPLAVDAQGLCVPAAGVLAQCCAVVVT
FT                   PRAHNPTGVALGAARWKALRRRLRAHPHTLLILDDHWGLLSHAPLAMAGALPPLWLHVL
FT                   SVSKALGADCRVALAAGTPALVQGMCAHQALGPRWVSHWLQGLVAQLWRQAAQGRARGS
FT                   WRHAAAQYAARRAALADALRGHGVAAPWLEGEGLHAWVPVPDEAAAVQALAAAGWAVQA
FT                   GAPLRLHSGPGVRISLGAVGVRDMGRLARDLAGALRPAVRAVF"
FT   gene            18899..19381
FT                   /locus_tag="Dtpsy_0019"
FT   CDS_pept        18899..19381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0019"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: ajs:Ajs_0001 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31508"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9T7"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACM31508.1"
FT                   /translation="MRAFALPVLTLAASLLVVGCGTTPPTSASRNAAYSRLSPEQSSDI
FT                   AIHALGLVGTPYRYGGNTPDSGFDCSGLIGYVYTSRAGVAPPRTVAQLSGFGQSIDADE
FT                   LRTGDLVVFGRGRPTHAGIYVGEGRFVHAPSSGGTVRLDHLKSRYWSQQFASFRRP"
FT   sig_peptide     18899..18985
FT                   /locus_tag="Dtpsy_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.407 at
FT                   residue 29"
FT   gene            19509..20609
FT                   /locus_tag="Dtpsy_0020"
FT   CDS_pept        19509..20609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0020"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: ajs:Ajs_0002
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31509"
FT                   /db_xref="GOA:B9M9T8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9T8"
FT                   /inference="protein motif:TFAM:TIGR00034"
FT                   /protein_id="ACM31509.1"
FT                   /translation="MTLTERLASPLTTHDTTRIDDLRIKAVRPLITPALLQEWQPAPEA
FT                   AQTLVESSRVAISRVLHGQDDRLIVVVGPCSIHDHDQAMEYARLLKEQADALAQDLLIV
FT                   MRVYFEKPRTTVGWKGYINDPHLDGSFAINEGLERARALLLDVLALGLPVGTEFLDLLS
FT                   PQFISDLVSWGAIGARTTESQSHRQLASGLSCPVGFKNGTDGGVKVAADAIQAAQAPHA
FT                   FMGMTKMGQAAIFETRGNHDCHVILRGGKAPNYGAADVQAACEMLGKAGQRPQVMIDLS
FT                   HANSSKQHRRQIDVAQDVAQQIAAGDARITGVMIESHLQEGRQDIVDGQPLTPGVSVTD
FT                   ACISFAQTVPVLHQLAAAVRERRTRG"
FT   gene            20851..24528
FT                   /locus_tag="Dtpsy_0021"
FT   CDS_pept        20851..24528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0021"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: aav:Aave_0022 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   GGDEF domain containing protein; EAL domain protein; GAF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31510"
FT                   /db_xref="GOA:B9M9T9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9T9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACM31510.1"
FT                   /translation="MPISDSTGTPSAHPAEAGGPAAAVQAHDEAAAHALLLQLQQLITD
FT                   LQLPLEHVLAQAAQAACAITGAVGAMIALRENDALAVRASVGAPPLPAIGTRVPLDACA
FT                   SWQGMEQAARAGLQAATGAPAQDVGSAQPPHRRVSMPLGSGALLAGLLQVRVPQGAALD
FT                   AQHLLHLRILAESLGAMLQLRRVDAQLRASEQQYRTLFAEHPQPMWVCDRDSLRLLAVN
FT                   HAMVRHYGHAEQELLGMELRALWSAENQDAATCALDMLRREAHAPGSPASAPRLWRHAR
FT                   KDGAALDVEVVVGDTDFGGRPAWQMLASDVTERCRIEDELARVNRAKRMRGACSETLVR
FT                   ATSESDLLHGVAVEIGGYRMGWVGMARDDAHRRIEPVAHAGVAQAHDYTEHLHLSWSVQ
FT                   EPGGNGPAGVCVRSGRTVIVHDVHHSPAFSHLADRMAQLGFHAVVCLPLRNAERTFGLL
FT                   YLYAPEVLHLGVQETQLLEAMAADLAFGIENLRARAEQQRLQATLVKVATAVSAGVGAA
FT                   FFDHLAQHMAEALGAQVACVGRFLPAAPGQARRAVALSHVVDGVTQPNAEYVLEGTPSE
FT                   RLLTQRSLVIRDRARERFPRAPVLARTGARSYVGQQLTASDGTPIGMIFVVFRQALERS
FT                   RFVSNTLQIFAARAAAELQRQTDDQRIRQQASLLDKARDAIIVRDLEHRITFWNEGAER
FT                   MYGWSREEVLGRSIATLLYQNPEDFLRATQHVMQHGVWSGEILQCDRAGRTLEAEGRWT
FT                   LVRNDRGEPESVLAINADIGTRKHQEREIQRLAFFDPLTHLPNRVQLLDRVDQALAKAQ
FT                   RLEQGGALLFIDLDNFKTLNDTLGHDQGDELLQIVAQRLNTCVRSADTVARLGGDEFVV
FT                   LVEQLSAHSDTLAEQAGAVGEKILAVLSAPYALTGYQYRSTPSIGIALFNHAPTTVGEL
FT                   LKQADLAMYQAKTAGRNTLRFFNPSMQHAVAERASLEADLRNALAQKEFLLHYQPQINA
FT                   RGAIVGVEALLRWAHPRRGMVSPGRFIPLAEETGLVLPLGHWVLHTACSVLADWQRVPA
FT                   LAPLTMAVNVSSRQFRDAGFVDDVAGVLAATGAPAAQLKLELTESLLVEDLAATIATMA
FT                   ALRALGVGFSLDDFGTGYSSLAYLKRMPLGQLKIDQSFVRDLLTDPNDAAIVRTIIGLA
FT                   ASLGLEVIAEGVETSAQRDWLAHAGCAVYQGYFFSRPLPLDLLEQLLHDHIAAARTPPL
FT                   "
FT   gene            complement(24586..25389)
FT                   /locus_tag="Dtpsy_0022"
FT   CDS_pept        complement(24586..25389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0022"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   ajs:Ajs_0004 regulatory proteins, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31511"
FT                   /db_xref="GOA:B9M9U0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9U0"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACM31511.1"
FT                   /translation="MARTRNIDFDEGADSRRFVTALARGLDVLACFQVDEKWLTNAEIA
FT                   ARTGLPKPTVVRLAYTLCVLGYLRHSRDSGKYALGDSLAALGITMVSNLRLRRIARPYM
FT                   QDFADRYDISVSLGIRNGLSVLYVENCRSGTPLSLGLDLGARLPVAETAMGHALLAVME
FT                   PRERERLLAEIRQAEGERWPQLRQAIETGCAHWRARGFTVVVRDWQTDIAGVGAAIRQP
FT                   DGRVISFNAGGSASKFPRALLEQEIGPQFARMVKGLEPFVRSEEA"
FT   gene            25632..26603
FT                   /locus_tag="Dtpsy_0023"
FT   CDS_pept        25632..26603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31512"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9U1"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31512.1"
FT                   /translation="MTHALLNRRTLSLLLAAGCVAGPALAQPERFPSRPIKVLIGFTAG
FT                   GSTDVPFRVLAENASKILGQPVIIENKPGAGGVLPAQMMQSTPADGYTLAQVPLPVFRL
FT                   PYTQKINWNPATDLQYVIGLAGYAFGLVVPADSPIKSMQDYIAYAKDNPGKLNYGTPGA
FT                   LTTLHLTMENIALQAGVTLNHIPYKGNSESLQAVLGGHVMSIADTPGWAPYVEQGKLRV
FT                   LSVWGDKRSARFPNVPTLKEVGINLVQTSPFGLVVPKGTDPKIAQVLHDAFKKAMEMPN
FT                   YKESLAKFDMDTYYMDSATYKQYALDTMKTEKVIIEKLGLAK"
FT   sig_peptide     25632..25712
FT                   /locus_tag="Dtpsy_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(26942..27547)
FT                   /locus_tag="Dtpsy_0024"
FT   CDS_pept        complement(26942..27547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31513"
FT                   /db_xref="GOA:B9M9U2"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9U2"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0006"
FT                   /protein_id="ACM31513.1"
FT                   /translation="MPTIARRSAFFRRTALLSPAPFLAAAAACLTAPPALAQPSEDRAY
FT                   APSVYVQGEWARRQTDAITIGATLPWGTWRRPLWGGELRGHWDVSLSRWSFDGIGGHNS
FT                   AVVVGVAPTLRLRPDEGRSLWFWEAGIGATVASHRYRVQDHEFSTRFNFASHLGLGRNF
FT                   GAQRQHELMLSVQHVSNAGIKSPNPGENFLQLRYALHF"
FT   sig_peptide     complement(27434..27547)
FT                   /locus_tag="Dtpsy_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 38"
FT   gene            complement(27674..28303)
FT                   /locus_tag="Dtpsy_0025"
FT   CDS_pept        complement(27674..28303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0025"
FT                   /product="protein of unknown function DUF1520"
FT                   /note="PFAM: protein of unknown function DUF1520; KEGG:
FT                   ajs:Ajs_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31514"
FT                   /db_xref="GOA:B9M9U3"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9U3"
FT                   /inference="protein motif:PFAM:PF07480"
FT                   /protein_id="ACM31514.1"
FT                   /translation="MARFKITQRLAATAVAAAVLAGMAVPTLAQPGPGPAATEQGASQA
FT                   QQRPRQRALTPEQREQYLAQRAEAFKRKLQLTPEQEPAWNSFLQSMKPDADARKARLDW
FT                   QGMDQLTTPERIDRMRALRSQRAAEMDRRGDAVKAFYGTLTPAQQKTFDAEGKRMYRHW
FT                   GGDHPMGKRWGKDGARGDFRGDGRGMRHQGPGPGAGAAPGAPLTPQ"
FT   sig_peptide     complement(28214..28303)
FT                   /locus_tag="Dtpsy_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            28616..29593
FT                   /locus_tag="Dtpsy_0026"
FT   CDS_pept        28616..29593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0026"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG: ajs:Ajs_0008
FT                   recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31515"
FT                   /db_xref="GOA:B9M9U4"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9U4"
FT                   /inference="protein motif:PFAM:PF04381"
FT                   /protein_id="ACM31515.1"
FT                   /translation="MFKNMIVYRIAPEWQVELTQLEEALAKAPFQECGATQEKSSGWVP
FT                   PRGEAHGLLAESVGGHWMLRFQWEAKMLPATVLARKVKEKAAQIEQQTGRKPGKKETKE
FT                   LKEEAKLDLLPMAFTKQGGTWVWIDPQAHLLVLDTGAQGRADEVVSLLVEHLPGLSLAL
FT                   LDTQTSPQAAMALWLKEQEPPAGFSIDRECELKAPDETKAVVRYARHPLDIEEVQGHIE
FT                   AGKLPTKLAMSWDDRVSFVLTEGLQLKKVAFLDTVFEGQAQDEGGFDADVAIATGELSQ
FT                   LIPDLIAALGGEGRTSLGGAAAAPAPTAGALHAAASGPDDDAPF"
FT   gene            complement(29663..31015)
FT                   /locus_tag="Dtpsy_0027"
FT   CDS_pept        complement(29663..31015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0027"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   ajs:Ajs_0009 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31516"
FT                   /db_xref="GOA:B9M9U5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M9U5"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACM31516.1"
FT                   /translation="MHAISSAAPAPSVRLPFYRQLYFQVVFAIIIGVLLGHFQPEYGAA
FT                   MKPFGDAFIKLIKMIIAPVIFLTIVTGIASMSHLSAVGRVFGKAMAYFLTFSTLALVVG
FT                   LVVANVMQPGTGMHINVAELDQTAVKGYVSKSHEMTLTGFALDIIPKTLISPFVGDNIL
FT                   QVLLVAVLFGVSLAMVGDAGKPILDFLDGLTKPVFKLVNIVMKAAPIGAFGAMAFTIGK
FT                   FGLGSLVNLAELVLTFYITSAVFVLVVLGAVARACGFSVLKLIRYLKAELLLVLGTSSS
FT                   ESALPSLMEKMEKAGCSKSVVGLVVPTGYSFNLDGTNIYMTLAALFIAQATDTHLTLGH
FT                   QIALLLVAMLSSKGAAGVTGAGFITLAATLAVVPEVPVAGMALILGVDRFMSECRSLTN
FT                   FIGNAVATVVVSRWENALDADRLHRVLDGEAEFLPEPERAVEPVVLARHRA"
FT   gene            31185..33839
FT                   /locus_tag="Dtpsy_0028"
FT   CDS_pept        31185..33839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0028"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; SMART: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   ajs:Ajs_0010 multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31517"
FT                   /db_xref="GOA:B9M9U6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9U6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACM31517.1"
FT                   /translation="MPLRRRRPLITALVALFVLAGMAVCMLLASQYAQRRALHDESQGV
FT                   RRQLTLYGQALEQRIDRFRTLPEVLALDAQLRDALTHPLTPAEVDALNRKLEQANGASH
FT                   SSTLTLINLQGRAIAASNWRDTPNNVGEDYHFRPYVQQALAQGHGRFYGIGLTTGEAGY
FT                   FLSTAIRGDDGQTLGLVAIKILLTELEREWRQSPDVVLASDAHGVVFLASRDAWRYRLL
FT                   APLTPQARQELEATRQYTGQPLAPLGLQVERRVDEGTVLARAQEPPLPGPLLWHTQELA
FT                   GAGWQLHLLHHADSAIEARRWAAGAAAGLWLALALLVLFVRQRQRLALLRQRSRQELET
FT                   VLRQHAQELRTAQDGIVQAAREADTGLSRSLQHLPQGVVVIDRDLNLVAWNSRYVELFR
FT                   FPPELMRVGTPVEALIRHNARRGLLGATPTEDAIQRRLQHLRSGKPHLHESAKSDGTVL
FT                   EIRGNPLPDGGFVTSYADITSYKNAARELRSLADALELRIAERTRDLDAARREAEAANR
FT                   YKTRFVAAAVHDLLQPLNAARMFASLLRGHLHDAAGRQVADSIDGALAAQDGILNSLLD
FT                   ISRMESGQLEVHVRDFALGPLLQVMQHNFGIIAASRGLRLRTVGTRYAVRSDEALLRRI
FT                   LQNLVSNAIRYTPRGRVLIGCRRRGRYLRIEVHDQGPGIPESLQREIFEEFRRLGEGHS
FT                   QDGDRGAGLGLAIVERLGKLLGHEIGLRSELGRGSVFWVCVPLADAAAAPRPAAAGAAA
FT                   PPEGDQPLQGTTAWYIDDDAPSCEATGALLRRWGCEVPLAGGPQSALDLAAPGNAPQLV
FT                   LLDVRMGPFHGPDLYDRLCTVWGQAPSVVLVTAERSSTLRRQAAERGWGYLLKPVRPSA
FT                   LRALISQMMLRKQ"
FT   sig_peptide     31185..31274
FT                   /locus_tag="Dtpsy_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.807 at
FT                   residue 30"
FT   gene            complement(33910..34554)
FT                   /locus_tag="Dtpsy_0029"
FT   CDS_pept        complement(33910..34554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0029"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; SMART: regulatory
FT                   protein LuxR; response regulator receiver; KEGG:
FT                   ajs:Ajs_0011 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31518"
FT                   /db_xref="GOA:B9M9U7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9U7"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACM31518.1"
FT                   /translation="MPPPTLLVADDHPLFRAALIQVLHERFAPLQTLEAASAATLGQAL
FT                   QDHPEVELVLLDLAMPGARGFSALLHVRGEYPQVPVVVISSNDHPRVIRRAQQFGAAGF
FT                   IPKSAPAEDMGAAIRAVLDGGSWFPPMAAERSEADAALAAKLAQLTPQQFRVLLCLADG
FT                   LLNKQIAHELGLAENTVKVHVTAILKKLECYSRTQAAVLVKSLETEPEAAP"
FT   gene            34609..35862
FT                   /locus_tag="Dtpsy_0030"
FT   CDS_pept        34609..35862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0030"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ajs:Ajs_0012 nucleoside recognition domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31519"
FT                   /db_xref="GOA:B9M9U8"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9U8"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACM31519.1"
FT                   /translation="MALNWVWTGFFIVAFATAVVRWLLGEAGIFQALLTALFDGARAGF
FT                   EISLGLAGIMALWLGLMRVGERAGMVELLARLAGPLLTRLFPAVPAGHPAQGAMTMNIS
FT                   ANLLGLDNAATPLGLKAMQELQTLNREPAGAASNAQIMFVVMNTAGLTLIPTSVIAIRQ
FT                   SVALKQGLGAGFNAADIFLPTLLVTFASLLAGVLAVALFQRLPIWRARLLLPLLAVGGV
FT                   LAAAVAGLAQLPAEQAAQIAGATGAGVILGVVALFLLAGAWRRVNVYDAFIDGAKEGFG
FT                   VAVQIIPYLVAILAAIGVFRAAGCMDALLAAIGAGVAALGWNTDFLPALPVGLMKVLSG
FT                   AGARGLMIDVLQTHGVNSFVGRLAAIVQGSTETTFYVLAVYFGSVGVKHTRHALACALV
FT                   ADAVGLLAAIGVGYTLLR"
FT   gene            36339..36641
FT                   /locus_tag="Dtpsy_0031"
FT   CDS_pept        36339..36641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31520"
FT                   /db_xref="InterPro:IPR021724"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9U9"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0013"
FT                   /protein_id="ACM31520.1"
FT                   /translation="MQALYCFPRPFPVTDSALLPLPDRLAIDPRSPHHVAAVFQQAADI
FT                   GIRFNGKERVDVEEYCVSEGWIKVPAGKTLDRKGRPLLITLKGSVEVFYKPEAAA"
FT   gene            complement(36938..38125)
FT                   /locus_tag="Dtpsy_0032"
FT   CDS_pept        complement(36938..38125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0032"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: ajs:Ajs_0014 beta-ketothiolase; TIGRFAM:
FT                   acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31521"
FT                   /db_xref="GOA:B9M9V0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9V0"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACM31521.1"
FT                   /translation="MTHREVFVVSTARTAIGTFGGSLKDVPNTQLATTAVKAAIARAGI
FT                   APDAVGHVVMGNVIPTDTKDAYLSRVAAIDAGCPIETPAFNVNRLCGSGLQAIISAAQA
FT                   IGYGDCDVAVGGGSESMSRGPYFDQGARWGQRMGDSKSIDYMLGILHDPWQKMHMGITA
FT                   ENVAERYQISREMQDQLALASQQRAAAAIAAGYFKEQIVPVEIATRKGTVLFQEDEHVR
FT                   AATTLDVLAGMKPAFKKEGGTVTAGNASGINDGAAAVVLVAGDRLQALNVKPLARLVGY
FT                   AHAGVDPAYMGIGPVPATQKVLQRTGLKVQDMDVIEANEAFAAQACAVVQELGLDPAKV
FT                   NPNGSGISLGHPVGATGAIITTKAIAELHRTGGRYALVTMCIGGGQGIAAIFERV"
FT   gene            complement(38122..38673)
FT                   /locus_tag="Dtpsy_0033"
FT   CDS_pept        complement(38122..38673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0033"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="PFAM: protein of unknown function DUF1130; KEGG:
FT                   ajs:Ajs_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31522"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9V1"
FT                   /inference="protein motif:PFAM:PF06571"
FT                   /protein_id="ACM31522.1"
FT                   /translation="MAAPPLYTIGHSTLTVQDFIALLQREGVTRVIDVRAIPRSLRQPQ
FT                   FHEDRLPGALAAQGIAYTHMPALGGRRPLQRGVPPTTNGYWDNRSFHNYADYALQPAFR
FT                   AALAALRTAAAREPCAIMCAEAVWWRCHRRIITDHVLAAGGAVRHILGARTESATLTPA
FT                   AQVHPDGTVTYPPPTTVSAP"
FT   gene            complement(38686..38901)
FT                   /locus_tag="Dtpsy_0034"
FT   CDS_pept        complement(38686..38901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31523"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9V2"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0016"
FT                   /protein_id="ACM31523.1"
FT                   /translation="MAHPFKVGDHVSWNSEAGRVSGRITAVHTRALQWKGYTHHACAEE
FT                   PQYEIQSDKTDHVALHKGSALHRLAR"
FT   gene            complement(39013..39516)
FT                   /locus_tag="Dtpsy_0035"
FT   CDS_pept        complement(39013..39516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0035"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: ajs:Ajs_0017 MerR family transcriptional
FT                   regulator; TIGRFAM: Cu(I)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31524"
FT                   /db_xref="GOA:B9M9V3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9V3"
FT                   /inference="protein motif:TFAM:TIGR02044"
FT                   /protein_id="ACM31524.1"
FT                   /translation="MSTAPRRLAHRVPRAVAGHAAALDWPVAIGTAAERAGVSARMLRH
FT                   YESLGLLTGVARTDSGYRQYTEADVHTLRFIRRARDLGFSMEEIATLLGLWQDKQRASS
FT                   QVKRIAQAHIDNLSERIAAMQAMQRSLQALVHCCHGDDRPDCPILDDLAMAGIPNSGAA
FT                   DVAI"
FT   gene            complement(39513..39710)
FT                   /locus_tag="Dtpsy_0036"
FT   CDS_pept        complement(39513..39710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0036"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: ajs:Ajs_0018 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31525"
FT                   /db_xref="GOA:B9M9V4"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9V4"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ACM31525.1"
FT                   /translation="MQYTFQVQGMTCGHCERAVVHAVRQVDTDALVKVDLATGQVIVES
FT                   DKSREALANAIQEEGYKVAA"
FT   gene            39889..42237
FT                   /locus_tag="Dtpsy_0037"
FT   CDS_pept        39889..42237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0037"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: ajs:Ajs_0019 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31526"
FT                   /db_xref="GOA:B9M9V5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9V5"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACM31526.1"
FT                   /translation="MTSASLSPAATGDAPAGTLDLGIAGMTCASCVGRVERALRKVPGV
FT                   QDATVNLATERAHIVFDAASGGGMEALARRAVRNAGYEPRSVEEQEAGEEGAQSPWAGF
FT                   TPVAVGLLLSAPLVLPMLGDLFGLHWMLPAWVQFILATPVQFILGARFYKAGWHAAKAL
FT                   TGNMDLLVAIGTSAGYGLSLWLWATAESTHGAGHTPHLYFEASAVVITLVLLGKWLEAR
FT                   AKRQTTAAIRALHALRPEVAHLLGRDGEVDVPIAEVMAGDRLVVRPGERIPVDGTVVEG
FT                   HTQVDESMLTGEPLPVARSADGPEGGALTGGSINGDGRIVMQVTAVGSETVLARIIRLV
FT                   EDAQAAKAPIQRLVDKVSAVFVPVVLAIAIVTLLGWLWTGAGVEAALIHAVAVLVIACP
FT                   CALGLATPAAIMAGTGVAARHGILIKDAEALETAHRVQTVAFDKTGTLTVGRPRLTAFH
FT                   VEPGVDEAALLSAVAAVQSGSEHPLARAVVSAAQERGLPAPAPDGVRAVPGRGTEGEVA
FT                   ARSYLVGSLRWMQELGVDLGPLADRAATLQAEGATVSAVAERVAQDPSGARPPEAASAP
FT                   LGGSEDTIVPSAGAHYVLRALLAFGDEPKPGAREALAHLRTQGVRCVMISGDNRGAAEA
FT                   MARRLGLQPEAGEVMAEVLPGDKAAAVNALKAQGHVVAMVGDGVNDAPALAAADVGMAM
FT                   GNGTDVAMHAAGITLMRGDPQLVAAALDISRRTVAKIRQNLFWAFAYNVAGIPLAALGY
FT                   LSPVVAGAAMALSSVSVMTNALLLKRWRG"
FT   gene            42422..44074
FT                   /locus_tag="Dtpsy_0038"
FT   CDS_pept        42422..44074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0038"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; SMART: histidine kinase HAMP
FT                   region domain protein; chemotaxis sensory transducer; KEGG:
FT                   ajs:Ajs_0020 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31527"
FT                   /db_xref="GOA:B9M9V6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9V6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACM31527.1"
FT                   /translation="MNIYALMRLFTIRLRMIGAIGVVLGLLGLLGGAGMLGMFRIHGLA
FT                   QDFVSQPHAAVKLMGQLRSEMGEIRQHEKDMIIHYERPESVRAAHDRWLASLDRAGKVT
FT                   ATLGQIWQGEDLAEAKDVAKHLVAYREQFAHVARQLEAGGYDTATIANRMSGKAVEQFN
FT                   IATEKVAALDKRLAAEVDSAIAHQDRVTDQTKWLFALAVLITVVVVVPLTLLNMVSICR
FT                   PLEVARAMAQAIAGGDLSQRIHVEGRDEAADLQRALLDMQTGLGAMVAQVRDASSNIAT
FT                   ASQEIATGNQDLSSRTEQTASNAQEAVAALSQLTATVQQTASSSQVANQLVTSASGIAT
FT                   RGGQVVQQAVNSMHEISSSSRKIGDIIGLIDSIAFQTNILALNAAVEAARAGEQGRGFA
FT                   VVAGEVRSLAQRSAAAASEIKGLISSSVTAVDGGVRHVEDAGKAMQEIVSSVQRVTDII
FT                   GEINSAASEQAGGIGEVNASVGEIDRMTQQNAALVEESAAAAESLREQAARLSQVVSQF
FT                   QLADDGHAPAAFTRSGAPAPALRGGDTPRLSAA"
FT   sig_peptide     42422..42559
FT                   /locus_tag="Dtpsy_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.639 at
FT                   residue 46"
FT   gene            complement(44261..45010)
FT                   /locus_tag="Dtpsy_0039"
FT   CDS_pept        complement(44261..45010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0039"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   dac:Daci_2500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31528"
FT                   /db_xref="GOA:B9M9V7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9V7"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACM31528.1"
FT                   /translation="METPAVLVLGAVVAGFVQGLSGFAFSMVAMSFWVWVLEPHLAAAL
FT                   AVFGSLTGQVLAAVTMRRGFNAALLWPFILGGLVGVPVGASLLPHLNAHWFKALLGTLL
FT                   VCWCPAMLMARSLPRVRWGGRTADAVVGLCGGVMGGIGGFTGVLPTLWCTLRGLPKDTQ
FT                   RAVVQNFNLAMLAVAMATYLAKGLVTRDMLPAFGIVATAVLVPVLLGTRLYIGISEVRF
FT                   RQIVLGLLTVSGGALLVASVPRLLAPA"
FT   sig_peptide     complement(44915..45010)
FT                   /locus_tag="Dtpsy_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.619 at
FT                   residue 32"
FT   gene            complement(45165..46289)
FT                   /locus_tag="Dtpsy_0040"
FT   CDS_pept        complement(45165..46289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0040"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   ajs:Ajs_0022 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31529"
FT                   /db_xref="GOA:B9M9V8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9V8"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACM31529.1"
FT                   /translation="MPTLFDPIQAGDLHLANRIAMAPLTRNRSPRAVPRDITATYYAQR
FT                   ASAGLLITEGTAITHQGQGYSDVPGLYGTEQLDGWKRVTQAVHARGGKIVTQLWHVGRV
FT                   SHTALQPEGGAPVAPSAVRAQSQTYLVDAASGQGQFVPTSEPRALAAEELPDIVHAFAA
FT                   AARNAVQTAGFDGVEIHGANGYLLDQFLKDGANQRKDDYGGGIANRVRLMVEVTRAVVD
FT                   AIGGGRVGIRLSPVTPANDIHDSDPQPLFEHLARELAPLGLAFIHVIEGATGGPREVEG
FT                   RPFDYAAFKNAYRSAGGRGAWMVNNGYDRDMAQEALASGRADIVAFGRAFISNPDLVER
FT                   LRRGAPLNAWDQTTFYGGGEHGYIDYPALEQAPA"
FT   gene            complement(46360..46545)
FT                   /locus_tag="Dtpsy_0041"
FT   CDS_pept        complement(46360..46545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31530"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9V9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACM31530.1"
FT                   /translation="MAAPGICGARLVRAGASPQKSPTRRTPGAIQGRQPAPPPYPSLFD
FT                   VAQNPWFCSAWVYCTP"
FT   gene            complement(46553..47161)
FT                   /locus_tag="Dtpsy_0042"
FT   CDS_pept        complement(46553..47161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0042"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ajs:Ajs_0023 glutathione S-transferase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31531"
FT                   /db_xref="GOA:B9M9W0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9W0"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACM31531.1"
FT                   /translation="MKLYYSPGACSLSPHIVLHETGLAHTSVLASTKSHKLQDGTDYYT
FT                   INPLGYVPVLELDDGTRLREGPAIVQYLADQAPHKNLAPANGTLARYRLQEWLTFIGTE
FT                   IHKGFTPLFKPTTPADYKPLVHEQLLSRLKWVDGELAHKPYLMGEHFSVADAYLFTVTN
FT                   WAPAVNLDISALKNLAAYRERIAARPAVQAAMKAEGLLK"
FT   gene            complement(47296..47562)
FT                   /locus_tag="Dtpsy_0043"
FT   CDS_pept        complement(47296..47562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0043"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   ajs:Ajs_0024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31532"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9W1"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ACM31532.1"
FT                   /translation="MDCRPGCGACCTAPSISSPIPGMPHGKPAGMRCVQLDDDARCRIF
FT                   GRPERPAVCASLRPSPAMCGDSRAHAMRWLALMEQATQPSTPR"
FT   gene            complement(47628..48212)
FT                   /locus_tag="Dtpsy_0044"
FT   CDS_pept        complement(47628..48212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0044"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   ajs:Ajs_0025 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31533"
FT                   /db_xref="GOA:B9M9W2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9W2"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACM31533.1"
FT                   /translation="MKFLVFAGSTRTQSFNRRLAAVAAHMARDAGAEVTLLELADFDIP
FT                   LYNADLETAGTPADVIRLKEVLDAHPAWVICSPEYNGSYTGLLKNTIDWASSPVAGHAE
FT                   WSDGTRPFAGKVVGMLSASNGALGGLRSQSHLAPLLLNLECWLAPRHFALPRAASAFDA
FT                   QGQLVDASQAAHVRGVVEQVLWAAGRLHGTA"
FT   gene            48425..50398
FT                   /locus_tag="Dtpsy_0045"
FT   CDS_pept        48425..50398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0045"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: ajs:Ajs_0026
FT                   tRNA uridine 5-carboxymethylaminomethyl modification enzyme
FT                   GidA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31534"
FT                   /db_xref="GOA:B9M9W3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M9W3"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ACM31534.1"
FT                   /translation="MLYPQDFDVIVVGGGHAGTEAALAAARMGSRTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMALATDEAGIQFRILNSSKGPAVRATRAQADRILY
FT                   KAAIRRMLENQPNLWLFQQAVDDLMVEGDRVVGAVTQVGIRFRSRAVVLTAGTFLDGKI
FT                   HVGLNNYAAGRAGDPPAVSLSARLKELQLPQGRLKTGTPPRIDGRSIDFSQCEEQPGDG
FT                   MPGGVNEGAVPVFSFMGNAAMHPRQVPCWITHTNARTHEIIRSGFDRSPMFTGKIEGVG
FT                   PRYCPSVEDKINRFADKESHQIFLEPEGLTTHEFYPNGISTSLPFDIQYDLVRSMRGLE
FT                   NAHILRPGYAIEYDYFDPRSLKSSFETRQIQGLFFAGQINGTTGYEEAAAQGLFAGINA
FT                   ALQCRGERAWVPARDEAYLGVLVDDLITKGVTEPYRMFTSRAEFRLQLREDNADMRLTD
FT                   AGRRMGLVDDARWDAFSRKRDAVSRETERLKSTWVNPRNLPTVEAERVLGKAIEHEYNL
FT                   FDLLRRPDVGYDALTTMDGGKYASEAVSRETLGELSAPVIEQVEIAAKYAGYIERQRDE
FT                   VQRAAHFEKLRLPEDLDYMQVAALSIEVRQKLQKHRPETLGQASRISGVTPAAISLLMV
FT                   HLKKGGFKGFAPQPADGVETVA"
FT   gene            50395..51075
FT                   /locus_tag="Dtpsy_0046"
FT   CDS_pept        50395..51075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0046"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: ajs:Ajs_0027
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31535"
FT                   /db_xref="GOA:B9M9W4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M9W4"
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /protein_id="ACM31535.1"
FT                   /translation="MSVVSNTSLEHALREGANALGLDLSEAQITQLLDFLALLQKWNKV
FT                   YNLTAVRDPQEMLTHHLLDSLAAVPPLRRHVARRGQGGAIHLGARLLDVGSGGGLPGVV
FT                   FAICCPEVDVSCVDTVAKKAAFIQQAAGTLGLSNLHGIHARVETLAGPFDVVSCRAFAA
FT                   LADFTAWSRQALAPHGVWLAMKGKHPHDEIAALPADVSVFHVEQLTVPGLQAERCILWL
FT                   RPVA"
FT   gene            51110..51724
FT                   /locus_tag="Dtpsy_0047"
FT   CDS_pept        51110..51724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0047"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   ajs:Ajs_0028 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31536"
FT                   /db_xref="GOA:B9M9W5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9W5"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACM31536.1"
FT                   /translation="MFGIADYGAFVAAIVLFLAIPGPGNLALITSTGKGGVRAGMAACM
FT                   GVIAADQVLMWMAVAGVAGLLAAYPAAFHAVQWLGAVYLGWMGYKMLTAKPGDAPVLNI
FT                   APRHYFRQGAVITLLNPKAIVFYMAFFPLFVNPATHRGLVTFAAMAATIATLTFLYSLV
FT                   VVLLTHFLAERMRANPTVARVLEKTAGVFLIGFGVKLAISK"
FT   gene            51741..52511
FT                   /locus_tag="Dtpsy_0048"
FT   CDS_pept        51741..52511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0048"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   ajs:Ajs_0029 chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31537"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9W6"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACM31537.1"
FT                   /translation="MAKIFCIANQKGGVGKTTTSVNLAAGLAKIGQRVLLVDLDPQGNA
FT                   TMGSGVDKRALELSVYDVLLESASVPEAAVLSEQCGYRVLGANRELAGAEVELVPLEQR
FT                   ERRLKAALAAVDSDYDFVLIDCPPSLSMLTLNGLCSAHGVIVPMQCEYFALEGLTDLVN
FT                   TIKQVHANLNPDLQIIGLLRVMFDPRITLQSQVSEQLKDHFGDKVFDTVIPRNVRLAEA
FT                   PSYGLPGVVFDPAAKGSQAFVEFAREMVERVKRM"
FT   gene            52598..53140
FT                   /locus_tag="Dtpsy_0049"
FT   CDS_pept        52598..53140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0049"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   ajs:Ajs_0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31538"
FT                   /db_xref="GOA:B9M9W7"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9W7"
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /protein_id="ACM31538.1"
FT                   /translation="MNPSQILLLPGWQNSGPGHWQTEWERLHGYQRVQQHDWMRPLRGD
FT                   WSARLEEVVADAPGEVVLAAHSLGCILTAWWAAHTRYAHKVRGALLVAPGDVERPDLAA
FT                   QIPGWAPIARQVLPFPAVLVGSQDDPYCSFERAQTLAGAWGARFVDCGPRGHINADSDL
FT                   GEWPEGHALLRALMNKD"
FT   gene            53147..54142
FT                   /locus_tag="Dtpsy_0050"
FT   CDS_pept        53147..54142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0050"
FT                   /product="parB-like partition protein"
FT                   /note="KEGG: ajs:Ajs_0031 chromosome segregation
FT                   DNA-binding protein; TIGRFAM: parB-like partition protein;
FT                   PFAM: ParB domain protein nuclease; SMART: ParB domain
FT                   protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31539"
FT                   /db_xref="GOA:B9M9W8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9W8"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ACM31539.1"
FT                   /translation="MVTKKPKGLGRGLEALLGPKVADKAPAGANAAGAADGPVSTLALD
FT                   RLVPGIYQPRTRMDEGALYELAESIKAQGIMQPILVRRLDDEQAQQRRQERASQGASAA
FT                   MGALSASGPLYEIIAGERRFRASRLAGLAEVPVLVRDVPNEAAAAMALIENIQREDLNP
FT                   LEEAQGLQRLIREFGLTHELAAQAVGRSRSAASNLLRLLNLAEPVQTMLMAGDIDMGHA
FT                   RALLSLERAAQITAGNQIAAKKLSVREAESLVKKLGAEFALTPQKPKKDKSRDLKRVEE
FT                   ELSDLLMAEVEVRVKKRVKRGSRVEEMGELAIQFGSLEALNGLIERLRGG"
FT   gene            54168..54965
FT                   /locus_tag="Dtpsy_0051"
FT   CDS_pept        54168..54965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0051"
FT                   /product="methyltransferase type 12"
FT                   /note="KEGG: ajs:Ajs_0032 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31540"
FT                   /db_xref="GOA:B9M9W9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9W9"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0032"
FT                   /protein_id="ACM31540.1"
FT                   /translation="MPRRPRRLHHLHAPPPRRIVLPWPLPAVLVWAAAWLLFAGLRGSV
FT                   APLAALGLACAVGVAGSLLAQGWWRRGLIALGFPLSAALGGAVALPAWGWLLPLALLLL
FT                   VYPLNAWRDAPLFPTPPGALHGLQDAVPLSAGAPVLDAGCGLGDGLKALRAAYPQARLH
FT                   GLEWSGPLALLCRLRCPWARVRRGDIWATDWGGYDLVYVFQRPESMARVAAKARAEMAP
FT                   GRWLVSLAFAVPGVRPSARLDSFAGHAVWIYQLPLPADSAAPH"
FT   gene            55131..56171
FT                   /locus_tag="Dtpsy_0052"
FT   CDS_pept        55131..56171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0052"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   ajs:Ajs_0033 peptidoglycan binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31541"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9X0"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACM31541.1"
FT                   /translation="MSRKPLTLLAAACAALALTGCETTNMRMGSAESKTVATGAAAGGS
FT                   AANESGQLERCQSPLGTVSLVENQDAGWYTILRNEYKLPPTANLLRLLIQQSNCFIVVE
FT                   RGAAGMRAMDRERQLMGSGEMRGGSNFGRGQMVASDYGMSPEIIFSNNDAGAIGGVLGG
FT                   LIGGGSGRALAAVGGGLKTREASAMLTLVDNRSGVQVAASEGSASKSDFAGFGSLFGGS
FT                   AGGGLGGYQNTAQGKVITAAFMDAYNQMVVALRSYKAQSVQGQGLGGGGRLGVDGGAAP
FT                   SQTRAGAAMSVREAQERLNAMGYNVGTPDGSAGPKTARALREFQQAQGLPVTGRLDSAT
FT                   AGALSR"
FT   sig_peptide     55131..55193
FT                   /locus_tag="Dtpsy_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.926 at
FT                   residue 21"
FT   gene            56416..57132
FT                   /locus_tag="Dtpsy_0053"
FT   CDS_pept        56416..57132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B2252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31542"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9X1"
FT                   /inference="similar to AA sequence:KEGG:H16_B2252"
FT                   /protein_id="ACM31542.1"
FT                   /translation="MYLSLPPFWSSWLAWPKPPPAPDASGVFSSFLDVSRRQARRLAQP
FT                   AELRIDVDPPDATIEQELSALHQRLHSPGDALHGLPSTPLPGHPGLFVRSRVADGELYV
FT                   YIEDPLRQCLAGTTVFNRLVELNRRADRHLRAPHSRYAPAYQRRGLATAVYRWALDGGQ
FT                   CLVSGARQSAGAHALWQRLGRDYPQGYVCLQHKTPRYLGRQVDARVQEALATRRLLLGR
FT                   GWTLARLAAATGMLSA"
FT   gene            complement(57198..58118)
FT                   /locus_tag="Dtpsy_0054"
FT   CDS_pept        complement(57198..58118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0054"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: ajs:Ajs_0038 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31543"
FT                   /db_xref="GOA:B9M9X2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9X2"
FT                   /inference="protein motif:PFAM:PF02311"
FT                   /protein_id="ACM31543.1"
FT                   /translation="MPSPSLPRPAPPPAEPAAASTAGRAARPARVLSYVESLTPHLFVP
FT                   SRERPVRAKHRELRADTQVRPHSHPWAQVAISTTGVLRLTVPRGTYIVPPSRALWIPPG
FT                   VEHAVTMVEDADLRTLYFYQPPGRCGPAVARAQEEPWRQCRVLEVSELLRAVVREMPTD
FT                   PDDGAPPPPELLHRERHLSALILDELRRASSVRLGVDLPRDKRLRHLCEAVLADPTRHD
FT                   TLADWARDTGASPRTVARLFRQELGSTFTQWRQQVILARAVALAAGRKPINQIAAELGY
FT                   NSPSAFSAMVRRAVGLAPGRFLGSP"
FT   gene            58178..59425
FT                   /locus_tag="Dtpsy_0055"
FT   CDS_pept        58178..59425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0055"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ajs:Ajs_0039 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31544"
FT                   /db_xref="GOA:B9M9X3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9X3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACM31544.1"
FT                   /translation="MPMTTAAPTLRQDARTIGLIGLAHGSSHFFHLLLPPLFPFLIAEF
FT                   GYSYSELGLLVSVFFVVSGVGQALSGFLVDRVGARPVLFAALASFALAGLTAGSASGYL
FT                   GLVVASVLAGLGNAPFHPVDFTILNKRVSPARLGHGFSVHGISGNLGWATAPLFMAGIA
FT                   TATGSWRMACLSGGALALVILAIMVWNRDALDDRQGTWAHAPAKGATGSAHAQEHPMAF
FT                   LKLPAVWLCFSFFFWSTCSLSAIQSFAAPALQRMYDMPLSLTSMVVTGYMLCSAVGMVI
FT                   GGFLVGRVVRLEKTISICLMASAALLVLVGLGALPGTVALAVAALAGMGVGIAGPSRDM
FT                   LIKRAAPPGATGRVYGTVYSGLDLGFSVAAPLFGVLLDRGQTADIFYGSALALVLSVVS
FT                   AALVGGGVARRQAQAA"
FT   gene            59741..60484
FT                   /locus_tag="Dtpsy_0056"
FT   CDS_pept        59741..60484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0056"
FT                   /product="ChaC family protein"
FT                   /note="PFAM: ChaC family protein; KEGG: rru:Rru_A2776
FT                   ChaC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31545"
FT                   /db_xref="GOA:B9M9X4"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9X4"
FT                   /inference="protein motif:PFAM:PF04752"
FT                   /protein_id="ACM31545.1"
FT                   /translation="MEPHAFRHLPELQGRLTPPQASGLRLTDEVLAAWDAQARQQGLSA
FT                   DWRLPDDVVERSRQAVLAQSEGCDLWVFAYGSLMWNPAIHFDEVRRARLADHARRFALA
FT                   TTIGRGTPDSPGLVLTLQRGVGDCEGLAFRIPQALLERESRMLWRREMIHGSYCPGFQP
FT                   LHTPQGGVRALVLSANTAHPLHRGGLSLDDTAAIIASAQGSVGSNRDYLDQLACQLDLL
FT                   GIRDDYVRCLAARVRAHRAAPNRGG"
FT   gene            60623..61225
FT                   /locus_tag="Dtpsy_0057"
FT   CDS_pept        60623..61225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0057"
FT                   /product="flavoprotein WrbA"
FT                   /note="TIGRFAM: flavoprotein WrbA; PFAM: NADPH-dependent
FT                   FMN reductase; flavodoxin/nitric oxide synthase; KEGG:
FT                   azc:AZC_4089 flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31546"
FT                   /db_xref="GOA:B9M9X5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR037513"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M9X5"
FT                   /inference="protein motif:TFAM:TIGR01755"
FT                   /protein_id="ACM31546.1"
FT                   /translation="MSKVLVLYYSTYGHLETMAQAVAEGARSAGATVDVKRVPETVPQE
FT                   IARSAHFKLDQSAPVATVTELENYDAIIVGAPTRFGRMPSQMGSFLDQAGGLWARGALN
FT                   GKVGAAFTSTATQHGGQETTLFSIITNLLHFGMVIVGLPYSFQGQMTLDEVVGGAPYGA
FT                   TTIAGGQGQRQPSATELDGARFQGRLVAETANKLFGG"
FT   repeat_region   61561..62454
FT                   /rpt_unit_range=61561..61596
FT                   /note="CRISPRs"
FT   gene            complement(62519..62827)
FT                   /locus_tag="Dtpsy_0058"
FT   CDS_pept        complement(62519..62827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0058"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   protein of unknown function DUF196; KEGG: pmu:PM1125
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31547"
FT                   /db_xref="GOA:B9M9X6"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9M9X6"
FT                   /inference="protein motif:TFAM:TIGR01573"
FT                   /protein_id="ACM31547.1"
FT                   /translation="MRMLVFFDLPVVSKADRRAYTVFRRFLLNDGYDMIQFSVYGRILN
FT                   GTDAAQKHMQRLLANLPSEGSVRVLTVTEKQFASMKLLVGLPLFQEKKVNAAQIALF"
FT   gene            complement(62864..63772)
FT                   /locus_tag="Dtpsy_0059"
FT   CDS_pept        complement(62864..63772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0059"
FT                   /product="protein of unknown function DUF48"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; protein of
FT                   unknown function DUF48; PFAM: protein of unknown function
FT                   DUF48; KEGG: asu:Asuc_0377 CRISPR-associated Cas1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31548"
FT                   /db_xref="GOA:B9M9X7"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9X7"
FT                   /inference="protein motif:TFAM:TIGR03639"
FT                   /protein_id="ACM31548.1"
FT                   /translation="MVWRSIVINRPAKLKREHFALVVEQEQSARVPFEDIAVIVLNHRE
FT                   ITLTHPVLSACGEYGIGLYSTGDNHQPNGVFMPFLQHSRATRMQRLQLDLDKPSAKRAW
FT                   AHIVQVKIGNQARCMELLGTVGTDRLASYARRVRSGDGGNLEAQASAYYFPQVFGRSFH
FT                   RSQTGWSNAALDYGYAVMRGACARALVAHGMLPSLGLFHRSEQNAFNLADDLIEPYRPV
FT                   VDLHVAQHRPADEDAELQPSDKVALVGLLNVDVAMPRGQMSVLASIEQAAESLARLYDG
FT                   GSEQVLELPRLIGLRQHVFEI"
FT   gene            complement(63759..67154)
FT                   /locus_tag="Dtpsy_0060"
FT   CDS_pept        complement(63759..67154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0060"
FT                   /product="CRISPR-associated protein, Csn1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csn1 family;
FT                   KEGG: pmu:PM1127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31549"
FT                   /db_xref="GOA:B9M9X8"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="InterPro:IPR041383"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9X8"
FT                   /inference="protein motif:TFAM:TIGR01865"
FT                   /protein_id="ACM31549.1"
FT                   /translation="MAQHVFGLDIGIASVGWAILGEQRIIDLGVRCFDKAETAKEGDPL
FT                   NLTRRQARLLRRRLYRRAWRLTQLSRLLKRKGLIADAKLFAKAPSYGDSAWELRRQGLD
FT                   RLLTPLEWARVIYHQCKHRGFHWTSKAEEAKADSDAEGGRVKQGLAHTKALMQAKNYRS
FT                   AAEMVLAEFPDAQRNKRGQYDKALSRVLLGEELALLFATQRRLGNPHASDFFEKLILGD
FT                   GDRKSGLFWQQKPALSGADLLKMLGKCTFEKGEYRAPKASFSVERHVWLTRLNNLRIVV
FT                   DGRSRPLNEAERQAALLLPYQTETSKYKTLKNAFIKAGLWGDGVRFGGLAYPSQAQIDA
FT                   EKTKDPEDQFLVKLPAWHELRKAFKAAGHEALWQQISTPALDGDPTLLDQIATVLSVYK
FT                   DGAEVVQQLRQLALPEPAASIAVLEKISFDKFSSLSLKALRRIVPLMQSGLRYDEAVAQ
FT                   IPEYGHHSQRIEPGAAKHLYLPPFYEAQRKYAGKGDHIGSMQFRDDADIPRNPVVLRAL
FT                   NQARKVVNALIREYGSPIAVNIEMARDLSRPLDERNKVKRAQEEFRDRNDRARSEFERD
FT                   FGYKPKAAAFEKWMLYREQLGQCAYSQQPLDIQRVLDDHNYAQVDHALPYSRSYDDSKN
FT                   NKVLVLTHENQNKGNRTAFEYLTSFPDGEDGERWRTFVAWVQGNKAYRMAKRNRLLRKN
FT                   YGVDESKGFIDRNLNDTRYICKFFKNYVEEHLQLAARADGDTARRCVVVNGQLTAFLRA
FT                   RWGLTKVRGDSDRHHALDAAVVAACTHGMVKALADYSRRKEISFLQEGFPDPETGEILN
FT                   PAAFDRARQHFPEPWTHFAHELKARLFTDDLAALREDMQRLGSYTTEDLGRLRTLFVSR
FT                   APQRRSGGAVHKETIYAQPESLKQQGGVIEKILLTSLKLQDFDKLLNPESNDHFVEPHR
FT                   NERLYAAIRQRLEQFGGRADKAFGPDNLFHKPDKNNQPTGPVVRSIKLVRGKQTGIPIR
FT                   GGLAKNDSMLRVDIFTKAGKFHLVPVYVHHRVTGLPNRAIVAFKDEDEWTLIDESFAFL
FT                   FSVYPNDYVKVTLKKEQQSGYYSGADRSTGAMNLWAHDRAASVGKDGLIRGIGVKTALS
FT                   VEKFNVDVLGRIYLAPPETRSGLA"
FT   gene            complement(67350..68774)
FT                   /locus_tag="Dtpsy_0061"
FT   CDS_pept        complement(67350..68774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0061"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ajs:Ajs_0040 fis family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31550"
FT                   /db_xref="GOA:B9M9X9"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9X9"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACM31550.1"
FT                   /translation="MNAPATTAHLQPLTTPRPVPQAMLDALAARFGAQYSAAQAVCEQH
FT                   GRDEGSLQAPPPAAVVFAENTQDVQDAVRLAAQYGVPVIPYGAGSSLEGHLLAVQGGIS
FT                   IDMGRMNRVLSVDADDLTVTVQPGITRKQLNEAIKDTGLFFPIDPGADASIGGMAATRA
FT                   SGTNAVRYGTMRENVLALEVVTASGEVIRTGTRAKKSSAGYDLTRLMVGSEGTLGLFTE
FT                   VTVRLYPLPEAVSAAICSFPTIEAAVRTVIQTIQLGVPIARVELIDANSVRMVNAHSKL
FT                   RLREEPLLLMEFHGSPAGVQEQAEVVQDIAREWDGNAFEWATTPEERTRLWTARHNAYF
FT                   AAVQSRPGCKAISTDTCVPISRLADCLLDSVAEADASGIPYFLVGHVGDGNFHFGYLLD
FT                   PAVTAERETAERLNHQLVARALRLGGTCTGEHGVGVHKMGFLVDEAGEGAVEMMRAIKR
FT                   ALDPQNILNPGKIFAL"
FT   gene            complement(69026..69406)
FT                   /locus_tag="Dtpsy_0062"
FT   CDS_pept        complement(69026..69406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0062"
FT                   /product="calcium-binding EF-hand-containing protein"
FT                   /note="KEGG: ajs:Ajs_0042 calcium-binding
FT                   EF-hand-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31551"
FT                   /db_xref="GOA:B9M9Y0"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Y0"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0042"
FT                   /protein_id="ACM31551.1"
FT                   /translation="MPHTPQRRTLPSFDARSVMLFAALTVGGAAAQAQTPSAPSAQPQY
FT                   QTGPGPATTQPKATFGGSSTATPSGSSASASAFERADANRDGQLSSAEAGQLPAIANRF
FT                   QALDKDKNGSLSRTEFEAGSRS"
FT   sig_peptide     complement(69305..69406)
FT                   /locus_tag="Dtpsy_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 34"
FT   gene            69562..70134
FT                   /locus_tag="Dtpsy_0063"
FT   CDS_pept        69562..70134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0063"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: ajs:Ajs_0043
FT                   ATP:cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31552"
FT                   /db_xref="GOA:B9M9Y1"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Y1"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ACM31552.1"
FT                   /translation="MGNRLTQIATRTGDDGSTGLGDNTRVSKASGRPQAMGDVDELNSH
FT                   IGLLLCEPLPADMRELLIDVQHQLFNLGGELSMPGYELLKDDALLQLDNALARYNAELP
FT                   RLLEFILPAGTRAACQAHVCRTVARRAERAVVALQQHETMRAAPRQYLNRLSDLLFVLS
FT                   RALNRMDGGSEVYWKSERLARQNDATE"
FT   gene            complement(70493..70915)
FT                   /locus_tag="Dtpsy_0064"
FT   CDS_pept        complement(70493..70915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0064"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ajs:Ajs_0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31553"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Y2"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACM31553.1"
FT                   /translation="MTLWKKPTTLALITASSANTAVSHLGIEFTEVGDDFLRARVPVDE
FT                   RTRQPFGLLHGGVSVVLAETLGSVGAYHASPEGWLAVGLDINANHLRAARSGWVTGTAR
FT                   PVHIGKTTQVWQIDMVNDAGELTCVSRITMAMLAPK"
FT   sig_peptide     complement(70844..70915)
FT                   /locus_tag="Dtpsy_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.518 at
FT                   residue 24"
FT   gene            71139..72296
FT                   /locus_tag="Dtpsy_0065"
FT   CDS_pept        71139..72296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0065"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   ajs:Ajs_0045 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31554"
FT                   /db_xref="GOA:B9M9Y3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Y3"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACM31554.1"
FT                   /translation="MQRRQFVLQAGRAAALAAAPAFVLPARAQDAPGVSAKALSIGCSA
FT                   AMSGPLLGFGTDIQLGAGAAFAQANARGGVHGRTLQLQMVDDAYDPERTLANVKQIIGQ
FT                   GSALALLSCVGTPNNTAIVPLVEEAGIPYVAPITGASSLRKSTRNVFHVRASYTDEVQR
FT                   LIQRLAGMGLKGIGVVYLDNGYGREMLEDATRALAALNMKPAVQVAVATDGKNLPQVLQ
FT                   AVAAARPSAVLLATAGTVSVGLVRGIKKESPGVLMAGLSVTLPSASVGQLGEDGSGLAL
FT                   SMIVPDPNRAKLQLVRDYQSAMRAQVKSEFSQGSLEAYVNARVLIEGLDRAGKDVTQPK
FT                   LRAALAGIRNLDLGGFVVDYSGQAPYVGSRFIDLGVLGSTGRFIA"
FT   sig_peptide     71139..71225
FT                   /locus_tag="Dtpsy_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(72543..74063)
FT                   /locus_tag="Dtpsy_0066"
FT   CDS_pept        complement(72543..74063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0066"
FT                   /product="succinate CoA transferase"
FT                   /EC_number="3.1.2.1"
FT                   /note="KEGG: ajs:Ajs_0046 acetyl-CoA hydrolase; TIGRFAM:
FT                   succinate CoA transferase; PFAM: acetyl-CoA
FT                   hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31555"
FT                   /db_xref="GOA:B9M9Y4"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Y4"
FT                   /inference="protein motif:TFAM:TIGR03458"
FT                   /protein_id="ACM31555.1"
FT                   /translation="MPTSSSPRIQHPGLAQKIMSAAEAAALIPAGANIGMSGFTGAGYP
FT                   KQVPQALAARIEAEHAAGRPFQVNVWTGASTAPELDGALAKVNGIHQRLPFQSDPICRD
FT                   KINAGEVHYLDIHLSHVAQHAWFGFLGPMQVAVVEVLGILPDGRLIPSAAVGNNKTWLE
FT                   IADKVILEVNSLPPIEMEGMHDIYYGTAIPPRRQPIHLTQATERIGEPYLRVDPSKVIA
FT                   VVQTHQRDRDTAFAKPDAVSNQIAAHIIDFLAHEVKVGRLPKNMLPLQSGVGNVANAVL
FT                   TGLLDGPFDELLGFTEVLQDGMLELIKRGKMTAASATAISLSSEALKDFNEHIAFYRDR
FT                   IVLRPQEISNHPELVRRLGVIAMNAMIEADIYGNINSTHVMGSAMMNGIGGSGDYARNG
FT                   YLSFFVTPSVAKGGKVSCIVPMVSHVDHTEHDTQIIVTEQGLADLRGLSPRQRAQVIID
FT                   KCAHPDFRPLLQDYFDRARSKGAQHTPHILGEALSWHERCLATGSMLP"
FT   gene            74263..74994
FT                   /locus_tag="Dtpsy_0067"
FT   CDS_pept        74263..74994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31556"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Y5"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0047"
FT                   /protein_id="ACM31556.1"
FT                   /translation="MPFTPLCPSCRQPTEIRRFAASTGGTLELDLCFACQGMWFDPQEN
FT                   TRLAPAAVLELFELLHQHRGDAHHPLADRLRCPRCSQALAKGYDVAQGGRYVTYRCAAR
FT                   HGRFSTFGSFMVEKGFVRHLSTMEIEALAERVGTINCTSCGGTVDIRHDHACPYCRSAL
FT                   SLLDPQAVDKALARHGSAARQTAPADAASPDALADALVALERNRAREERARQRERLEGT
FT                   RSDEFDLLTAGIEMVWSLLRR"
FT   gene            complement(75130..76416)
FT                   /locus_tag="Dtpsy_0068"
FT   CDS_pept        complement(75130..76416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0068"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: ajs:Ajs_0048
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31557"
FT                   /db_xref="GOA:B9M9Y6"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Y6"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ACM31557.1"
FT                   /translation="MALLQWNERPAQVLQGGGVIGPDERLPWAQTGLMGIQHVIAMFGA
FT                   TVLAPILMGFDPNVAVLMSGIGTLIFFLITGGKVPSYLGSSFAFIGVVIAATAYAGKGP
FT                   NANIGVALGGIIACGLVYTLVGVVVHLVGTGWIERFMPPVVTGAVVAVIGLNLAGIPIK
FT                   NMAANNFEAWMQALTFVCVALVAVFTSGMLQRLLILVGLIIASLLYALLTNGMGLGKPI
FT                   DVSGIANAAWFGLPQFHTPVFEANALLLIVPVVIILVAENLGHIKAVTAMTGKNLDQYM
FT                   GRAFIGDGVATMVSGAAGGTGVTTYAENIGVMAATRIYSTAVFLVAALLAVLLGFSPKF
FT                   GALIQAIPLPVMGGVSIVVFGLIAIAGAKIWVDNRVDFSQNKNLIVAAITLILGTGEFT
FT                   LKFGDFALGGIGTATFGAIVLYAALNRGK"
FT   gene            complement(76619..77917)
FT                   /locus_tag="Dtpsy_0069"
FT   CDS_pept        complement(76619..77917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0069"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="KEGG: ajs:Ajs_0049 methyl-accepting chemotaxis
FT                   sensory transducer; TIGRFAM: PAS sensor protein; PFAM:
FT                   chemotaxis sensory transducer; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein; chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31558"
FT                   /db_xref="GOA:B9M9Y7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Y7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACM31558.1"
FT                   /translation="MWWQQQRFSAQGRWQAIAEQAAVVEVDVQGVVREVNARFCDLLGY
FT                   QRAELIGQPQTIFYPPEYVASPAFQANWRRLCGGEFVQGTAQRRCKNGTVVWVQGMFYP
FT                   VRDARGRVERIVGLVYDVTATQEQTQRAHAILEAIERSMAVIEFDLQGHVLRANDHFLH
FT                   TMGYTRQNLVGQHHRILCPPAFAQSSDYPRFWDDLRAGVYSKGKIERVDARGRTVWLEA
FT                   TYNPVLDPDGVVSHIVKFATDITARVQQAQAREQGVNTAFAVAQETQQLSEEGTQTIVD
FT                   ATARIQSIAQLFEDTAARVHELGRKTESIAASVQGIRRVADQTNLLALNAAVEAARAGV
FT                   AGRGFAVVAEEVRKLAGDSRTATNDIHQTIQAVLQEMRAMIDHIQGGVAAVEQGAQLSR
FT                   QARDAIERIREDAHKVVDVVQELHALETGKPGR"
FT   gene            complement(78014..79921)
FT                   /locus_tag="Dtpsy_0070"
FT   CDS_pept        complement(78014..79921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0070"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: ajs:Ajs_0050 radical SAM
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31559"
FT                   /db_xref="GOA:B9M9Y8"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Y8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACM31559.1"
FT                   /translation="MPAALPRVLSVIPPMTQLNTPYPSTAYLTGFLRSRGVPAWQEDLA
FT                   IALVLRLLSRDGLAQVAERARALPANAQSPAVQSFLAQQERYLATIGPAMAFLQGRDST
FT                   LAHRIVGRHYLPEGPRFAALDVYEDDGSGDPLGWAFGALGLTDKAKHLATLYLNDLADV
FT                   LQGAVDARFEFVRYAEQLAGSQPTFDPLADALAQAPTFVDEVLQQLTHEAVARHQPGVV
FT                   LLSVPFPGSVYGAFRIAQAIKARHPHIVTVLGGGFVNTELRELADPRVFDFFDYVTLDA
FT                   GERPLLALLEHLQGQRGRQRLVRTFVRNDDGAVQYVHLAEPDVAFAEIGTPTWDGLPLQ
FT                   RYLSLLDMLNPMHRLWSDGRWNKLTVAHGCYWKKCSFCDVNLDYIGRYEGASAQVLADR
FT                   IAAIVAETGQTGFHFVDEAAPPKALKALAQELIARGTGISWWGNVRFEKTFTPELAELL
FT                   ADAGCIAISGGLEVASDRLLGLMKKGVSVDQVARVTRAFSDAGILVHAYLMYGFPTQTV
FT                   QDTVDALEYVRQLFENGCIQSGFFHRFACTVHSPVGQNPEEYGVTLAPLPPGGFAKNDV
FT                   AFIDPTGVDHDALGAGLKKAIYNYMHGIGLEQDVRMWFPFHVPKTTVRPGRIARALAAR
FT                   "
FT   gene            complement(80000..81010)
FT                   /locus_tag="Dtpsy_0071"
FT   CDS_pept        complement(80000..81010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0071"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="KEGG: dac:Daci_1599 diguanylate cyclase with GAF
FT                   sensor; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein; SMART: GGDEF domain
FT                   containing protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31560"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Y9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACM31560.1"
FT                   /translation="MDNLLDHLCETVTRARTVEELTRPLLELLEDITGFESTYLTVVDL
FT                   ERGVQRVLYARNTRQMQIPEGLSVPWHDTLCKRALDEGRPFTADVGQCWGDSQAAAALG
FT                   IQTYASTPVRMADGQLYGTLCAASDERQELTSQARNALTLFARLIGQQVEREELLQQLL
FT                   QANARLAAYAATDALTGLPNRRSLREMLHQQLAQGARQGTAVLIAFMDLDGFKAINDTY
FT                   GHEVGDLFLADMADRLRGAARAQDFVARYGGDEFVAVGPGPAPGPALEAARQGFGQRLA
FT                   QATRGRFGGAGAPIDYAGASVGVIAVLPNGMTADEALREADRAMYAAKKARRAVR"
FT   gene            complement(81098..82363)
FT                   /locus_tag="Dtpsy_0072"
FT   CDS_pept        complement(81098..82363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0072"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase
FT                   FAD-binding; FAD dependent oxidoreductase; KEGG:
FT                   ajs:Ajs_0052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31561"
FT                   /db_xref="GOA:B9M9Z0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Z0"
FT                   /inference="protein motif:TFAM:TIGR01988"
FT                   /protein_id="ACM31561.1"
FT                   /translation="MTTQDVSSQRSDVLIVGAGPAGLSLAASLAQAGMQVTVLEQQPAS
FT                   TLAAPLADGREIALTHPSVATLQRIGSWQRLAAHEVGLLREAQVHDGPVGQRGAMQLHA
FT                   GGSGVQHLGWIVPNHALRRTAYEVAAHTPGVRLVTEARVTRVAVTPAHAELEYTDTRNL
FT                   DAAPLRLQAPLLVAADSRFSATRRQLGIGAAMHDFGRTVIVCRLRHELPHHEVAHECFG
FT                   YEQTLAILPLPGDLVDGAPMCSAVVTTGAAHAQELLALPPEAFAARVQAQFKDRLGAMR
FT                   LVGERHAYPLVAVYAHRFAAARCALLGDAAVGMHPVTAHGFNLGLAGVDSLTRALTQAR
FT                   ERGADIGAASVLEGYARGHHRHAWPLYQGTNAIVRLYTDDRPLPRLLRQVVLAGANRLP
FT                   PLKGAIVSQLTGRRPAWPSAAP"
FT   sig_peptide     complement(82265..82363)
FT                   /locus_tag="Dtpsy_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.826 at
FT                   residue 33"
FT   gene            82536..82775
FT                   /locus_tag="Dtpsy_0073"
FT   CDS_pept        82536..82775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31562"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Z1"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0053"
FT                   /protein_id="ACM31562.1"
FT                   /translation="MRVDIYRRSEAEGRYSHLAVPEGKPIPQEAINTDWNCEHRAVERD
FT                   ETQAHWNDLGIPEPGRQLRDKGYAITSVTEQPRR"
FT   gene            82917..85004
FT                   /locus_tag="Dtpsy_0074"
FT   CDS_pept        82917..85004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0074"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: ajs:Ajs_0054
FT                   acetoacetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31563"
FT                   /db_xref="GOA:B9M9Z2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Z2"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ACM31563.1"
FT                   /translation="METHHNIPPTHPPYTPQIRRYQDWLQAQHGLRFDDYHALWRWSTT
FT                   DLDAFWQSVWDYFDLQSPTPHRAVLAKNVMPGAQWFPGAQVNYARQVLRHVDAAQAAGQ
FT                   PALIGRNERGERRELSWPALRRQVAALALHMRAQGVQPGDRVAAYLPNIPETIVAFLAC
FT                   ASIGAVWSLCAPDMGTHAVLDRFRQIAPTVLLAVDGVTYGGRDHDRCDVLAELRAQLPT
FT                   LRHVVLVSNLDASKTVADTACYASVIARNDAETAAFEPAWLPFDHPLWIVYSSGTTGLP
FT                   KPIVHGHGGMLLVMLQLAVLHNDIGCSYAPNSLGERYHWYSSTGWIMWNAQVGGLLGGT
FT                   TCVLYDGNPGGSKERPDWTVLWRMAAEERVTFFGAGAAFYGHCMKAGITPAACGDLSAI
FT                   RVLGSTGSPLPAEVQRWGSQLLASAGVPQVWWCNISGGTDFAGAFIGGNRELPQTPGRM
FT                   QCRMLGAAVEAWDEQGRPVLDAVGELVCTQPIPSMPLFLWGDADGARYRASYFEMYPPG
FT                   HGRRPGGGDLGPEAGAVWRHGDWIEIGSSAHPGCVIYGRSDATINRHGLRMGTSEIYSA
FT                   VEALPEVLDSLVVDLEYLGRASWMPLFVVLRAGAVLDEALRARIQGAIRSHLSPRFVPD
FT                   EIVQVAEVPRTLSGKKQELPIKKLLLGQPIEKVVNKDAMANPGCLAWYVEFAAWRQAHA
FT                   S"
FT   gene            85204..85517
FT                   /pseudo
FT                   /locus_tag="Dtpsy_0075"
FT   gene            complement(85523..86431)
FT                   /locus_tag="Dtpsy_0076"
FT   CDS_pept        complement(85523..86431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0076"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bav:BAV1031 LysR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31564"
FT                   /db_xref="GOA:B9M9Z3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Z3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACM31564.1"
FT                   /translation="MTLKQLEAFYWAAKLGTFAIAAQRLHVTQSSLSKRIAELESDLGQ
FT                   QLFDRTARRSMLTAAGEKLLDKAAAMLDLEREIRADSGPSRDELQGACRVGITELTATT
FT                   WFPSLVARVERDFPLLTLEPQVGLSRLIENDVVRGELDVAILAGPVNRPELRGRAVADI
FT                   EFIWTSAPVRLPHRTVLQTEHFEAHPVINNPHDSGLSATFESWANTHRIRIGKTIQCNS
FT                   RAAIIALTIAGVGISFQPRRYVQPLLERGLLVPLESAAPLPRQPYNLVWRADDDRRIVE
FT                   AIVALVQEEADFDADNLFWGN"
FT   gene            complement(86480..87709)
FT                   /locus_tag="Dtpsy_0077"
FT   CDS_pept        complement(86480..87709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0077"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: mrd:Mrad2831_3262 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31565"
FT                   /db_xref="GOA:B9M9Z4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Z4"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACM31565.1"
FT                   /translation="MKTDPSSFKNGPLQGVRIIDATTVVLGPYATRILADMGAEVIKIE
FT                   TSSGDQTRHYKPLRHEGMAGYFINLNRNKRSVSLDLKSPEGMEVLKRLLKGANAFIHNM
FT                   RQQAADRLGLGYEAVRALNPDIVYCAAVGFGSAGPYSGRAAYDDVIQAGSGIAGLFAQV
FT                   HGQPMFAPTVLCDKITGHTVAYAVVAALLQQAKGGGGQAVEVPMLETSAEFALVEHLHA
FT                   ATFDPPLGEIGFKRVMSKFRKPYRTRDGFMCILPYSDSNWADFFRFTGRTELLDDERFR
FT                   VLADRVQHIDELYAVVEKEAPRFTNAEWEAFCNRVSIPCMPVRDLEGVLQDEHLQAVGM
FT                   FQPATHPTEGDYRVVRSPVQFAEPFRLRHHAPRLGQDTINVMRDAGYSDAEIDSLVAKG
FT                   AVLAAPPVAE"
FT   gene            complement(87722..88813)
FT                   /locus_tag="Dtpsy_0078"
FT   CDS_pept        complement(87722..88813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0078"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   mrd:Mrad2831_3261 acyl-CoA dehydrogenase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31566"
FT                   /db_xref="GOA:B9M9Z5"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Z5"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACM31566.1"
FT                   /translation="MSERDELTAMVNEQADRQFRELLTPEAMEQTSTGQWLPALWQQME
FT                   DAGWPSALVAEAQGGVGLPSSAAFDVIRLSAHWGVPLPLAETMAGRGLWTAVGGDPDLV
FT                   ADRPVLLGVGAQARAPALRLDGECSLTGETGSVNFGEAPGALLLVQAHMRDDAHALVLL
FT                   DVQKLAPRSVRTLSFEAQCAFSLGSVPVPTDYCQPWDVRDPRALQAVGAVLRSVQMVGA
FT                   MQRCLALGLQYSQERVQFGRPISRFTPVQDMLVEAAAEVSAAVNAASLAVDHWQPAPTP
FT                   DGVFAAAVAKSRCGEAAGKVAAFIHQVHGAMGFTQEHVLHQFTRRLWAWRDEFGTEAYW
FT                   NHQIGTRVCAADGHSLWPLLTAL"
FT   gene            complement(88810..89952)
FT                   /locus_tag="Dtpsy_0079"
FT   CDS_pept        complement(88810..89952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0079"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mrd:Mrad2831_3260 acyl-CoA dehydrogenase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31567"
FT                   /db_xref="GOA:B9M9Z6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Z6"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACM31567.1"
FT                   /translation="MFEFNQPPDLSVCEPTRQRVRAFLAAEVERGSFKPWEVTWTTFDR
FT                   GFSRRAGTAGLIGMTWPRAYGGQDATALERYVVVEEMLAAGAPCGAHWIADRQSGPQIL
FT                   RHGSERAKQDILPRIARGECAFGIGMSEPDSGSDLAAVRTRATRVEGGWRINGTKVWTT
FT                   NAHQVDYLITLVRTAEPGAGKHEGLTQMITATGQPGITVRPIRDLSGHHEFNEVHFEDY
FT                   FVPDDMLIGEPGSGWRMVTAELAYERSGPDRFLSAWQLLAALVDAVGHEPDAQQAVQIG
FT                   RLVAHAATLRRMSTGIAGLLERGANPQVEAALVKHVGTGFEREIPEIARLLVDAGQQSE
FT                   AGQRFADALRHVTLAAPSFTLRGGTREILRGVIARGMGLR"
FT   gene            complement(89962..90762)
FT                   /locus_tag="Dtpsy_0080"
FT   CDS_pept        complement(89962..90762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0080"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   swi:Swit_3272 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31568"
FT                   /db_xref="GOA:B9M9Z7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Z7"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACM31568.1"
FT                   /translation="MSGFLSIDRRDGVVVATMNRPDERNALTEEHQMLEFVELCAQIRR
FT                   DPGVTALVLTGAGSAFSAGGNLKNMRDKKGFSAGSPADIRDAYRNGIQQIPLALYEVDV
FT                   PTIAAVNGPAIGAGLDLACMCDIRLASEQATFASSFVKLGIVPGDGGAWLLARTIGQPK
FT                   AMEMMLTGDTFDAARALALGLVSRVIPPEELMPQALDLAARISANPSRTVRLTKRLLRE
FT                   SDSVSLASSLEMAAAYQALAHYTSDHDEAVRAFLEKRKPVFTGR"
FT   gene            90968..91948
FT                   /locus_tag="Dtpsy_0081"
FT   CDS_pept        90968..91948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   atc:AGR_pAT_473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31569"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Z8"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31569.1"
FT                   /translation="MFRTSIHRSILAAAAALLAGLAATPAHAAWPSDAPINITVGFAAG
FT                   GTTDVMVRNLAPFIAKHLGDNASFVIQNRPGASGEIAINSVMRAKPDGYSLVVVNLPGY
FT                   FFVPMYRKSSYTTKDLTLVARLVGDPTIMVTRKDSKLIDLRQVVSQLKTDPSSYSAGHN
FT                   GLGTNGHLAMAQLENAASVKFNSIPFNGSAQQKAALTTSTLDIAFLAASEVPDPENEAT
FT                   PVRLLAQFTKDKVQRIASTPTTFEVGFPVEMTAERGIAAPNGVPAAIRARLEKAIEAAL
FT                   KDPEYVKTARNDAPFLSFLGGAEWAKAVEQAQKAYEPIARTLPKE"
FT   sig_peptide     90968..91054
FT                   /locus_tag="Dtpsy_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            92017..92358
FT                   /pseudo
FT                   /locus_tag="Dtpsy_0082"
FT   gene            92416..93039
FT                   /locus_tag="Dtpsy_0083"
FT   CDS_pept        92416..93039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0083"
FT                   /product="CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase"
FT                   /note="TIGRFAM: CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: ajs:Ajs_0064
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31570"
FT                   /db_xref="GOA:B9M9Z9"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:B9M9Z9"
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /protein_id="ACM31570.1"
FT                   /translation="MASPHKRFSMIREFHLADWFTLGNAVCGVGALFSSMTYLETSDVR
FT                   HVYFACALVLAALVFDVLDGRIARWRQKSSAMGRELDSLADVISFGVAPAIIAYACGMQ
FT                   GLYDRVVLAFFVACGVSRLARFNITAETLAEGPSGKVKYFEGTPIPTSIVLVGLMAVAA
FT                   SVGAVRGQLWLGSVTIGGFTLHPLVLLFALSGSLMISRIRIPKF"
FT   gene            93269..94036
FT                   /locus_tag="Dtpsy_0084"
FT   CDS_pept        93269..94036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0084"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: ajs:Ajs_0065 septum
FT                   site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31571"
FT                   /db_xref="GOA:B9MA00"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA00"
FT                   /inference="protein motif:TFAM:TIGR01222"
FT                   /protein_id="ACM31571.1"
FT                   /translation="MAVDTAGQARTHLDLKSAQLPVVAMVLKTTDVASIAAELAARRAD
FT                   DPEFFDNDPVLIDLSAVQDEPQPIDFAALVKTLRSHRTQPVAVRGGSSAQRQDAHDAGL
FT                   IAAPDAPPPRMQAPRENTPREVVHEVIREVEVVREVPVPAPAPGTVVVDKPLRSGQQVY
FT                   ARGSDLVVMAVVSFGAEVIADGNIHVYAPLRGRAIAGARGDTSARIFSTCMEPQLVSVA
FT                   GIYRTTETELPDNVRGKPAQVRLDGEKLLIEPL"
FT   gene            94090..94905
FT                   /locus_tag="Dtpsy_0085"
FT   CDS_pept        94090..94905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0085"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: ajs:Ajs_0066
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31572"
FT                   /db_xref="GOA:B9MA01"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA01"
FT                   /inference="protein motif:TFAM:TIGR01968"
FT                   /protein_id="ACM31572.1"
FT                   /translation="MAKIVVVTSGKGGVGKTTTSAAFASGLALAGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEANLNQALIKDKQCENLFVLAASQTRDKDALTQDGVGK
FT                   VLKDLADMGFDYIVCDSPAGIESGALMAMHFADEALLVTNPEVSSVRDSDRILGMLSSK
FT                   TKRAIEGGEPVKEHLLITRYNPHRVEDGQMLSLEDIQDILRIKLIGVIPESESVLQASN
FT                   QGLPAIHLSGTDVSEAYKDVVARFLGEDKPLRFIEAAKPGFFKRIFGGR"
FT   gene            94911..95177
FT                   /locus_tag="Dtpsy_0086"
FT   CDS_pept        94911..95177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0086"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: ajs:Ajs_0067 cell division topological
FT                   specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31573"
FT                   /db_xref="GOA:B9MA02"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MA02"
FT                   /inference="protein motif:TFAM:TIGR01215"
FT                   /protein_id="ACM31573.1"
FT                   /translation="MSLLSFLLGEKKKTASVAKERLQIILAHERSGRSAGQPDYLPALQ
FT                   RELVAVISKYVKINADDLKVHFERQDDLEVLEVKIELPEATAK"
FT   gene            complement(95254..95814)
FT                   /locus_tag="Dtpsy_0087"
FT   CDS_pept        complement(95254..95814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0087"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: ajs:Ajs_0068 flavin reductase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31574"
FT                   /db_xref="GOA:B9MA03"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA03"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACM31574.1"
FT                   /translation="MNSRLPHPPSSQPPVFTPREFRDALGMFATGVTIVTARGEGGALI
FT                   GMTANSFNSVSLEPPLVLWSLGHKTSSLPAFSRATHYAINVLTVEQRALAEQFATRGID
FT                   RFAGVAYRLGRSGVPVLDGAAAVFECFNRSQYVEGDHTIFVGQVERCSHREGASPLLYH
FT                   GGVFYTEHPLGSLSATVARPMEK"
FT   gene            95923..96705
FT                   /locus_tag="Dtpsy_0088"
FT   CDS_pept        95923..96705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0088"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ajs:Ajs_0069
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31575"
FT                   /db_xref="GOA:B9MA04"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA04"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACM31575.1"
FT                   /translation="MSLLPRFSLLGSGPTVLLLHDADGDHLGFAPTLETLAAAGYRAVA
FT                   WDMPGYGGSAPVEPYNFKGLAQRALLLLDALRCEQVVLVGHGLGAMLALEIAVRAPLRV
FT                   RRLVLCAGGPALDEAATAVWVAPRLAGLDDGRDMARLADPTVARDAGPGALPEGLQLAR
FT                   HAMGRVPPATYRRALEALTAFARRAPELVRLQVPALLVGGEYDRCTPPEALLALAHVLP
FT                   DARAVLLPGVGHWPQLEDPEGFEAALLDFLAGPAPVLH"
FT   gene            96844..98034
FT                   /locus_tag="Dtpsy_0089"
FT   CDS_pept        96844..98034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0089"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   ajs:Ajs_0070 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31576"
FT                   /db_xref="GOA:B9MA05"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA05"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACM31576.1"
FT                   /translation="MMAMRPRHWAGALALWALAGMAGAQPVKVGVIGPFSGPSSDFGTP
FT                   MLQGIQLAVEQFNAVGGYLGRPVELVVKDDQGSPDTGRQRSQELAKEGVVAALGFCNTG
FT                   VAMKSLDVFQQAKLPLIVPCATGTPVTRTYPAAQSFIFRTSAPDNIQAPFVVEDILRRG
FT                   WTRVALFADDTGYGQAGRKDVEAALAAHQLTPVYATNFPLGVKSLAPQLQAARDAGAQV
FT                   IFSYTVGPENAVIAQGRKELGWKVPQVGGWTLSFPFFIQGGKDAAEGALTAQTFIAEPS
FT                   NERRASFLSTYARAFKGRPAVPMAAAQGYDAAYLLMYALLGIRDGQVNGPALKHSLENL
FT                   QRVYYGVVATYERPFSAEEKEAITPNMLVMGKVQAGAVTFAYPEDAKRNLLVQRKR"
FT   sig_peptide     96844..96918
FT                   /locus_tag="Dtpsy_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 25"
FT   gene            complement(98047..99387)
FT                   /locus_tag="Dtpsy_0090"
FT   CDS_pept        complement(98047..99387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0090"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ajs:Ajs_0071 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31577"
FT                   /db_xref="GOA:B9MA06"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA06"
FT                   /inference="protein motif:PRIAM:1.4.99.1"
FT                   /protein_id="ACM31577.1"
FT                   /translation="MKTIVLGAGIIGISTAWHLRERGHEVTVVDRQPDAALETSFANAA
FT                   QISVSYCEPWANREAPWKALKWMFDKEAPLLFRPQLDWEQWRWCLKFLAQCNDTAFARN
FT                   VQQIVALGAYSHAALKDIVRATGIEYHRLERGIAHFYTDQKSFDDAAHAVELMRRFGVQ
FT                   RRVVSRDELLAIEPAFHAYGDRITGGTYTSTDESGDARVFTQALARRCAERGVQFLYGH
FT                   DVLRLNRSGDAIESIAIRARQESATGQKDQILKADAVVVACGSYSAPLLRGVGVHLPIY
FT                   PGKGYSATFPLLKPEGAPMVSTIDDGKKIAMSRLGNVLRVAGTIELGGYDLSLDSPVAR
FT                   ARCHMLSRRIETILPGVCDTRTPEEGGDPQYWTGLRPATPTNIPFIGRTPLHGLWVNAG
FT                   HGTLGWTHGAGSGKAMAELLSGERPAMDFAFLGDDTPAAAYGAPRLA"
FT   gene            99475..100386
FT                   /locus_tag="Dtpsy_0091"
FT   CDS_pept        99475..100386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0091"
FT                   /product="transcriptional regulator, ArgP, LysR family"
FT                   /note="TIGRFAM: transcriptional regulator, ArgP family;
FT                   PFAM: regulatory protein LysR; LysR substrate-binding;
FT                   KEGG: ajs:Ajs_0072 chromosome replication initiation
FT                   inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31578"
FT                   /db_xref="GOA:B9MA07"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA07"
FT                   /inference="protein motif:TFAM:TIGR03298"
FT                   /protein_id="ACM31578.1"
FT                   /translation="MSTFDPAALECLAAIVEEGGFERAARRLNITQSAVSQRLRALEAQ
FT                   VGSVLIVRSRPLKPTSAGQLLLKHTKQLRLLRADLERDLQDLMPSGRGGGREEERIAIA
FT                   INADSIATWAVDALGDLVRQRLPLEIIADDQDFTQEWLRSGQVMGCVTTLKSALRGCRM
FT                   VPLGAMQYVAVAAPELARRQLPQGLTAHNFRDVPFVSFNRKDDMQAEFVTRTFGLKRVS
FT                   LSRVFVPSSEGQVRAVAAGWGVSVVPELLARPWLQQGRLVDLAPGHTLPIQLYWHSWNL
FT                   ESEVLDALADALTSAAAQYLSA"
FT   gene            100457..101089
FT                   /locus_tag="Dtpsy_0092"
FT   CDS_pept        100457..101089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0092"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ajs:Ajs_0073
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31579"
FT                   /db_xref="GOA:B9MA08"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA08"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACM31579.1"
FT                   /translation="MNTLQPPRPSFKEQMLRAREDAIVEAASRLLGEKGFETMTVDEVA
FT                   AAVGIAKASLYKHFAGKDDLCSAAMVHVVERLQRFLAALPAELGAMQRLHALLCWTLQL
FT                   QLADEVPLLPSRNSALAQALRACDAYQASMQEVHACILGWIVEAQAQGQLRRELPPDVI
FT                   LCALLARNSDPMLGMLRDRGYADECIIDWAADTCLSGLASGPAMRAA"
FT   gene            complement(101090..101512)
FT                   /locus_tag="Dtpsy_0093"
FT   CDS_pept        complement(101090..101512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0093"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: ajs:Ajs_0074 UspA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31580"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA09"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACM31580.1"
FT                   /translation="MNILLAVDGSTYTKKMLAYLAAHDEMLGSSHTYTAITVQPQLPPR
FT                   ARAALGKEVVDKYHAEEGEKVLSPVVKFMARQGVQLKTMTKVGPAGETIAKVAESGKYD
FT                   LVVMGTHGHGSLGKLVMGSVSTQVLANCQVPVLLVR"
FT   gene            complement(101625..102470)
FT                   /locus_tag="Dtpsy_0094"
FT   CDS_pept        complement(101625..102470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0094"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ajs:Ajs_0075
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31581"
FT                   /db_xref="GOA:B9MA10"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA10"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACM31581.1"
FT                   /translation="MKLQLLSDLHLEAHPHFTPSPAVGADVLVLAGDIGSYQAGSLLSD
FT                   DDFGLARFSPLPQYAGWPTPVVFVPGNHEYDMQDFDAAHARLRRICDRLGLIWLERESM
FT                   VLQGVRFVGTTLWSDFDALADHAGITDPGQRLQRREKAFRAANFYLSKTGSTRQGVPFL
FT                   AAEVREQALVCQAWLRNALAQPFAGTTVAVTHFAPSLLSADPRYGLVPGTAGFCNALDD
FT                   CLPHAQLWLHGHLHAPSDYLVRGARADGAPWSCRIVANPLGYARKGEQATFQPHCVLTV
FT                   "
FT   gene            complement(102487..103458)
FT                   /locus_tag="Dtpsy_0095"
FT   CDS_pept        complement(102487..103458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0095"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ajs:Ajs_0076 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31582"
FT                   /db_xref="GOA:B9MA11"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA11"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACM31582.1"
FT                   /translation="MQPLNFRTLDLNLLRVFDEVMAERNLTRAAEKLAITQPAVSNALR
FT                   RLREVLGDELVTRRGHGVEPTPRALALWPAVRHALAQLQETLSPGRFDPASAQTTFVLA
FT                   MADATGATLIPPLIEIVEREAPGVSLRVVPLTTRDPRRLLDDESADMAVGYFPSVLADL
FT                   TARAQSDNVVAHESTRLYDGQYVCVMRADHPLAAVPMTLDLYCAARHLLVSFSGKPFGF
FT                   IDGALAALGRERRIVLTVNQFFTAGRVVATTDLLTVLPRHFVGVASVRDELVWRPLPMT
FT                   LPPVHVDALWHRRRNHDPAHRWLREAIARAARNTPAPIHRQD"
FT   gene            103582..104022
FT                   /locus_tag="Dtpsy_0096"
FT   CDS_pept        103582..104022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31583"
FT                   /db_xref="GOA:B9MA12"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA12"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0077"
FT                   /protein_id="ACM31583.1"
FT                   /translation="MTKFVHIDVPVQHHGIARIEEAASHLKQTVARFDGTRGATSLLLA
FT                   ALVAALLVVANQVMDTWNDGHMLAGWMVMWVIAFAGMALLAAPARSAVLGLRAAAKAWS
FT                   DAHRRAAEDERTWNAALRDARIMADLSRAMNGIAVDDLRRYR"
FT   gene            complement(104202..106073)
FT                   /locus_tag="Dtpsy_0097"
FT   CDS_pept        complement(104202..106073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0097"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   ajs:Ajs_0078 phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31584"
FT                   /db_xref="GOA:B9MA13"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA13"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ACM31584.1"
FT                   /translation="MNAPTMPVLDIQAPAYVKNAKLIAWVAEMAALCKPARIHWCDGSQ
FT                   QEYEQLCQQLVDAGTFKKLNPAKRPGSYLAWSDPSDVARVEDRTYICSEKKEDAGPTNN
FT                   WMAPAEMRATLQPLFDGCMAGRTMYVVPFSMGPLGSHIAHIGIELTDSAYVAVNQKLMT
FT                   RMGKAVYDVLGTDGEFVPCMHTVGAPLAAGQKDTTSWPCNPQVKYIVHYPETREIWSYG
FT                   SGYGGNALLGKKCLALRIASTMGRDQGWLAEHMLILGVTNPEGKKYHVAAAFPSACGKT
FT                   NFSMLVPPEAGFAGWKVTTIGDDIAWIKPHADGKMYAINPEAGYFGVAPGTNMHTNPNC
FT                   MRSLDKDVIFTNVALTDDGDVWWEGMEKDTGKLPDHLIDWQGKDWTPQIAKETGAKAAH
FT                   PNSRFTVAATNNPALDPEWDNPAGVAIDAFIFGGRRSTTVPLVTEARSWMEGVYMAATM
FT                   GSETTAAAFGAQGVVRRDPFAMLPFCGYNMSDYFQHWLDMEHKLEESGHQLPKIFCVNW
FT                   FRKGEDGKFVWPGYGDNMRVLKWMLDRIEGTAQGEPTMFGIAPQYAEINWTGLDFSTEQ
FT                   FKMVTSIDKAAWAEELKLHTEHFDKLAYHLPQELLATKAALEKRLAA"
FT   gene            complement(106408..106569)
FT                   /locus_tag="Dtpsy_0098"
FT   CDS_pept        complement(106408..106569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31585"
FT                   /db_xref="GOA:B9MAD8"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAD8"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0079"
FT                   /protein_id="ACM31585.1"
FT                   /translation="MAHDHPIAPNAADVEAATATDAAESVVHLIPVVIPAVGAAMIFLL
FT                   AFIAVYMA"
FT   gene            complement(106677..107876)
FT                   /locus_tag="Dtpsy_0099"
FT   CDS_pept        complement(106677..107876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0099"
FT                   /product="threonine dehydratase"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein; KEGG: ajs:Ajs_0080
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31586"
FT                   /db_xref="GOA:B9MAD9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAD9"
FT                   /inference="protein motif:TFAM:TIGR01127"
FT                   /protein_id="ACM31586.1"
FT                   /translation="MLTFQDIQHAAERLRGQVLETPCVESRTLSQIVGAQVFLKFENLQ
FT                   FTASFKERGACNKLSQLTPQERERGVVAMSAGNHAQGVAYHAQRLGLRAVIVMPRFTPG
FT                   VKVERTRGFGAEVVLHGDTLEEARQHAYQLAEQQGLTFVHPYDDEAVAAGQGTLVLEML
FT                   AAQPDLDALVVSVGGGGLLAGMATAARAIKPNLEIIGVQTARFPAMVNAIKGTHHAQGA
FT                   STIAEGIAVGQPGKMTQEVIGRLVDDLLLVDEGDIEQAVLMLLEIEKTLVEGAGAAGLA
FT                   ALVRHPERFRGKKVGLVLSGGNIDPLLLAAIIERGMVRSGRLARIMVSARDVPGVLARI
FT                   TALVAEAGANIEEVHHQRAFTVLAAQNVEIELVLQTRGKAHIQQVLDLLRAAQMEAELR
FT                   "
FT   gene            complement(107988..109643)
FT                   /locus_tag="Dtpsy_0100"
FT   CDS_pept        complement(107988..109643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0100"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ajs:Ajs_0081
FT                   acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31587"
FT                   /db_xref="GOA:B9MAE0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAE0"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACM31587.1"
FT                   /translation="MDWTTHQVFNQYPELNDYHPLATDAALCEAVERAGADWARPALDT
FT                   YAARLGMAETYALAEQANRHTPQLQRFDTRGRRIDALEFHPAWHQLMALYRGEGLISRP
FT                   FQDERPGRWAAWAAGFYLHGQVEQGTLCPATMTQAAIPLLRKEPALWQSLQSRLYSTVY
FT                   DPRDLPVADKASIWLGMGMTEKQGGSDVRANTTVAAPIGTGGRGGEYRLRGHKWFFSAP
FT                   QCDAHLVVARTGEGGPFACFYVPRWRPDGSRNAVRVQRLKDKVGNRSNASSEVEFEDAW
FT                   GLLMGEEGRGIPTIIEMASYTRLNCVVGSAAILRQATVQAIHYAHRRHAFGKALAEQPL
FT                   MRAVLADLALESEAALHLAMRLAQAYEDDDAPAQRAWKRVMTPAAKFWVCKRAVELTGE
FT                   AMEVLGGNGYVEDGVMARLFREAPVNSIWEGSGNVMCLDVLRALQREPEAAHALLTELH
FT                   AAAQGEPRIAAAARELQALLATPAEQLEGLGRVLTQRLVLLAQACLLRQQAPAAVADAF
FT                   IATRLADSGAGRVAGAIDTRGLDVAAVLARAFPG"
FT   gene            complement(109796..110458)
FT                   /locus_tag="Dtpsy_0101"
FT   CDS_pept        complement(109796..110458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31588"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAE1"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0082"
FT                   /protein_id="ACM31588.1"
FT                   /translation="MQPSPRTSFPATPRRATATLALCVAACLAVTGCATPPPPPVAPDP
FT                   ALDARARYDADLQDCRDRAQQVGVLSETLDAVVQGALVAAFLAWGLGRSDTGVRDWALT
FT                   GGALAGGSQGLQALERRRQLVAHCMAVRGHRISPLAVAGPQPGAAPSVPVAPAAPPRPS
FT                   GADAYSAERLAREQACHAQPVAALAAKGPGFETYSVPCSNGDALAIRCEFGNCRVLR"
FT   sig_peptide     complement(110354..110458)
FT                   /locus_tag="Dtpsy_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.731 at
FT                   residue 35"
FT   gene            complement(110506..111540)
FT                   /locus_tag="Dtpsy_0102"
FT   CDS_pept        complement(110506..111540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0102"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   ajs:Ajs_0083 methionine synthase (B12-dependent)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31589"
FT                   /db_xref="GOA:B9MAE2"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAE2"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ACM31589.1"
FT                   /translation="MTLPHYTRAQALPAILEQRIAILDGAMGTMIQRFKLTEAQYRGER
FT                   FKDFARDVKGNNELLSLTRPDVIRDIHEGYLAAGADLIETNTFGATSIAQDDYGLAELA
FT                   YEMNLESAKLARAACDKFSTPDKPRFVAGALGPTPKTASISPDVNDPGARNITFEQLRA
FT                   AYHEQARGLIEGGADVLLVETIFDTLNAKAALFAIDEVFEETGECLPIMISGTVTDASG
FT                   RILSGQTVTAFWHSVRHARPLSIGLNCALGAALMRPYIQELNRAAPDTFISCYPNAGLP
FT                   NPMSDTGFDETPEVTSRLVHEFAAEGLVNIVGGCCGTTPDHIGAIARAVAPVGTRRLFQ
FT                   TEAA"
FT   gene            111704..113575
FT                   /locus_tag="Dtpsy_0103"
FT   CDS_pept        111704..113575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0103"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: ajs:Ajs_0084 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   helicase domain protein; HRDC domain protein; DEAD-like
FT                   helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31590"
FT                   /db_xref="GOA:B9MAE3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAE3"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ACM31590.1"
FT                   /translation="MSPAHFVLHDVFGYEQFRGPQQAIIDHVIAGGDALVLMPTGGGKS
FT                   LCYQVPAIVRRDAGLGVTVVVSPLIALMHDQVGALHEAGVEAAFLNSTLDWQQTQDVER
FT                   RLARGEITLLYAAPERVTTDRFLTLLDGLHARGQLGLFAIDEAHCVSQWGHDFRPEYRQ
FT                   LAVLHERYAGVPRIALTATADALTREDIVQGLRLQQARQFVSSFDRPNIRYRIEEKKEP
FT                   LTQLMRFIDREHLGEAGVVYCQSRKRVEELAQALCDAGLTALPYHAGLPAEVRQQNQDR
FT                   FLREDGIVMVATIAFGMGIDKPDVRFVAHVDMPKNIEGYYQETGRAGRDGLPADAWMAY
FT                   GLQDVVNQRRMIDESPAGEEFKAVMRGKLDALLALAEATDCRRVRLLGYFGEASEPCGN
FT                   CDNCLNPPAVWDGTDAARKLLSTIYRVHEASGLTFGTGHIMDILRGKATDKVQQFGHEK
FT                   LSTFGLGAQYSEAQLRGVLRQLLAAGAVGLHKVTTEGGHSFDTLALTEGSRPVLRGEQS
FT                   VLLREATAAAGPKKPRRASAPPVAAANLGQDAQVRFINLKAWRAEVAREHNLPAYVIFH
FT                   DATLAAIAERNPATLEDLQGISGMGAKKLEAYGAEVLRVCGAGAAAG"
FT   gene            complement(113493..114263)
FT                   /locus_tag="Dtpsy_0104"
FT   CDS_pept        complement(113493..114263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0104"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; PFAM: Radical SAM domain
FT                   protein; KEGG: ajs:Ajs_0085 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31591"
FT                   /db_xref="GOA:B9MAE4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAE4"
FT                   /inference="protein motif:TFAM:TIGR02495"
FT                   /protein_id="ACM31591.1"
FT                   /translation="MPARTSHTAAQALRIGGITPLTTIDFPGRLAAVVFCQGCPWRCGY
FT                   CHNAGLLDAAAPAPHRWSEVEQLLHTRRGLLDGVVFSGGEPTLQAALPDALARVRALGF
FT                   ATGLHTAGMYPERLQALLPLLDWVGLDIKGPLAHYDAITRTPGSGDRAWESLRCVQASG
FT                   VNYECRTTWHAGLFDTAALRALAEDLAAQGVRQWVLQECSTPASVPWCRTAPPHAVAAA
FT                   HQPAVRLISRPRPRRRTPAALRRRTPPAFSHPCR"
FT   gene            complement(114253..114444)
FT                   /locus_tag="Dtpsy_0105"
FT   CDS_pept        complement(114253..114444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31592"
FT                   /db_xref="GOA:B9MAE5"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAE5"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0086"
FT                   /protein_id="ACM31592.1"
FT                   /translation="MTHFSATENTALATAVQLTDAERQPCEVWTRVMGYHRPVASFNTG
FT                   KQGEHNERQFFAEPGRAC"
FT   gene            complement(114535..116562)
FT                   /locus_tag="Dtpsy_0106"
FT   CDS_pept        complement(114535..116562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0106"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; PFAM: ATP-cone domain protein; KEGG:
FT                   ajs:Ajs_0087 anaerobic ribonucleoside triphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31593"
FT                   /db_xref="GOA:B9MAE6"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAE6"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ACM31593.1"
FT                   /translation="MTPPSPIVASLPRDVIQRNGERTPFDAVRIQSAIARAGQATGEFG
FT                   EDEARLLTAQATKVLIHRFHGEAPAIEQIQDVVEQTLIAANHLQTARAYMAYRQRHATL
FT                   RADRQTLVHVESSINEYLTRADWRVNANANQGYSLGGLILNVAGKVTANYWLSHVYAPE
FT                   IGEAHRNGDIHIHDLDMLSGYCAGWSLRTLLHEGLNGVPGKVEAGPPKHMSSAVGQIVN
FT                   FLGTLQNEWAGAQAFSSFDTYMAPFVRKDGMDYAAVRQCIQELVYNLNVPSRWGTQTPF
FT                   TNLTFDWTCPEDLREQVPVIGGVEMPFCYGELQAEMDVINRAYIDVMTTGDAKGRVFTF
FT                   PIPTYNITPDFPWESENAVALFDMTAKYGLPYFQNFINSELSPNMVRSMCCRLQLDLRE
FT                   LLKRGNGLFGSAEQTGSLGVVTVNCARLGYLHAGDEASLFAALDRLLELGKQSLEVKRK
FT                   LIQRLMDQGLFPYTKRYLGTLRNHFSTLGVNGINEMVRNFTHDAHDITSDWGHQFALRL
FT                   LDHVRARMTAFQEETGHLYNLEATPAEGTTYRFAKEDKKRWPAILQAGTAEQPYYTNSS
FT                   QLPVGFTDDPFEALQRQEALQGKYTGGTVLHLYMGERISSGAACRELVKRALTHFRLPY
FT                   ITVTPTFSICPTHGYLAGEHPFCPRCDEERLAAKRARLAA"
FT   gene            complement(116857..120187)
FT                   /pseudo
FT                   /locus_tag="Dtpsy_0107"
FT   gene            complement(120465..120890)
FT                   /locus_tag="Dtpsy_0108"
FT   CDS_pept        complement(120465..120890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0108"
FT                   /product="hemerythrin HHE cation binding domain-containing
FT                   protein"
FT                   /note="KEGG: ajs:Ajs_0091 hemerythrin HHE cation binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31594"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAE7"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0091"
FT                   /protein_id="ACM31594.1"
FT                   /translation="MNIDRFKHEHRDILGQIATLRQLAHSGGEHNATAIAQGIVAMSST
FT                   IKLHLAVEDRLLYPALRQGADAELARLGEQFQREMGAIAAAYMDFARRWNTPERVRTDA
FT                   EGFRADANTVLRHVYERMQRENRDFYPRIEAEEALAH"
FT   gene            complement(120965..123271)
FT                   /locus_tag="Dtpsy_0109"
FT   CDS_pept        complement(120965..123271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0109"
FT                   /product="nitric oxide reductase large subunit"
FT                   /note="KEGG: ajs:Ajs_0092 nitric oxide reductase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31595"
FT                   /db_xref="GOA:B9MAE8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAE8"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0092"
FT                   /protein_id="ACM31595.1"
FT                   /translation="MGKYAKYWYTLIGVLIVTFSLLGFYGAEVYRTAPPIPGQVLVQGS
FT                   DKPLYTKDGILDGQTAWQSVGGMQLGSILGHGAYQAPDWTADWLHRELTAWLELAAQKD
FT                   HGKAFADLDVGQQAVLRDRLKTEYRTNTYDKAKDTMVISPLRAEAIAMTAQYYDKLFSN
FT                   DPSLQKTRESYAMKENTLPSAERRAQMAGFFFWTSWAASTERPADNGGTGATYTNNWPH
FT                   EPLVGNQPTGENLVWSVMSVVVMMAGVGFLVWGWAFLRKHDEQDPTPPQHDPLSRVALT
FT                   PSQRALGKYLFLVVALFTAQVLLGGFTAHYTVEGQTFYGVEISQYLPYSLVRTWHLQAA
FT                   LFWIATGFLAAGLFLAPVINGGKDPKYQKLGVDVLFWALVVVCVGSFIGNYFAIAQIMP
FT                   AEWNFWLGHQGYEYVDLGRLWQIGKFAGIAFWLVLMARAIFPALLAPNGQDKNLLALLT
FT                   SSVVCIGLFYGTGLFYGERTHISVMEYWRWWVVHLWVEGFFEVFATTALAFIFSTLGLV
FT                   SYRMATAASLASASLFMLGGVPGTFHHLYFSGTTTPVMAVGASFSALEVVPLVVLGHEA
FT                   WEHWSLQHKATWMKNLKWPLMCFVAVAFWNMLGAGVFGFMINPPISLYYIQGLNTTPVH
FT                   AHAALFGVYGFLALGFTLLVLRYVRPQMVFNERLMKTGFWWLNAGLVLMIATSLLPIGL
FT                   FQFHASVAHGTWYARSEEFLQQPFLETLRWVRTFGDLVFITGALCVTWQVVSGVLFAPR
FT                   APAAPSTGALAGANR"
FT   gene            123545..125155
FT                   /locus_tag="Dtpsy_0110"
FT   CDS_pept        123545..125155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0110"
FT                   /product="transcriptional regulator, NifA subfamily, Fis
FT                   Family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: GAF domain
FT                   protein; AAA ATPase; KEGG: ajs:Ajs_0093 anaerobic nitric
FT                   oxide reductase transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31596"
FT                   /db_xref="GOA:B9MAE9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAE9"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACM31596.1"
FT                   /translation="MTIVEASPAAATSALLLCADLGAELPQAVRLQRLVDLLRTQFGCG
FT                   AVALLRLEEERLRPVAVTGLVSDALGRRFAVGQHPRLAAILTRREVTCFEHDSQLPDPY
FT                   DGLLDTLVGEPLPVHDCMGVALHVEGRPWGVLTLDALATGTFGPAARQRLGQWVPLVEA
FT                   VVRVARLEQELRTLRMAATGPAEGDLALATPERGGAGELEIVGESPALKRLLHELSVVA
FT                   ASELPVLLLGETGVGKELFARLLHHQSPRRARPLVHVNCAALPESLAESELFGHVRGAF
FT                   SGAVSDRAGRFEAAEGGTLFLDEVGELPLSVQAKLLRTLQNGEIQRLGADRPRSVHVRV
FT                   IAATNRNLREQVASGAFRADLYHRLSVYPVPIPPLRERGNDVLVLAGRFLELNRARLGL
FT                   RSLRLSPDAQAALRRYRWPGNVRELEHVISRAALKALSRGVDRNEIVTLEAGLLDLDAL
FT                   DEPVATPRSDAPMAPAAGGALSLAAPTGTLRDAVDACQRQVLNAALVAHGGNWAQAART
FT                   LDVDPSNLHKLARRLGLKG"
FT   sig_peptide     123545..123616
FT                   /locus_tag="Dtpsy_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.620) with cleavage site probability 0.355 at
FT                   residue 24"
FT   gene            125300..126349
FT                   /locus_tag="Dtpsy_0111"
FT   CDS_pept        125300..126349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31597"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAF0"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0094"
FT                   /protein_id="ACM31597.1"
FT                   /translation="MASSIDPPRPPLAPAVRVLAEAALQRQNWLLAAPAAPTPAGAAPA
FT                   GSAPTDAPPVTFSPNLLPPALPPMPAVQAGRERVSLSDQARQGLQAMAGGAVAPSRAPA
FT                   ASHGPAALSADAVADEGAFARAAAIPAPWPAQGVGAPLLRLLNTLVQQLGPAGGAAPRV
FT                   LAAQPWPAGTDPAAGGTGLPALQIARVAQGMVYTPDGARGFTLTLRLPAAAMPALPSAP
FT                   TAPAALSVGFAGPPQTLAPGLFALVLQGPGAAGQRTSGWLSLDLAPAPGAAAVVYGRDP
FT                   LQARTDPWLALAALQASGQSRVQEHDRAAEPPCSAPGCPYEGRAPCVQPFCLALRVQPA
FT                   PLAAPTGPG"
FT   gene            126432..127820
FT                   /locus_tag="Dtpsy_0112"
FT   CDS_pept        126432..127820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0112"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: ajs:Ajs_0095 L-serine ammonia-lyase; TIGRFAM:
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31598"
FT                   /db_xref="GOA:B9MAF1"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAF1"
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /protein_id="ACM31598.1"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAARLFAQRLAREGVLAQVAR
FT                   VRSTLYGSLGATGRGHASDRAVLLGLAGHAPDTVEVDAIEPLIARIRSRRRLPLADGPE
FT                   VAFAEAADLLLVPDVTLPLHANGMRFEAFDAAGGTLAAQVYYSVGGGFIVSEEAAADAQ
FT                   RQAAIAPDTEVLPLPFHSGEQLLAQAAAQGGSIAQVMRLNERHWRTDAEIDAGLLAIWR
FT                   AMQDCVARGCSVGGVLPGGFQVRRRAPALHQALQNAPDTQQDPLQVIDWVNLFALAVNE
FT                   ENAAGGRVVTAPTNGAAGIVPAVLHYYWRFIPGATEAGVVDFLLTAGAIGILYKENASI
FT                   SGAEVGCQGEVGVACSMAAAGLCAVLGGTPAQVENAAEIGMEHHLGLTCDPVGGLVQIP
FT                   CIERNALASVKAINAARMALHGDGTHHVSLDQVIKTMRETGADMMTKYKETSRGGLAVN
FT                   IVEC"
FT   gene            127879..129087
FT                   /locus_tag="Dtpsy_0113"
FT   CDS_pept        127879..129087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0113"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ajs:Ajs_0096 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31599"
FT                   /db_xref="GOA:B9MAF2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAF2"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACM31599.1"
FT                   /translation="MHNPASPTDTLLPALARPAIQSLGGSLIREVANTGMGRADVLPFW
FT                   FGESDQPTPQFIRDAAAQSLGSGETFYSQNLGRPYLREAIAQYLSDLHGREVSAQRIGA
FT                   VASGDAGLMLTCQMLLSPGDRVVAVTPLWPNLLEMPRILGAQVERVPLAVRGGRWTLAL
FT                   DRLLDALTPGTRMLILNSPNNPTGWTIDEESLVAILAHCRRHGIWILSDDVYERLVYDP
FT                   QLASAPSFLRHYAPGDRIISVNSCSKAWCMTGWRAGWMVVPEALEADLGKVIEYNFSCI
FT                   FEPVQRAATVALQQGEAHVAQLRAGLVESRRLLVQALRAVPGVEVPDAGGAMYVFFRLA
FT                   GFDDSLALAKHLVSEVGLGLAPGAAFGPEGEGWLRWCHAVSDGARLREGVERLARFVQR
FT                   ATA"
FT   gene            129266..130216
FT                   /locus_tag="Dtpsy_0114"
FT   CDS_pept        129266..130216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31600"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAF3"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31600.1"
FT                   /translation="MPLRRHLLALCLTALPLATWAAWPERPITIVVPAAAGGTTDIAAR
FT                   VLAEKMAKDLGTSIVVENKGGGGGSIGTAQVARAKPDGYTLLMGNIGPVAINFSLYKQL
FT                   SYKESDLRGITNVISVPNILVVHADSPVRSAQELVSLAKTRRLNVSTSGVGQSPHMSSE
FT                   MFRQKSGIEVTLVPYPGAAPAVTALLGQQVDFMIDNLPSSMPHIKAGKFRALAITSAER
FT                   SAQLPDVPTMAEAGVPMQVTAWFGLLAPTGTPDAVVERLQQSARKAMQTPEVRQRFAEL
FT                   GGVPGGETPAEYDAFIAQERKSWAQIVKAAGLSLE"
FT   sig_peptide     129266..129331
FT                   /locus_tag="Dtpsy_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            130262..131842
FT                   /locus_tag="Dtpsy_0115"
FT   CDS_pept        130262..131842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0115"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0098 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31601"
FT                   /db_xref="GOA:B9MAF4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAF4"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACM31601.1"
FT                   /translation="MHPDIEHLLAQPFGSLPELIERQAAHRPGHTALVLEDRRLDYAAL
FT                   HAGMDRVARSLQRDGMQPGDVVAICAGTSVEYVLAYLGALRAGVAVAPLAPSATAEHLS
FT                   AMLDNCGARLVLRDREVAAQWPLHAGAALRCVALDDAAEAGEPWSQWLAQGDGAPATTP
FT                   APITPEPDWPFNVIYSSGTTGVPKGIVQSWAMRWAHVRRAVTNGYGPDAVSLCATPLYS
FT                   NTTLVAALPTLALGGTLVLMRKFDATRYLALAQQHGATHTMLVPVQYQRLMACSDFDRT
FT                   DLSRLQHKFCTSAPFSAALKAEVLRRWPGRLIEYYGMTEGGVRCELHCHDFPHKLHTVG
FT                   RPGEGADIRFIDEQGRELPAGEQGEIVGRSAGMMSGYYRLPDKTREAEWFDAEGRRYIR
FT                   SGDVGRLDADGFIVLGDRKKDMIITGGFNVYPSDIEAVLCQHPQVAECAVVGVPSEQWG
FT                   ETPVAYVVGRSGSQPTAEELREWLNTRVGKTQRVADLRLVERLPRSEIGKVLKRTLREQ
FT                   YLQAAPIAG"
FT   gene            131870..132865
FT                   /locus_tag="Dtpsy_0116"
FT   CDS_pept        131870..132865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31602"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAF5"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31602.1"
FT                   /translation="MSLPRPSRLRRALLASMALTASALLAPVAYAADAWPAKPIQLVIP
FT                   YPPGGSADLLGRPLAMQLQQQLGQPVVLEYKPGAGGTLASQYVARAKPDGYTVFMVLAA
FT                   HAINDSLYPKLPYDTRKDFAPVSLVANLPMVVAASGKLPAKNIHELIQAAKAAPGKLTF
FT                   GSAGNGNTGHLAAEYFSSIAGVKMTHVPYKGSAGVVNAMLAGDIDLTFDSISTSMPHIR
FT                   GGRMHALAVTSPQRSALAPEVPTVQEQGMAGFDVTGWYALIAPAGTPPEITQRLSREIA
FT                   AALRQPQLQSQLAAGGYEPVGSTPEALQAHIEREITRWAAVVKSTGARVD"
FT   sig_peptide     131870..131965
FT                   /locus_tag="Dtpsy_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            133029..133496
FT                   /locus_tag="Dtpsy_0117"
FT   CDS_pept        133029..133496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0117"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ajs:Ajs_0100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31603"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAF6"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACM31603.1"
FT                   /translation="MQQPSSITADIPLSPFAGEAPDMFFGLPMAMARAMALRGERIGHD
FT                   MAQVRMRFQADQANSRGEVHGGSIATLLDCTLAAAARAHDPAAYGVATIDLTLHYVAAG
FT                   TGDLIATARCERRGRSISFVRGEVRAEDGTLVAMATGSFKLIARSTASASA"
FT   gene            complement(133513..134532)
FT                   /locus_tag="Dtpsy_0118"
FT   CDS_pept        complement(133513..134532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31604"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAF7"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31604.1"
FT                   /translation="MKHEAHPLGWNRRHLLALAAATAAAGPLGARAQAAPTGFATRPVR
FT                   VVVPFAAGGATDVIARILGERMAQRFGQSVVVDNKPGAAGLIAGEMVAKAPPDGMTALL
FT                   GTTSSMLTNKYLYKKTPYDPLTELTPLVRVCLAPIALVVTADTPAQNLQDFMAWIRSQK
FT                   GKLTYGSYGIGSHGQLACTTLSEVAGADMTHVAYKGEAPMVQDLLGGQIKIGMGSLLSL
FT                   KAHVDAGKLRALAVTGPRRVPLLPEVPTFTEAGYPQDALSIVGWLAIAGPKAMPADVAR
FT                   QWAQAANHAVASREGLARIIAAGFVPVDDDTPEKFARLWAQEAPVWGRLLQAAGVQPS"
FT   sig_peptide     complement(134434..134532)
FT                   /locus_tag="Dtpsy_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.717 at
FT                   residue 33"
FT   gene            complement(134761..135747)
FT                   /locus_tag="Dtpsy_0119"
FT   CDS_pept        complement(134761..135747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31605"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAF8"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31605.1"
FT                   /translation="MAFTRRKTLGQWLPLIALAATCGVGAAQAQDHYPSKPIRVIVPYP
FT                   AGGGTDIIARLIGTQLSQRLGQAVVVENKPGASGILGNDTVAKAPGDGYTVLMGITTVV
FT                   QIPALYKKVPYKLSDLAPVSQVAKSADLLMVPRSSGVTTLQQFVDKAKAAPGTLNFGSY
FT                   GNATSSHMNGERFKQKAGIDITHIPYQGSGPEMAAMLGGQLSLAFVDATAAYPHIKSDK
FT                   INILAITGAQRHPALPQVPTMTEAGYPGLEANGWFGMFVPATTPKAIVDKLGSEVSSIV
FT                   KSPELNKRLTEMGLIPVGSLPDDFKAQIDKDAAHWKAVAEAAKISMD"
FT   sig_peptide     complement(135658..135747)
FT                   /locus_tag="Dtpsy_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 30"
FT   gene            complement(135792..136946)
FT                   /locus_tag="Dtpsy_0120"
FT   CDS_pept        complement(135792..136946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0120"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ajs:Ajs_0103
FT                   acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31606"
FT                   /db_xref="GOA:B9MAF9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAF9"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACM31606.1"
FT                   /translation="MQDLIQRTVFREDHEQFRDAVRHFFDKEIVPHLADWERNGIVPKE
FT                   VWRKAGREGLLNTMLPEPYGSGGDFGHAAVLIEEVGRTNATALGFPLHSDIVAPYIYAY
FT                   GNQEQHDRWLPKMAAGEMIGAIAMTEPGAGSDLKSVRTTAKLVKSSEGDHYVINGAKTF
FT                   ITNGINSEIVIVVCKTAPDLGAKGVSLIVVEDGTPGFSKGRKLEKIGLMGQDTSELFFD
FT                   NVKVPVGNLLGEENMGFKYLMQELAQERLVVAVRAARCIESFLQKTIDYTRERKAFGQT
FT                   VFEFQNTRFKLAEAKAQATMLRTFVDECMKLHMQRKLTPERAAMVKLNATALQNKLLDE
FT                   FLQLHGGYGYMTEYQVGRAWTDARIGRIYGGSDEIMKEIIARTL"
FT   gene            complement(137019..138587)
FT                   /locus_tag="Dtpsy_0121"
FT   CDS_pept        complement(137019..138587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0121"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0104 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31607"
FT                   /db_xref="GOA:B9MAG0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAG0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACM31607.1"
FT                   /translation="MTGMQDFFGRAAAAPERVVLAMAETGVQYRAGEVARSALGMAQWL
FT                   HAQGLQPGERFAVVLENRVEILALALAARQAGLYAAVLSTHLTPAEVAYIVRDCGARLV
FT                   VASDKTLPQLGGLQDGPPLPCWTVDAATPQAASLPAALAAQQGPAADFADRPLGRDLLY
FT                   SSGTTGRPKGVLKPLWPAHLRGQTDPEALGTARIMGMGEDTVYLSPAPLYHAAPLRYTL
FT                   RVLELGGQAVIMERFDAETALALIERYRVTHSQWVPTMFGRMLKLPETVRQRYDLSSHR
FT                   VAIHAAAPCPVDVKHAMLDWWGDILMEYYAGSEGCGTTMINSAEWRRRPGSVGRPTTGR
FT                   LHIVGDDGQELPAGEIGQVYFSGGGQFSYLNDEEKTRQAINERGWITYGDIGHVDAEGY
FT                   LYLSDRRADLILSGGVNLYPQEIENALMRHPDVYEVAVVGVPHPDFGEQPLAAVVLRHG
FT                   AQASLDTARAIAAQAAEVLARMKLPQRVVFVDALPRLETGKLLRRKLKERFRDEPQAGF
FT                   ALRDS"
FT   gene            138787..139965
FT                   /locus_tag="Dtpsy_0122"
FT   CDS_pept        138787..139965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0122"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: ajs:Ajs_0105 acetyl-CoA acetyltransferases;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31608"
FT                   /db_xref="GOA:B9MAG1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAG1"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACM31608.1"
FT                   /translation="MKNPVIVDAIRSPMARAKPDGALAQVHPVDLLSQVLEQLVERNQI
FT                   DPGQVDDVICGCVSQAGEQAGTPGRLAWLAAGLPAHVPSTTIDRKCGSSQQAVHFAAQA
FT                   IMAGTQDIVIACGVESMSRVPMGSSRMGQNTTGARFDARYAPGLVGQGVSADLVAAQWG
FT                   LDRTALDTYAARSHQRAHAAQSSGGFAREIVGIDTPAGRVTADETIRAGTTVEKLAGLK
FT                   AVFENEELSARFPQIQWATTAGNASQMTDGASAMLIMSEQRAQQLGLRPRARFVAFDVV
FT                   GDDPLYMLTAPIPATQRVLAKAKMKLDDIHHYEINEAFASVPLAWQKELKADGERLNPR
FT                   GGAIALGHPLGASGIRLMTTMLHALEDSGQRYGLQSMCEAGGMANATIIERL"
FT   gene            140029..140796
FT                   /locus_tag="Dtpsy_0123"
FT   CDS_pept        140029..140796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0123"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: ajs:Ajs_0106 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31609"
FT                   /db_xref="GOA:B9MAG2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAG2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACM31609.1"
FT                   /translation="MKLQQGMTALVTGGVSGLGEATALQLLERGLNVVVVDLNDERGQA
FT                   MEQQYAGRLRYVKADVSDAEQMAPAIAAAQAFGNFRALVHCAGIGGPLRLIEKDGSPGS
FT                   LEKYVNIIRVNLIGTFNVLRLAAVSMAGNEPIDGERGACVLTASVAGYEGQIGQIPYAS
FT                   SKAGVIGLTLVAARDLASKFIRVCTIAPGLFDTPILAKLPENVRQSLSASVPHPARLGY
FT                   PSEYAMTALHILENPMLNGETIRLDGAIRMAPR"
FT   gene            140970..141734
FT                   /locus_tag="Dtpsy_0124"
FT   CDS_pept        140970..141734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0124"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   ajs:Ajs_0107 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31610"
FT                   /db_xref="GOA:B9MAG3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAG3"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACM31610.1"
FT                   /translation="MASTVLVEVRGNVLIMTLSNPEARNAATLEMAEAMAAALDELDRN
FT                   PALQVGVITGAGGTFCAGMDLKGFLQGKRPSLPGRGFLGLTQQPPRKPLIAAVEGYALA
FT                   GGFETVLACDLIVAAKTAQFGLPEVKRGLAAAAGGLLRLPRRLPYHLAMEAILTGDMFS
FT                   AERAQAHGLVNRLVEPGQALDSALELAQAVAANGPLALIASKRVAQESADWTQAEMFER
FT                   QAVITAPVFASLDAREGAAAFAEKRPPVWKGV"
FT   gene            141835..142833
FT                   /locus_tag="Dtpsy_0125"
FT   CDS_pept        141835..142833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31611"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAG4"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31611.1"
FT                   /translation="MPFPHRRHALRLAGATALLGLAALGASQPARADATWPTRPITFVV
FT                   PGAAGGTTDTPVRFMAQKLSERLGQPIVVDNKPGAGGSLGSSLVARAQPDGYNVLVGNT
FT                   GSNAINYTAYQKLPYKAEDFTPLTDMISFANVLVVPVKSPIKSLKELVAAAKREPGKLA
FT                   FSSAGVGQTTHLMGELLRQSAGVDVVHVPYKGSAPATMAIVAGETQFMFDNLTGSLGHV
FT                   KDGKLRALAVTGATREPELPDVPTMTELGMKDFDKVGWMGFFVPAKTPPAVVKKLTDNL
FT                   IAVLQDPAVVKRYRELGGRPGGMAPEQFSQMVERDRQDWGALIRSQKLQLD"
FT   sig_peptide     141835..141933
FT                   /locus_tag="Dtpsy_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 33"
FT   gene            142846..143652
FT                   /locus_tag="Dtpsy_0126"
FT   CDS_pept        142846..143652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0126"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ajs:Ajs_0109 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31612"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAG5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACM31612.1"
FT                   /translation="MAEFSSFAGRHVFVAGGTSGINLGIAQAFARAGAHVVVMSRSPDK
FT                   VQQAAEGLRALGAQALGISADVRDPAAVDAALRQAHAQFGDIDVLISGAAGNFIAPAAD
FT                   LSPNGFKTVIDIDLNGSFHVLRLAYPMLKKPGASVINISAPQGVNPTMYQVHACAAKAG
FT                   IDMMTRVLAMEWGEVGVRVNAIAPGPIGDTEGMRRLAPTPEALANAVATVPLQRMGTLD
FT                   DIANMALFLSSPQAGYVTGAVIPVDGGSSLRGGRDMRASYVPRSAA"
FT   gene            143649..144441
FT                   /pseudo
FT                   /locus_tag="Dtpsy_0127"
FT   gene            144482..145270
FT                   /locus_tag="Dtpsy_0128"
FT   CDS_pept        144482..145270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0128"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   ajs:Ajs_0111 regulatory proteins, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31613"
FT                   /db_xref="GOA:B9MAG6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAG6"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACM31613.1"
FT                   /translation="MNVNADPDGKLVSALVRGVSILRCFSSKCQELSAKELMDLTGLPK
FT                   PTLFRLTDTLCELGLLRYSERLSKYVPGLGLLQLSSPVLTRMALRQFARPHMQALADLT
FT                   EGQVQLAVGHKRRLCMVELANGMGNTVFRQEIGVPISLSRTATGRAYLLGMAEDDRKAY
FT                   LQDLQRNDPQRAAWLEQRLTDARDDFARHGFCRSHGDLHREIESIAVPMSQPQDGELWV
FT                   FAVSVPVFSPMYARLETDLGPRLRTLVRSVESVLGASGLT"
FT   gene            145314..146426
FT                   /locus_tag="Dtpsy_0129"
FT   CDS_pept        145314..146426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0129"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: ajs:Ajs_0112 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31614"
FT                   /db_xref="GOA:B9MAG7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAG7"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACM31614.1"
FT                   /translation="MKVLDSVRVLEIGGLGPGPFCAMHLADLGADVISVVRETKGRETT
FT                   GALLNRGKRSVFADLKTEEGRQLVLALVAEADALIEGMRPGVMERLGLGPEECMAVNPR
FT                   LVYGRMTGWGQSGPLAPRAGHDTNYAAVSGALWGCSPVGARPVSPFAVLGDIGGGAMYL
FT                   MTGLLSGIVQARATGRGTVVDAAIVDGSAHMLNLMLSARQSGLVADVRGQSIHDSAPFY
FT                   DTYVCADGHYVTVGAIEPQFYTLLLQVLGLAEDPDFTGSQWDKAAWPVRRARLAALFLA
FT                   QPRAHWQALLEPTDACFGVVLSPVEAAQHPHMRARDVYSERQGVLQAAPAPRFDGAAYE
FT                   PGEACAPGAHTQSVMEGLGQSGARAVWRQR"
FT   gene            complement(146463..147686)
FT                   /locus_tag="Dtpsy_0130"
FT   CDS_pept        complement(146463..147686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0130"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ajs:Ajs_0113 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31615"
FT                   /db_xref="GOA:B9MAG8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAG8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACM31615.1"
FT                   /translation="MRLFRTQPLWVMLLTLLSGFALSQAYRTTTAIVAQGLQADFGLQA
FT                   SSLGAFAGLFGLSFGIAQLLMGIALDRYGLRRTVLVAAPLGIAGAALSALAPSYGWLMV
FT                   GQVLIGVGYSPAFVACTLFIARYFAADRFAFFSGLSMGLGGLGLLFTGTPLAWVVQHWG
FT                   WRAGFGLLAGLSLLSWLLIYALVHEPVRADTAHRPASSWGEALTGMGRLFTVPHTWGIV
FT                   ILGMSCYAAFLSLRGLWLGPLLIDRYGFSLVDSGNVALVLSLIALFTPAAFGRMDPGPA
FT                   RRRTWVGRASLSMAGLFAIMAWVNNAQATVALMIAMGLLSGYSILQYADVRSSYPNEQT
FT                   GRALSLYTMAMFLGVALMQSLTGAVAAWATSAGLEPYRAVLLCIAAWLALASLAFRLLP
FT                   ASALLQQR"
FT   sig_peptide     complement(147615..147686)
FT                   /locus_tag="Dtpsy_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.760 at
FT                   residue 24"
FT   gene            complement(147769..148638)
FT                   /locus_tag="Dtpsy_0131"
FT   CDS_pept        complement(147769..148638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0131"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: ajs:Ajs_0114
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31616"
FT                   /db_xref="GOA:B9MAG9"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAG9"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /protein_id="ACM31616.1"
FT                   /translation="MTDSVRHACSFLFVPATQPERLPKALASGADLVIADWEDAVAPAD
FT                   KERARTALADALATLPAPQRARLLVRINSEATPWFTADLQALAQLTAQGLAGAVVPKAE
FT                   RAQTLQAVAQAAGLHAALVPLVESVAGLAAADALATAPQVARLAFGHLDFQVDAGMACA
FT                   EDEQELLPVRMALVLASRRAGLAAPIDGVTVDTRNPERMGRDAERARRMGFGGKLCIHP
FT                   AQVPVLHAAFDPDEAAVTHAQRVRQALEQAGGGVCVLDGRMVDAPVLAQAEQTLLRHAR
FT                   ALQRLARV"
FT   gene            complement(148668..149045)
FT                   /locus_tag="Dtpsy_0132"
FT   CDS_pept        complement(148668..149045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0132"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cti:RALTA_B2224 putative
FT                   metallothiol transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31617"
FT                   /db_xref="GOA:B9MAH0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAH0"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACM31617.1"
FT                   /translation="MIDRLDHLVLTTAHEAQCVHFYCTVLGMALQTFGEGRKAFVFNGQ
FT                   KINLHIQGREFEPKAQHPMPGALDLCFIASIPLAQVQQRLAEYGIAIECGPVQRTGARG
FT                   PILSVYVRDPDHNLIEIAEYA"
FT   gene            complement(149109..150116)
FT                   /locus_tag="Dtpsy_0133"
FT   CDS_pept        complement(149109..150116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31618"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAH1"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31618.1"
FT                   /translation="MTARFIPISRRTTFGAIAAACAALALGGPAAANTWPEKNVTLVVP
FT                   YSAGGPTDVVARLLAVPMGQSLGQTVVVENTVGAGGTIAPNRVAKSKNDGYTILIHHMG
FT                   MATAPALYKKLPYDPLKDFEYIGQVLDVPMTLLSRKDFPANTFPELLDYVKKNQDKVSL
FT                   ANAGVGAVSQLCGMLFMHQVGVKLTTVPYKGAGPAMNDLMGGQVDLLCDQTTQTAPVIQ
FT                   DGKRAKVFGVTTPQRLASMPNIPTLDEQGLKGFDVKVWHGMYAPKGTPKDVIEKLNKAL
FT                   NVAIKDENVKKRIAELSSDLVSPEKATPEGLRKHLAAEVARWDKVIKAAGVSAE"
FT   sig_peptide     complement(150018..150116)
FT                   /locus_tag="Dtpsy_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 33"
FT   gene            complement(150205..151569)
FT                   /locus_tag="Dtpsy_0134"
FT   CDS_pept        complement(150205..151569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0134"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: ajs:Ajs_0116
FT                   MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31619"
FT                   /db_xref="GOA:B9MAH2"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAH2"
FT                   /inference="protein motif:PFAM:PF03972"
FT                   /protein_id="ACM31619.1"
FT                   /translation="MKQETQVTIHPLAQFAATLQWSDVPAPVQRRTEDLWVDWFGSVLA
FT                   GCRARPVASITRFALSQGPASGPAEVIGHGATSSPMMAALANAAASHVAEQDDVHNGSV
FT                   FHPAAVVFPPALAVAQSIGASGAQLMAACVAGYEVGIRVGEFLGRSHYKVFHTTATAGT
FT                   LAAAAAVGRLLDLTPAQMQHAFGSAGTQSAGLWEFLRTAADSKQLHTAHAAAAGLMSAY
FT                   LAQDGFTGAQDIFTGPQGLAAGMSSDANPAKLTEGLGTRWATAETSFKWHASCRHTHPA
FT                   ADALQQVMREHGLAPADIAQVTCHVHQGAIDVLGPVVSPTTVHQSKFSMGTVLALAARF
FT                   GHAGLTEFDEQFLAPDTVTLREKVRMVLDPEVDAAYPQRWIGKVTVQTTDGRTLAGRVE
FT                   EPKGDPGNTLSREELTAKALRLAAYGGAVSDAQARAAVQRLWQVQEWPRTQHLLG"
FT   gene            complement(151620..152810)
FT                   /locus_tag="Dtpsy_0135"
FT   CDS_pept        complement(151620..152810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0135"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: ajs:Ajs_0117 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31620"
FT                   /db_xref="GOA:B9MAH3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAH3"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACM31620.1"
FT                   /translation="MTKTIRPLDGLTVVSLEHAVAAPFCTRQLADLGARVIKVERPGSG
FT                   DFARGYDQRVKGQSSHFTWINRSKESLALDVKQPQAKAALLQLLKTADVLVQNLAPGAA
FT                   ARMGLSYEALKAHNPKLIVCDISGYGADGPYRDKKAYDLLIQSEAGFLSVTGTPETPSK
FT                   SGISVADIAAGMYAYTNILSALLLRGKTGEGSHIDVSMLEAMGEWMGYPMYYAFDGAPP
FT                   PPRTGASHASIYPYGPFVAGDGKTVMLGLQNEREWKAFCDAVLQRPEVASDARFDSNGQ
FT                   RNAHRDALQALILQEFSTLSAAQVVERLDQAGIANARVNDMADLWAHPQLAARQRWSDV
FT                   DSPVGRIPALLPPGVNSAFDYRMDAVPAVGQHNAAILAELGWSAEQIDALQAPQPL"
FT   gene            complement(152979..154139)
FT                   /locus_tag="Dtpsy_0136"
FT   CDS_pept        complement(152979..154139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0136"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ajs:Ajs_0118
FT                   acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31621"
FT                   /db_xref="GOA:B9MAH4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAH4"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACM31621.1"
FT                   /translation="MIHQPDQYQEIRDAVRALCAQYPDEYFRKVDEARAYPEAFVDALT
FT                   QAGWMAALIPQEYGGSGLTMAEASVIMEEINRSGGNSGACHGQMYVMNAIVRSGSEAQK
FT                   QKYLPKIASGELRIQSMGVTEPTTGSDTTKLKTSAVKKDGRWVINGQKVWISRIQHSDL
FT                   MILLARTTPADQVKKRSDGLSCFLIDLHQAIGNGLTVRPILNMVNHETNELFFDNLEIP
FT                   EDALLGEEGKGFKTLLDGLNAERTLIAAECIGDGYWFIDRASKYAKERVVFNRPIGQNQ
FT                   GVQFPIADAFIELEAANLMRWKACEKIDAHQNAGAEANMAKYLAAKASWEAANVCLQTH
FT                   GGFGFACEYDIERKFRETRLYQVAPISTNMIYSYVAEHILGLPRSF"
FT   gene            complement(154211..155116)
FT                   /locus_tag="Dtpsy_0137"
FT   CDS_pept        complement(154211..155116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31622"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAH5"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0119"
FT                   /protein_id="ACM31622.1"
FT                   /translation="MATMTEPTIDTAQLAHLQTWQGQSETLSDTLTATPIAALSATLDR
FT                   DDPAPAPGTTVPPLWHWLYFLPHARQSEIGPDGHPKRGGFLPPVPLPRRMWAGGRLRWE
FT                   MQGDGANPLQVGQQVQRTSTIQSVKHKAGRSGELLFVLVEHQYRNAQGLALTEEHDIVY
FT                   RSAAQPGDPAPTPQKPPLEGQAAWSRTIVPDDVLLFRYSALTFNGHRIHYDRKYVTEVE
FT                   GYPGLIVHGPLIATLLLDLLRRSLPGAQVLTFDFRAVRPTFDLHPFSVHGRPSSDGKSV
FT                   ELWAQDHEGWLTMQGTATLA"
FT   gene            155310..156227
FT                   /locus_tag="Dtpsy_0138"
FT   CDS_pept        155310..156227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0138"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ajs:Ajs_0120 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31623"
FT                   /db_xref="GOA:B9MAH6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAH6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACM31623.1"
FT                   /translation="MAQKMVQDKVVVVTGAGGGIGRDMALALAAAGAKVVVNDIGTSTT
FT                   GEGTDAGPAQKVVEEIKAAGGQAVANMDSVAEAAAAGRIIQCALDHFGRIDGVVNNAGI
FT                   LRDRFFHKMSLDEWDAVLKVHLYGSYYMSRAAANHFKEQESGAFVHMTSTSGLIGNFGQ
FT                   ANYSAAKLGLVALSKSIALDMQQFHVRSNCIAPFAWSRMIGSIPTDTPEQQARVAKIQQ
FT                   MTPNKIAPLAVYLLSDQAKDVNAQVFAVRNNEIFLMSQPRPLRSVHRSEGWTPEFIAEH
FT                   GMPALKASFVPMERSGDVFSWDPV"
FT   gene            156417..157310
FT                   /locus_tag="Dtpsy_0139"
FT   CDS_pept        156417..157310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0139"
FT                   /product="3-alpha,7-alpha,
FT                   12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoAhydratase"
FT                   /EC_number="4.2.1.107"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   ajs:Ajs_0121 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31624"
FT                   /db_xref="GOA:B9MAH7"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAH7"
FT                   /inference="protein motif:PRIAM:4.2.1.107"
FT                   /protein_id="ACM31624.1"
FT                   /translation="MAIDYHHLKARDFGVIRQTYTERDTMLYALSLGLGNDPLNASALP
FT                   FVYEGLEGGLRALPSQAVVLGYPGFWAREPDTGIDWVKLLHGEQRMRLHRPLPASGEVV
FT                   GHNRITHLTDKGEGKGAIMVTERRLETAAGELLATVQQVTFLRGDGGYSQQGGGQPSDA
FT                   PLPALQPTPQDRAPDFTDTQPTRPEAALLYRLMGDYNPLHADPAVAAKAGFERPILHGL
FT                   ASYGLVAHAVLRQCCAGDPARLKAMDIRFAAPVYPGETLVTEIWRVPGQPAQVQLRARV
FT                   LERDKVVLSHGFAELA"
FT   gene            157389..158183
FT                   /locus_tag="Dtpsy_0140"
FT   CDS_pept        157389..158183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0140"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   ajs:Ajs_0122 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31625"
FT                   /db_xref="GOA:B9MAH8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAH8"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACM31625.1"
FT                   /translation="MSASPVLTSVQDGIGTITLNRPEARNALNQAMRPALAAAIAQMRD
FT                   DAQVHAVILTGAGGAFCSGGDISAMLDTSRTGLAFRKGMRELHQWFPELVNLEKPVIAA
FT                   VDGPAFGAGLSLALAADFVLATRRAKFCAVFGRIGLIPDLGAMHLLPRIVGQQKAKELV
FT                   FTARTVDAEEAQQLGMVFDIVDDATALTEAALALARRFGEASTAAIGMAKTIMNQSFES
FT                   DARTIAELESYAQSVCRGSDYHQDAVRRFKDKQPLRFDWDRK"
FT   gene            158355..159635
FT                   /locus_tag="Dtpsy_0141"
FT   CDS_pept        158355..159635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0141"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   ajs:Ajs_0123 acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31626"
FT                   /db_xref="GOA:B9MAH9"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAH9"
FT                   /inference="protein motif:PFAM:PF02550"
FT                   /protein_id="ACM31626.1"
FT                   /translation="MSVLAERLQALIRPGDTLWWGQATAEPLTLTRAVVQQRHALAQGG
FT                   RLRVFVGIGASDTLQPGQADAIDFFGYAAGGPHRALAQAGVLDILPSHYSHLPGLIRAG
FT                   VLPVDVVLLQVSPPDAQGRYSLGLVQEYLPAAIERARVVIAEVHPDVPWTHGGLHLQAS
FT                   DFALLIDAEHPPLDQSRSAPGPVEQAIARHVAGWVEDGATLQLGIGNLPEAVLAALHGH
FT                   RDLGLHSGAVGDGIAALAEAGVLTNARKSLDTGVGIGGILMGGERLRRWAHRNPQIELR
FT                   GTDYTHDPAVLAASHKLTAINAAIEVDLTGQINAEVAAGCYVGAVGGAVDFLRGAARSK
FT                   GGLPIVALPATAKGKTRIVAQLSGPVSTPRSDAGLIVTEHGVADLRGQTLSRRVRRLID
FT                   IAAPEHRADLERQAHDTLRRCGAVFQI"
FT   gene            159702..160910
FT                   /locus_tag="Dtpsy_0142"
FT   CDS_pept        159702..160910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0142"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: ajs:Ajs_0124 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31627"
FT                   /db_xref="GOA:B9MAI0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAI0"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACM31627.1"
FT                   /translation="MRRAAIVTPVRTPVGTFGGSLRPVPVEELAATTVRAVVERSGIDP
FT                   ARIDDVVMAQSYANSEVPCVGRWAALQAGLPVSVPGMQLDRRCGGGLQAIVTASMMVQS
FT                   GAADVVIAGGVESMSNIEYYSTDMRWGARSGNVRFYDRLDRGRERSQPVERFGKISGMI
FT                   ETAENLARDYGITREEADAFALRSHQRAAAAWEAGRFADEIVPVQVPQRKGEPVTFARD
FT                   EGFRPDVTPESLAKLRVLMPNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLV
FT                   GWAAAGCEPSHMGIGPVPAVKKLLARLNLRIDDMDLVELNEAFACQVLAVLKGWEWRDQ
FT                   DAIAHKLNVNGSGISLGHPIGATGVRILATLLHELQRRKGRYGLETMCIGGGQGIAAVF
FT                   ERV"
FT   gene            161170..162144
FT                   /locus_tag="Dtpsy_0143"
FT   CDS_pept        161170..162144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31628"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAI1"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31628.1"
FT                   /translation="MPASRRLATAALALAPFAFALPAAAQDGQPVRLIVGYAAGGPVDQ
FT                   GARLFAPALSKELGMPVMVENKTGANATIAGSEVVRSKPDGMTLWFAASPTITISPNVM
FT                   TKMPFDPAKDLTPVAPILSYYNVLVVNNNEPYKSVRELVATAKSNPGKLAYGSAGVGGS
FT                   NHLGALLFAKRSGIEMNHIPYKGNAPAMTDVIGGQLNMMLDIISTASAYIHSGKVRAIA
FT                   VTSPQRNASLPDVPTFAESGIDGLKGFDVGGWYGVYGPKGMSPELVAKLNKAVNAALQQ
FT                   PDLKKRYKELGYDEWTGAPQKLAERGAQERAMWATVTQGITVD"
FT   sig_peptide     161170..161247
FT                   /locus_tag="Dtpsy_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            162146..163660
FT                   /locus_tag="Dtpsy_0144"
FT   CDS_pept        162146..163660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0144"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0126 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31629"
FT                   /db_xref="GOA:B9MAI2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAI2"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACM31629.1"
FT                   /translation="MAERIHHLLDRWLAEAPARPFIHLPDGRSLSFADLGALTDTAEAE
FT                   LRALDVRPGDRVLVVAENCPEHAALILACSRVGAWSCGVNARMAPAEIDAFVGKADARV
FT                   VFFTAAASRSAAAHAQRFTAVDSALPGMQHGAVLQDAQPEAGALRDTVASLIFTSGTTG
FT                   QPKGVMLTHDALIHFARVSGASRALGPQDRSYAFVPMTHIFGLGTVLISSLLAGAQLVM
FT                   RPQFDPDDLLDALAHHGVSQLQGPPALFSRLLAHLQERGIQRPEAPALRYLYTGAGPLD
FT                   LALKQRVEAAFGQALHHGYGLSEYAGSVHLTRLGEQRTDTSAGYAVAEAEVRVTDPATG
FT                   EPLPLGERGELWIRGRGLMPGYFRDPAATAAVMREGGWYASGDLGEMHADGALFVVGRL
FT                   KEMIIRSGFNVYPAEVETALNTHPSVQRSAVVGRTVEDGNEEIVAFVELRPGAALDADA
FT                   MQSHLRELLAPYKRPSHIVALSELPTNTNGKVLKRTLKDQALCLTT"
FT   gene            163679..164656
FT                   /locus_tag="Dtpsy_0145"
FT   CDS_pept        163679..164656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31630"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAI3"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31630.1"
FT                   /translation="MHSTTSRRSFIAGSLLAAAHPLAALAADPWPSKPVRFIVPFPPGG
FT                   PVDTTARVFSHRLSEIWKTPTVIDNRAGAGGVVGATAAAKEAPDGYGLFVGAIHHSVNP
FT                   SLMGKLPYDIEKDFAPISFAAMFPVFIVAHPSVPANTIQELIALAKKGTPLAYGSSGNG
FT                   GGTHLAGELFNMEAGTKLQHIPYKGSAPAMNDLLGGQVQLMFSDAPTALQHIKSGRVKV
FT                   LGVASRQRSAMLPDVPTGVESGLPGYEAYSWAALFAPAKTPQAVLDKINADFNTAMKDP
FT                   AVRQRLLDAGAEADPGTQEQMRQRLRGELDKWAKVIKTAGITPG"
FT   sig_peptide     163679..163759
FT                   /locus_tag="Dtpsy_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            164752..165135
FT                   /locus_tag="Dtpsy_0146"
FT   CDS_pept        164752..165135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0146"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   ajs:Ajs_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31631"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAI4"
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /protein_id="ACM31631.1"
FT                   /translation="MHLSAQTHYQAELDAGRFCLQHCPQCKNHVFTPRELCPHCGASPL
FT                   RWVRASGLGTVYSATTIARKADAGGNYNVALIDLDEGVRMMSRVEGVAPEDVRIGQRVQ
FT                   ARVAQKDGRGLVLFQPAAQGGAA"
FT   gene            165132..166340
FT                   /locus_tag="Dtpsy_0147"
FT   CDS_pept        165132..166340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0147"
FT                   /product="thiolase"
FT                   /note="KEGG: ajs:Ajs_0129 thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31632"
FT                   /db_xref="GOA:B9MAI5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAI5"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0129"
FT                   /protein_id="ACM31632.1"
FT                   /translation="MSRVPQSPLDAAAVNRPLRGRAAIVGAATYGCGEAPGMDDMTLLV
FT                   RAAHAAVADAGLTMQDIDGLATCSVNASMWTMPVIEHLGINPTYVDGTMIGGSSFIAHL
FT                   LPAIRALEAGQCKAVLVCYGSAQRSATFGRKESVAARRFLDPQPYEFPYEPVLPVSAYA
FT                   LAAARHMHEFGTTREQLAEVAVAARAWAQQNPEAFMRDPLTIEDVLAARPIASPLTVRD
FT                   CCLVTDGGGALVLTRAERARDLPNPPVYVLGNATAIWNRQISCMPDLTTTAAAQSGAQA
FT                   FAMAGLQAKDMDMAQVYDAFTINTLLFLEDLGFCAKGEAGAFVQNGGIAPGGRLAVNTN
FT                   GGGLSCVHPGMYGIFALIEAVRQLRGEAGARQLSRHDTAVVHGNGGTLSSQSTAVLGTA
FT                   DTL"
FT   gene            166367..167524
FT                   /locus_tag="Dtpsy_0148"
FT   CDS_pept        166367..167524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0148"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ajs:Ajs_0130
FT                   acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31633"
FT                   /db_xref="GOA:B9MAI6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAI6"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACM31633.1"
FT                   /translation="MIRDPDILEALLDSVRRFVRERLVPAENEVAETDEIPESIVQEMR
FT                   ELGLFGMTIPEKFGGLELTMEEECRVLFELCQTAPAFRSIIGTTVGIGSQGILMDGTPE
FT                   QQAQWLPKLATGEVIASFALTEPEAGSDAASLRTTAIKDGDHYIVNGTKRYITNAPHAG
FT                   MFTLMARTNPADKGAGGVSSFIVDAKTPGISFGKYDKKMGQRGAHTCDVIFDNVKVPAA
FT                   NLIGLQEGRGFKTAMKVLEKGRIHIAAVAVGVAQRILRDALAYALERKQFGQPICDFQL
FT                   VQAMLADSQAELYAAECMTIDAARRRDDGHNVSTEASCAKMFATEMCGRVADRAVQILG
FT                   GAGYMAEYGIERFYRDVRLFRLYEGTTQIQQIIIARNMVREARAA"
FT   gene            167521..167943
FT                   /locus_tag="Dtpsy_0149"
FT   CDS_pept        167521..167943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0149"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ajs:Ajs_0131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31634"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAI7"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACM31634.1"
FT                   /translation="MSGAPPLVDRSAFLRLIGAAQVPAPPGKVQVRLPHLREELLNQLP
FT                   AAHGGVVMALLDSVMSRAAGELPEAPSQTAVTVEMSSRFHRPGRGALLAEGWVVHATRS
FT                   LCSCAGQLLDEDGQLVATAHGTFKYWLAPTTLDSKK"
FT   gene            complement(168020..168943)
FT                   /locus_tag="Dtpsy_0150"
FT   CDS_pept        complement(168020..168943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0150"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ajs:Ajs_0132 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31635"
FT                   /db_xref="GOA:B9MAI8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAI8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACM31635.1"
FT                   /translation="MPAMAMHFDLVDLRLMVHIADANSMTRGAELSFISLPAASTRIKN
FT                   LEESIGTKLLYRTSQGVTLTPPGQAFVSHARMVLGQIEHLRGDMQEYVRGIKGHVRVFA
FT                   NTTSLGEFLPPVLRHFLRRNPDVNIDLRERLSHDIVRAVTEGQTDIGIVAGLVRTENLE
FT                   TLPYRRDRLVLVVPKGHALDGEMQIDFADTLELDYVGLHESSAIHAFLRHASDQLHRPI
FT                   KLRIQVGNFETACRMIEAGVGVGVLPESAASRHAQAMDIAIVPLSDAWSVREMQICVRS
FT                   MEALPSFAQELVDLLVADAQGRLQLE"
FT   gene            168997..170349
FT                   /locus_tag="Dtpsy_0151"
FT   CDS_pept        168997..170349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0151"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: ajs:Ajs_0133 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31636"
FT                   /db_xref="GOA:B9MAI9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAI9"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACM31636.1"
FT                   /translation="MQSRGAGAGRTMRLPLGKHRLSMTTPDSSSSPGAGRAGALGHLRV
FT                   LDLSRVLAGPWCTQNLADMGADVIKIEKPGDGDDTRHWGPPFFPDADGQPSEHACYFAA
FT                   CNRNKRSVTVDMATPEGQRLIRELAQQSDVVVENFKTGGLKRYGLDYESLSALNPRLIY
FT                   CSVTGFGHTGPYAPRAGYDLLIQAMSGLMSVTGHADGEPGGGPMRVGVAVIDLFTGMYA
FT                   TTAILGALEARHRTGRGQHIDMALLDVAMAVLANQGAGFLNAGNIPKRQGNTHPSVVPY
FT                   QDFPTQDGNMLLAIGNDGQFARFCEAAGTDWAGDERFATNAGRVTHRETLIPLMAALTR
FT                   TRPTAAWIALLEDKAVPCGPINHVGQAFDDAQVRARGLRVEQQRYPGAQPPAGEVVNRV
FT                   VTTASPLRLSDTPVTLRYAPPPLGQHTDEVLRERLGLDAAQLQALRAQRVL"
FT   gene            complement(170357..171337)
FT                   /locus_tag="Dtpsy_0152"
FT   CDS_pept        complement(170357..171337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0152"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: ajs:Ajs_0134
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31637"
FT                   /db_xref="GOA:B9MAJ0"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAJ0"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ACM31637.1"
FT                   /translation="MRMSQCLPLSFATLAALALPATAQSQVTISGYLDTGVFRDYDKTR
FT                   KLGTIQRSHLAVAGTEDLGGGLKANFRLSTRFELDTGQSEGAGSKPFWHDESTVGLQGG
FT                   WGQLRLGRALSAMWSQEWKFDAFSNFNRIASTAWHMAHYYTPTDRASNNGAAEYGRMTN
FT                   GIYYDSPTWDGFSFNASASTERTQTPGRDGRGGSVALNYDQGPVAAMVGYERNGSGDKD
FT                   LFLGGLYRLGAATLMMAYDHSRAGSSPDTSRMVSVGGSYALGVTTLRASYGRQRLNDGV
FT                   THHMASLGAEYNLSKRTMLYASLGHQRYEHNPSRTAFGVGVAHAF"
FT   sig_peptide     complement(171266..171337)
FT                   /locus_tag="Dtpsy_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 24"
FT   gene            complement(171687..172991)
FT                   /locus_tag="Dtpsy_0153"
FT   CDS_pept        complement(171687..172991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0153"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   ajs:Ajs_0135 Glu/Leu/Phe/Val dehydrogenase, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31638"
FT                   /db_xref="GOA:B9MAJ1"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAJ1"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ACM31638.1"
FT                   /translation="MSNTPNPPLPTHALPSYLDPNHLGPWGVYLQQIDRVTPYLGSLAR
FT                   WVETLKRPKRALIVDVPIELDNGTIAHFEGYRVQHNVSRGPGKGGVRFHQDVTLSEVMA
FT                   LSAWMSIKNAAVNVPYGGAKGGIRVDPKTLSKAELERLTRRYTSEIGIIIGPSKDIPAP
FT                   DVNTNAQVMAWMMDTYSMNVGTTATGVVTGKPVDLGGSLGRVEATGRGVFTVGVEAARL
FT                   TGMAIEGARVAVQGFGNVGGTAGKLFAEAGAKVVAVQDHTGSIHNDKGLDVPALLAHVQ
FT                   QTGGVGGFAGAEPMANDAFWGVACDILIPAALESQITKDNAGRIQAKMVIEGANGPTTP
FT                   EADDILNDKGVLVLPDVISNAGGVTVSYFEWVQDFSSFFWTEDEINARLVRIMKEAFAG
FT                   VWQVAQENKVTLRTATFIVACKRILHAREMRGLYP"
FT   gene            complement(173172..174089)
FT                   /locus_tag="Dtpsy_0154"
FT   CDS_pept        complement(173172..174089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0154"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   ajs:Ajs_0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31639"
FT                   /db_xref="GOA:B9MAJ2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAJ2"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ACM31639.1"
FT                   /translation="MPTYLPPFDIADDALAKQWRQWQPKDFAPNGGNGKNGKNGKHADK
FT                   DNGALHLKDYDPGAKPFSCGDKALDKARVEELALELDALQDLLYADRRYKLLVVLQGMD
FT                   TAGKDGTVRGVFGRMSALGVHAVGWKAPTELERAHDYLWRIHRQVPGAGELTVFNRSHY
FT                   EDVLVPVVNGWITPEQQRQRYAHINDFERLLAETGTVVMKFMLHISKDEQRQRLQERLD
FT                   DPTKHWKFDMGDIQVREQWDAYQRAYEAFLPATHTPWAPWTIVPADSKTHRNLMIASVL
FT                   RGVLQRLELRYPPGDPALEKFTVK"
FT   gene            complement(174119..175042)
FT                   /locus_tag="Dtpsy_0155"
FT   CDS_pept        complement(174119..175042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0155"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ajs:Ajs_0137 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31640"
FT                   /db_xref="GOA:B9MAJ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAJ3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACM31640.1"
FT                   /translation="MAFTSDNVLVFLAVLDRGSFSAAARALSRVPSAVSMAIAQLEAEL
FT                   DMPLFDRSGREPRPTAAARALEPQARALAAQLQQLNTQALALTQGLEERLTLAIAPELL
FT                   AARWHGPLATLAQDYPLLQVEVLAAPQADALALLHAGRAQLALVFERPSLDGREDFQEV
FT                   GSETLVAVIAPQHPLLAPRAAGAGPAGLREEHLAGTRQIVVAGRDLGQTDARFVYARHH
FT                   WRTDSHLAALGLIEAGLGWGWQPRALVAPRIAAGTLVELPLENLSNGAQLWVDVVWSRE
FT                   RPLGLGARRFVELMARQRPGSSPAPQ"
FT   gene            175114..175602
FT                   /locus_tag="Dtpsy_0156"
FT   CDS_pept        175114..175602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0156"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   ajs:Ajs_0138 transmembrane pair domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31641"
FT                   /db_xref="GOA:B9MAJ4"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAJ4"
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /protein_id="ACM31641.1"
FT                   /translation="MSATTHAVGLQGPKRRVVFVTLYEIIAIIVSSLLFMAIGQGAGAS
FT                   GVMAVVASALAIAWNVTFNALFERWEARQRVKGRSVLRRVVHAVGFEGGLALVLIPLMA
FT                   WWFGVSLWQATVMEAGLLLFFLVYTYAFNWAFDRVYGLPASAQAMPAAAPAGAVVGAP"
FT   gene            complement(175647..176573)
FT                   /locus_tag="Dtpsy_0157"
FT   CDS_pept        complement(175647..176573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0157"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ajs:Ajs_0139 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31642"
FT                   /db_xref="GOA:B9MAJ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAJ5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACM31642.1"
FT                   /translation="MELRQLRYFLSVAETEHLTRSADALFVTQSTLSHGLRQLEAELGV
FT                   PLFDRLGRGLRLSQAGHAFRDHAARALQELEAGRQAVADMSALQTGTLQVGVIPTFLTR
FT                   FVPDAVAAFSARYPGVQLTVRDLRSGQIEELLIAGRLDLGIAFHPASREEIEAEPLFEE
FT                   RMHLVVHQGHPLARRQRLRLAELAGVPLALLPASFATRRLIDAAFAQAGVTPLVRVEME
FT                   SVDALLQACRSGPLATIAAEHAALHAGPDMRAAVLTEPRTVRRAGLLWRRGASRSAAAR
FT                   EFVALLRPAIARTAAPPSLQGGVAQQE"
FT   gene            176722..177924
FT                   /locus_tag="Dtpsy_0158"
FT   CDS_pept        176722..177924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0158"
FT                   /product="muconate and chloromuconate cycloisomerase"
FT                   /note="TIGRFAM: muconate and chloromuconate cycloisomerase;
FT                   PFAM: Mandelate racemase/muconate lactonizing protein;
FT                   KEGG: ajs:Ajs_0140 muconate and chloromuconate
FT                   cycloisomerases"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31643"
FT                   /db_xref="GOA:B9MAJ6"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR013370"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAJ6"
FT                   /inference="protein motif:TFAM:TIGR02534"
FT                   /protein_id="ACM31643.1"
FT                   /translation="MTTSPSASVLRIERIQARILDIPTIRPHKLSFGAIQRQSPVIVQL
FT                   WLSDGASGFGEAATIGGPSWNEESPESIRHAIDSYLAPAVIGQDAGRFEQLLQRMDLAC
FT                   KGNRFAKSAVEQAAIDAVARSLGLPVWQLLGGKQRESLPLAWTLASGDSAKDIEEAEKM
FT                   LAARRHRIFKLKIGARAPQEDVAHVARIARALDGRASMTVDVNQAWDGATARRYLPEMI
FT                   DAGVGLIEQPVAQWNEEALRQLTATLPHTALVMADETVCTPQDAMRLARHNACHVFSLK
FT                   IAKHGGLLRTRAVADVARAADIGWYGGTMLETSVGSAASAHVFATLGGTHHNCELFGPQ
FT                   LLVDDIVEQQMVLSDFALQLPDGPGFGLTVVPERLDRFDRARQGLTPVHVDLGRASAQP
FT                   A"
FT   gene            177953..178249
FT                   /locus_tag="Dtpsy_0159"
FT   CDS_pept        177953..178249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0159"
FT                   /product="muconolactone delta-isomerase"
FT                   /EC_number="5.3.3.4"
FT                   /note="KEGG: ajs:Ajs_0141 muconolactone delta-isomerase;
FT                   TIGRFAM: muconolactone delta-isomerase; PFAM: Muconolactone
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31644"
FT                   /db_xref="GOA:B9MAJ7"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAJ7"
FT                   /inference="protein motif:TFAM:TIGR03221"
FT                   /protein_id="ACM31644.1"
FT                   /translation="MLFLVRMDVKIPHDLPAAQADEIKAREKKYSQDLQRDGRWRHIWR
FT                   VVGEYANYSVFDVQSNDELHQLLSQLPLFPYMDIHVTPLANHPSAIVQEGAPG"
FT   gene            178296..179219
FT                   /locus_tag="Dtpsy_0160"
FT   CDS_pept        178296..179219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0160"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; Catechol
FT                   dioxygenase domain protein; KEGG: ajs:Ajs_0142 intradiol
FT                   ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31645"
FT                   /db_xref="GOA:B9MAJ8"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAJ8"
FT                   /inference="protein motif:PFAM:PF00775"
FT                   /protein_id="ACM31645.1"
FT                   /translation="MAEYTAQQLLDIVNTVHVAEGNARVRQITQRIVTDLFRTIEELDV
FT                   TPDEFWAGVGWLTRLGASGQTGLITAGLGFDRLIDIRMDEADERAQRAAGTPRAIEGPL
FT                   FVAGAPLSEREVRLDEGEEPPRGEVVVMEGRVLDTDGQPVAGALVDVWHANELGRYSHF
FT                   DPDQAPYHLRRKIRTGADGSYRFRSFIPPGYAIPPGSPTAELFDALGRHGNRPAHIHFL
FT                   VVAEGLRTLTTQVNIPGDSFLDDDFAFATRDGLVVTLEPGTPAAGYESLGISAPFTRVR
FT                   FDFVLQKALSADEQRPEARMDRVAAA"
FT   gene            179246..180238
FT                   /locus_tag="Dtpsy_0161"
FT   CDS_pept        179246..180238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31646"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAJ9"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31646.1"
FT                   /translation="MTFSRRIALLGACTLAAAGLLPAAAVAQPDANWPSKPIKWVVPFP
FT                   PGGAMDVIARTLGEKAGRTLGQPFVIENRPGAGGNIGADAVAKSPADGYTIMITSIGMA
FT                   TNKALYPRLSYDPVKDFAPISLLAIVPNVLVVNTAKTTDKSVADVIAHAKRDPGKLTYA
FT                   SAGNGTSIHLAGEVFASMAGLNLLHVPYKGSGPAVTDMLGGQVDLMFDSITSARPHILS
FT                   GKLRALGVTSAKRSATLPGVPTIAEAGVPGYEVSPWFAVFAPAGTPAAIVNKINAALID
FT                   AMKQPDTVAKFETIGAEPIGTTPQQLATHLDKELARWGALIKERNIRMD"
FT   sig_peptide     179246..179329
FT                   /locus_tag="Dtpsy_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.898 at
FT                   residue 28"
FT   gene            complement(180324..181736)
FT                   /locus_tag="Dtpsy_0162"
FT   CDS_pept        complement(180324..181736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0162"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="TIGRFAM: cytochrome c oxidase accessory protein
FT                   CcoG; KEGG: ajs:Ajs_0144 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31647"
FT                   /db_xref="GOA:B9MAK0"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAK0"
FT                   /inference="protein motif:TFAM:TIGR02745"
FT                   /protein_id="ACM31647.1"
FT                   /translation="MPAPQTQPPAAERDVYVDLYEAKKKIYPRAIGGVFTRWRWALVLL
FT                   TQGVFYGLPWWQWGERQMVLFDLGARRFYLFGLVLYPQDFIYLTGLLIMSALSLFLFTA
FT                   VAGRLWCGFACPQTVYTELFLWLERLTEGDRSARMRLDKGPWTFEKLWRKTLKQLAWMS
FT                   VALWTGFTFVGYFVPIRQLGGELLALHGTWQIFWVGFYSFATYGFAGYMREQVCKYMCP
FT                   YARFQSAMFDKDTLIVTYDTQRGEPRAARSKKVDAKAAGLGDCIDCSLCVQVCPTGIDI
FT                   RKGLQYECIGCGMCVDACNTVMDKVQYPRGLIRYATQNGMQNRWSSAQMLRRVLRPRVL
FT                   FYSAVLLALCTAMLASLVTRTPLKVDVVRDRAALSRVVAGGQLENIYRVQVMNATEQPQ
FT                   RYRITASGLQGLQVASEPEVEIGPAESRWVAVRLQVPYGAAPAGSHTVHLDVQALGDRA
FT                   QVSEKTVFLVPR"
FT   gene            complement(181781..182395)
FT                   /locus_tag="Dtpsy_0163"
FT   CDS_pept        complement(181781..182395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0163"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="KEGG: ajs:Ajs_0145 ubiquinol-cytochrome c reductase,
FT                   iron-sulfur subunit; TIGRFAM: ubiquinol-cytochrome c
FT                   reductase, iron-sulfur subunit; PFAM: Rieske [2Fe-2S]
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31648"
FT                   /db_xref="GOA:B9MAK1"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAK1"
FT                   /inference="protein motif:TFAM:TIGR01416"
FT                   /protein_id="ACM31648.1"
FT                   /translation="MTALPASCTCAAPDAERRTLIHATAAAGGLAAVGAAVPLVSSLAP
FT                   SERARSLGAAVEVDIAGLPPGGMLTVEWRGKPVWVVRRTPEMLQSLQGLEAQLADPASA
FT                   KDQQPDYARNTHRSIQPEVFVAIGICTHLGCSPTAVAPGAPQSGLGAGWPGGFFCPCHG
FT                   STFDNAGRVYRNKPAPTNLEVPPHRFLSATRLLIGEDSASA"
FT   gene            182599..183951
FT                   /locus_tag="Dtpsy_0164"
FT   CDS_pept        182599..183951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0164"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; PAS fold-4 domain
FT                   protein; SMART: AAA ATPase; KEGG: ajs:Ajs_0146 sigma-54
FT                   dependent trancsriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31649"
FT                   /db_xref="GOA:B9MAK2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAK2"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACM31649.1"
FT                   /translation="MADTQDLSPTPAQVAQTALLASWLEGLPEPHILFDRGYRIVAANG
FT                   AYRRQFGQGAPVVGRTCHAVSHHSPVPCDQAGETCPLARSLFSGQRERVLHLHHTPAGE
FT                   EYVQIELVPLRDEAGQPQYFLEKMEPLRIAQGQPGAPGMIGRAPAFQAVLELIARVGPS
FT                   QASVLLLGESGTGKELAARAVHEASPRAGRPLVVVDCASLPETLFESELFGHERGAFTG
FT                   AHAARAGLVEAAHGGTLFLDEVGDIPLTMQVKLLRLLESGTYRRVGHTELRRADIRLVA
FT                   ATHRDLRAMVREGRFRQDLYYRLSTFPIQLPALRERPQDIPLLAESLLQRVAGGRGLVL
FT                   APAALRRLAQHPFPGNVRELRNVLERAALLTDGAAVTAHTIERALSFDAPAAAPARAAQ
FT                   QPDHATLRDIESEALRAALAGGAASRRELARALGVSTRTLYRKLRLLREQG"
FT   gene            184270..187059
FT                   /locus_tag="Dtpsy_0165"
FT   CDS_pept        184270..187059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0165"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: ajs:Ajs_0147 methionine synthase
FT                   (B12-dependent); TIGRFAM: methionine synthase; PFAM:
FT                   dihydropteroate synthase DHPS; Methionine synthase
FT                   B12-binding module cap domain protein; Vitamin B12
FT                   dependent methionine synthase activation region; cobalamin
FT                   B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31650"
FT                   /db_xref="GOA:B9MAK3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAK3"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ACM31650.1"
FT                   /translation="MPSSAPASSVPSHAVPPMRLSGLEPVFIGEGSLFVNVGERTNVTG
FT                   SKAFARMILNDQYEQALSVARQQVENGAQIIDVNMDEAMLDSKAAMVRFLNLIASEPDI
FT                   ARVPVMVDSSKWEVIEAGLRCLQGKGIVNSISMKEGVEEFKRQAKLIRRYGAAAVVMAF
FT                   DEKGQADTFARKTEICERAYRILVDEVGMAPEDIIFDPNIFAIATGIEEHANYAVDFIE
FT                   AVRWIKQHLPGAKVSGGVSNVSFSFRGNEPVREAIHTVFLYHAIKAGMDMGIVNAGMVG
FT                   VYDDLDPELRERVEDVVLNRRPDAAERLLEIAEAAKGAAKDDSKKLEWRGTPEHPKTVG
FT                   ERLSHALVHGITDFIVEDTEEAYQQIVVQGGGRPLHVIEGPLMDGMNIVGDLFGAGKMF
FT                   LPQVVKSARVMKQAVAHLIPYIEEEKRQQEAAGLDVSSKGKIVIATVKGDVHDIGKNIV
FT                   TVVLQCNNFEVINMGVMVPCHEILARAKAEGADIIGLSGLITPSLEEMQYVAGEMDKDE
FT                   YFRIKKIPLLIGGATCSRVHTAVKIAPQYQGPVVYVPDASRSVSVAQSLLGEQKDSYLA
FT                   EVQADYDHVRHLHANKKKTPVWPLAQCRANKTRIDWAHYQPPAPKFIGRRVIKNIDLAE
FT                   LVPFIDWAPYFQTWDLAGKYPDILQDEVVGEEATRVFRDAQAMLKKIVEGRWLTAHAVV
FT                   GFWPANTVRDDDIELYADAARDKVVLTWYGLRQQAEKQPDAEGRMRPSRCLADFIAPRP
FT                   EGGAPTQADHIGAFAVTAGIGVDAKVAEFMADHDDYNAITLKALADRLAEAGAEWLHHR
FT                   VRTDWWGYQAGEQLSNDELIAEKYVGIRPAPGYPACPDHRVKKPLFALLGTADVDMDIT
FT                   DSYAMTPAASVSGFYFSHPESTYFSVGKIDDAQVQDMAQRSGVPLAEVERALAPNLGL"
FT   gene            187095..188696
FT                   /locus_tag="Dtpsy_0166"
FT   CDS_pept        187095..188696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0166"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: ajs:Ajs_0148
FT                   peptidoglycan binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31651"
FT                   /db_xref="GOA:B9MAK4"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAK4"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACM31651.1"
FT                   /translation="MNLRLLTHHTAPLLLAAWMPLAAWANPSWLTADGRPLPAAHEAVR
FT                   WLNEAAADGLEPADYGAQHLSDALAAAAARGLDAASAVALDQELTQAVERYLYELHGGR
FT                   IDPARLNERYDHSRRPQPDLRAALQTALADGQIQQARDAAIPRVPMYPALRALLAHYRA
FT                   LGAHPAWAQPLPALPGRKLTPGQPWEGLGVLAERLVALGDLPPQPTGEPPAASAPAQYT
FT                   PVLVEAATAFQRRHGLEADGVLGATTLAALNVPPAARAEQIALQMERLRWTPVLQGPRM
FT                   IAVNVPEYRLRAYEYAGGRITLRLSMAVIVGKALDTRTPLFDEDMQSIEFSPYWNIPPS
FT                   IARGETVPRLRRDPGYLARQGMEFVSAAGVSTDTTPEMLGAVVAGQARIRQRPGPLNAL
FT                   GDIKFVLPNNDNIYLHHTSAPTLFGRSRRDLSHGCVRVGEPVALAQFVLQDDPTWTVER
FT                   IRAAMAQPKPVFVRLPHPVPVIITHITVVVQDGRPHFYGDLYGHDRKLASLLRQHSAKP
FT                   YDAVRAGSAAGVIGPK"
FT   sig_peptide     187095..187172
FT                   /locus_tag="Dtpsy_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            188730..189302
FT                   /locus_tag="Dtpsy_0167"
FT   CDS_pept        188730..189302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0167"
FT                   /product="protein of unknown function DUF882"
FT                   /note="PFAM: protein of unknown function DUF882; Peptidase
FT                   M15A; KEGG: ajs:Ajs_0149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31652"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAK5"
FT                   /inference="protein motif:PFAM:PF05951"
FT                   /protein_id="ACM31652.1"
FT                   /translation="MAPPHNPHRRLFLGRGAAVAHAAAAAVLLPKAALASLSEEQDLAR
FT                   RLAFNHLHTHERLALVYAQGEQFIPAALPTLNHFLRDHYSGDVGVMDPDLFHLLHRVRQ
FT                   TLQTQQPFEVISGYRSPHTNETLRTTRGGGVARRSLHMDGKAIDVRLPGVSLSDLRDAA
FT                   ISLRAGGVGYYAREQFVHIDTGRVRSW"
FT   sig_peptide     188730..188807
FT                   /locus_tag="Dtpsy_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.851 at
FT                   residue 26"
FT   gene            complement(189371..189907)
FT                   /locus_tag="Dtpsy_0168"
FT   CDS_pept        complement(189371..189907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0168"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: ajs:Ajs_0150 shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31653"
FT                   /db_xref="GOA:B9MAK6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAK6"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ACM31653.1"
FT                   /translation="MQTRCALVGMPGSGKSTVGRQLARRLGLPFVDLDQRLEQRLGTSI
FT                   RDYFDQHGEAAFRDHEAALLAELAAQPGGMVLSTGGGAVLREDNRATLRRGFPHVMYLR
FT                   ASPDEIFKRIKHDRTRPLLQVDDPLARLRDLYRARDPLYREAAHYVIETGRPTVHTLVN
FT                   MIMMQLEMAAPGDPV"
FT   gene            190039..190956
FT                   /locus_tag="Dtpsy_0169"
FT   CDS_pept        190039..190956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0169"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: ajs:Ajs_0151
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31654"
FT                   /db_xref="GOA:B9MAK7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAK7"
FT                   /inference="protein motif:PFAM:PF03631"
FT                   /protein_id="ACM31654.1"
FT                   /translation="MPLSLQSLKSFAQPLLQRVLQPIAPLVRAVQMWLDADGLRMSAAM
FT                   SFYGMLSLAPLLLLLVGVLGWWIDQAYLESNLIAQVRGVMGERGAEVVRLALASAQEPA
FT                   EGRLASMAGFVLLLSGATGVFVELQSALERLWAHGQPAPERKAWWRMASLRLRGLAYVL
FT                   AIGFLLLVSLVLSTAINVLATWASARLPFGSGTLLQIVNEAVAFAVAVALFLGLMRIGS
FT                   GPKPPTHCLVFGAVVGATLFTVGKQLLALYLSTAAVVSAYGAAGSLVVLLMWIYFSSAV
FT                   LLFSAASARALHETRTAASVPAGS"
FT   gene            191082..191924
FT                   /locus_tag="Dtpsy_0170"
FT   CDS_pept        191082..191924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0170"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: ajs:Ajs_0152 17
FT                   kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31655"
FT                   /db_xref="GOA:B9MAK8"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAK8"
FT                   /inference="protein motif:PFAM:PF05433"
FT                   /protein_id="ACM31655.1"
FT                   /translation="MHSTSASPAAAPSAASLKWLWAAVGVLGVSVLALGGTLLAQNLRG
FT                   GPPAGDSAAGGPAATLAATAPRTPEAEVLNEKAPPAQSQQAMAALDSGANPTARRAAAP
FT                   PSPQAYPQDDPQTYAQGYPQPGASPSPVPTQRGEPLQRAVAQRSAAPVCGTCGRVESVR
FT                   AVEQAAPATGVGAVAGGVLGGVLGNQIGKGSGRTAATVLGAVGGGYVGHKVEQRARTTT
FT                   VYQMRVRMDDGSVRNFTRAQPLAEGTAVRVQGKSLRVDPGADADRAGVEPVRVVDRGY"
FT   sig_peptide     191082..191204
FT                   /locus_tag="Dtpsy_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.701) with cleavage site probability 0.418 at
FT                   residue 41"
FT   gene            complement(192095..192868)
FT                   /locus_tag="Dtpsy_0171"
FT   CDS_pept        complement(192095..192868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0171"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   ajs:Ajs_0153 ferredoxin--NADP(+) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31656"
FT                   /db_xref="GOA:B9MAK9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAK9"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACM31656.1"
FT                   /translation="MSAFHEERVLTVHHWTDRLFSFTTTRDPALRFSNGHFTMIGLKVD
FT                   GKPLLRAYSIVSANYEEHLEFLSIKVPDGPLTSRLQHIQVGDSIIVGKKPTGTLLIDYL
FT                   LPAKRLYLMSTGTGLAPFLSVIRDPETYEKFEQVILLHGVRQVAELAYHDYITKELPQH
FT                   EFLGELITKQLKYYPTVTREPFRNQGRIPDLIDSGKLAADLGLPELNPLEDRVMLCGSP
FT                   EMLASLKELLEKRDFEEGNTTRPGDFVIERAFVEK"
FT   gene            193128..194315
FT                   /locus_tag="Dtpsy_0172"
FT   CDS_pept        193128..194315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0172"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   ajs:Ajs_0154 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31657"
FT                   /db_xref="GOA:B9MAL0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAL0"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACM31657.1"
FT                   /translation="MHKPFTPLLALLFAGGAYAQGAYTIGEINSYKAQPAFLEPYKKGM
FT                   ELAVEQINAAGGIQGKQLRLVTRDDNATPGDAVRAAEELIAREKVDVLMGSFLSHVGLA
FT                   LTDFAQQKKRFFLAAEPLTDKIVWEHGNRYTFRLRPSTYMQVAMLVPEAVALKKKRWAI
FT                   VYPNYEYGQSAVATFKQLLKAAQPDVEFVAEQATPLGKVDAGSVAQALEDAKPDAIFNV
FT                   LFAADLAKFVREGNTRGLFAGRSVVSLLSGEPEYLDTLKSETPEGWIVTGYPWYAIQTP
FT                   EHKAFLDAYMKRFKDYPRAGSVVGYNAVQSVAAGLAKAGSADTEKLITAFRGLQVATPF
FT                   GPITYRTQDHQSTMGAYVGKTALRMGKGVMVDFTYRDGAKYQPSDAEVKRLRKDE"
FT   sig_peptide     193128..193187
FT                   /locus_tag="Dtpsy_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 20"
FT   gene            194448..196355
FT                   /locus_tag="Dtpsy_0173"
FT   CDS_pept        194448..196355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0173"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ajs:Ajs_0155 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31658"
FT                   /db_xref="GOA:B9MAL1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAL1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACM31658.1"
FT                   /translation="MDVSGLLAQLLNGLAGASTLFLVAAGLSLIFGVMRIVNFAHGSFY
FT                   MLGLYLAYALVERLGDALGFWPALLLAPLAVGLLGAAVEVLLLRRIYRAPELLQLLATF
FT                   ALVLVIKDAALWLWGPEELFGPRAPGLEGAVDLLGRRFPAYDLFLIAVGPLVLVLLTLL
FT                   LTRTRWGTLVRAATQDREMVGALGVNQAWLFTSVFALGALLAGLGGALQLPREPASLEL
FT                   DMLTIGAAFVVVVVGGMGSLPGAFVAALVIAELKAVCIWLGVVEVAGVEVAFPRLTLVV
FT                   EFLVMAAVLIWRPWGFMGRPQAVARGVGTPEAPLRQAGQGATAAWCALVLALALLPLAV
FT                   EPGSYATVLLTDIAIAALFAASLHCILGPGGLHSFGHAAYFGLGAYGAALLVRWLDWPM
FT                   GMALLLGPLVAAAGALVYGWFCVRLSGVSLTMLTLAFAQITWAIAYQWDGFTGGSNGIT
FT                   GVWPPQWAAQGAGFYWLVLALAVAGIYLLRRMLFAPLGWALRAARDSALRADAIGIDVR
FT                   GVQWAAFVVAGLLAGLAGALYVFSKGSVAPDALGVSRSVDGLVMVLLGGMQQLAGPVVG
FT                   AGVFTWLHDTVARSTDYWRALLGGIMLLLVLLFPQGISGFAQVWKALAAIKNKAQEGAP
FT                   "
FT   gene            196352..197104
FT                   /locus_tag="Dtpsy_0174"
FT   CDS_pept        196352..197104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0174"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ajs:Ajs_0156 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31659"
FT                   /db_xref="GOA:B9MAL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAL2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACM31659.1"
FT                   /translation="MSLLQVQELRKSFGGVQAVQGVSFALQAGELLALIGPNGAGKSTT
FT                   FNLVGGQLLPDAGRVLLQGQDITGLAPRAVWRRGVGRTFQIAQTFASFTVLQNVQMALL
FT                   SHDRQAWRWWRRADAHRPHDALALLEQVGMAAQAQRPCSALAYGDVKRVELAMALAHAP
FT                   ALLLMDEPTAGMAPAERLALMQLVQRIARERHMGVLFTEHSMDVVFGLADRVAVLVRGQ
FT                   LLAEGTPQQIQDDARVQAAYLGTELESA"
FT   gene            197101..197880
FT                   /locus_tag="Dtpsy_0175"
FT   CDS_pept        197101..197880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0175"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ajs:Ajs_0157 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31660"
FT                   /db_xref="GOA:B9MAL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAL3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACM31660.1"
FT                   /translation="MNNQNDSASRLPDKALVAKTPLLEVADLHAWYGAAHILHGVSLSV
FT                   GHGEVVALMGRNGAGKSTTLKGIAGLMERRSGRIEFLGQRIDRQPPHAIARRGLGYVPE
FT                   DRRIFTDLTVLENLEVGRQRPRHWPDGTPAPLWTPERLFTLFPNLGEMPDRPGGRMSGG
FT                   EQQMLTVARTLMGQPLLVLLDEPSEGVAPVIVQQMARTIRALKAQGIGILLSEQNLPFA
FT                   EAVADRACVLEQGRIVYSAGMAQLAGDAAARRQYLGV"
FT   gene            complement(197911..198828)
FT                   /locus_tag="Dtpsy_0176"
FT   CDS_pept        complement(197911..198828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0176"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ajs:Ajs_0158 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31661"
FT                   /db_xref="GOA:B9MAL4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAL4"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACM31661.1"
FT                   /translation="MSPFDRMHIFARVAELASFTQAAEALGIPKASASTAVQQLETQLG
FT                   TRLLHRTTRRVQLTQDGQAYYERCKDLLADVDELQSMFQHPDGAGLKGRVRIDMSTGMA
FT                   RNVVVPRLPELLARHPGLKVELSSTERRVDVVREGFDCVLRTGAVVDSSLVARPLGLVR
FT                   LVNCASPAYLRAHGTPRSLADLPGHRLVHFVNTLGARSAGFEAVVDGALVLTPMQGALT
FT                   VNNAEAYMAGCLAGLGLIQVPHLGVVDLLARGDLVEVLPQLAAPPMPLTLMYANRRNLP
FT                   RRVRTVMDWLAQVVAEHLAQVAAA"
FT   gene            198938..199747
FT                   /locus_tag="Dtpsy_0177"
FT   CDS_pept        198938..199747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0177"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ajs:Ajs_0159 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31662"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAL5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACM31662.1"
FT                   /translation="MAHAASSSSSTVTAGIATRPVIALITGGSRGLGRNAALHVARSGT
FT                   DVILTYRSQAAEAQAVVAEIEALGRRAVALPLDVAASATFTAFAGQVRDVLARHWQRER
FT                   FDFLVNNAGVGVYASFMETTEAQFDDMVNIHLKGVFFLTQKLLPLMNDGGRILNVSSGL
FT                   ARFALPGYAAYAAMKGGVEVLTRYLAKELGARGIAVNVVAPGAIETDFGGGAVRDNAQL
FT                   NAFIAGQTALGRVGLPDDIGGVIAALLQPGTGWVNAQRIEASGGMFV"
FT   gene            complement(199876..201621)
FT                   /locus_tag="Dtpsy_0178"
FT   CDS_pept        complement(199876..201621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0178"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; SMART: histidine kinase HAMP
FT                   region domain protein; chemotaxis sensory transducer; KEGG:
FT                   ajs:Ajs_0160 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31663"
FT                   /db_xref="GOA:B9MAL6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAL6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACM31663.1"
FT                   /translation="MKNLSIGTRLGGGFALVLLLMALMTAFGVWRLQTVAQATNEMTQQ
FT                   PLAVERMISDWYRYVYSAARRTSAIVKSTDPSLGQFFAADTATSTRESAELQKRIETLL
FT                   TSEEEKALWADIQKARVTYLSSRDQAVKAKAEGQLEEAERLLTQVYLPATDQYVALIQR
FT                   LLDMQRSRIDATAQGINVTYGQSRLWLIVLGVLGLGAGALCAWWLTRGITRPLAQAVQV
FT                   ARAVAANDLTSRVQVDSRDETGQLLQALQEMNASLSQVVARVRSGTDGIATASSQLDAG
FT                   NQDLSSRTEEQASSLQETAASMEQLTSTVRQNADNARQANQLASSAAQTATQGGQVVAG
FT                   VVQTMGAINASSRKISDIIGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRA
FT                   LAQRSAAAAKDIKGLIGDSVAKVEEGSHQVEEAGRTMDAIVQSVQRVSDLVAEITAASQ
FT                   EQSAGIEQVHQAITQMDQVTQQNAALVEEATAATGSLKAQAGQLAQAVSVFRVEGLQAA
FT                   QTATATATAAAAPAPLRRPAPATTTTTTKPPAAARTLAAPARPPAAAKAAPATARHSDD
FT                   DWEAF"
FT   sig_peptide     complement(201511..201621)
FT                   /locus_tag="Dtpsy_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.538 at
FT                   residue 37"
FT   gene            complement(201667..203205)
FT                   /locus_tag="Dtpsy_0179"
FT   CDS_pept        complement(201667..203205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0179"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: ajs:Ajs_0161 Mg chelatase, subunit ChlI;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31664"
FT                   /db_xref="GOA:B9MAL7"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAL7"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ACM31664.1"
FT                   /translation="MSLALVQSRALLGLHAPAVTVEVHLANGLPSFALVGLADVEVKEA
FT                   RERVRSALQNAGLEFPANKKITVNLAPADLPKDSGRFDLPIALGILAASGQIDAARLDG
FT                   WEFAGELSLSGLLRPVRGALATSLALRALAQPVRTVLPPGSAEEAALVPGTEIYRAHHL
FT                   LDVVRQFVPVPPPNDDGADDGGWQRLQPAPPAPATDGPDLADVKGQAAAKRALEIAAAG
FT                   GHGLLLVGPPGSGKSMLAQRFAGLLPPMGVEQALESAAIASLAGRFSPAQWMQRTTASP
FT                   HHSCSAIALVGGGSPPRPGEISLAHEGVLFLDEFPEFARSALEALREPLESGRITIARA
FT                   AQRAEFPARFQLVAAMNPCPCGFAGSHQRACRCTPDQIARYQGKLSGPLLDRIDLHVEV
FT                   PALPPEELLGAPPGEPSGAVRERVARAHERALQRQGKANQALQGQELEQMAALDAPAAR
FT                   FLQAAAARLAWSARSTHRALKVARTIADLSGCETVGAAHVAEAVQYRRALRAPA"
FT   gene            203424..204155
FT                   /locus_tag="Dtpsy_0180"
FT   CDS_pept        203424..204155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31665"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAL8"
FT                   /inference="protein motif:PFAM:PF09694"
FT                   /protein_id="ACM31665.1"
FT                   /translation="MHRFSLKTLALAFAAVAVPGLASAQLTANVSLTSNYKFRGQDQDV
FT                   NRIKAVNPAIQGGFDYSFGDSGFYVGNWNSSVDWLSGNSIEADFYGGYKFKAGEVDLDV
FT                   GALTYVYPGNTSGNTTELYGAATYGPFTAKYSHTVSKDYFGWAGAKTSSNRGRNTGYLN
FT                   LAFAQEVAPSVTLKASVGYTRFASDIKDLGVPNYVDYSVGGAYDFGAGLSLSAAIAGAN
FT                   KKGFFGDANKARLIVSLTKTL"
FT   sig_peptide     203424..203498
FT                   /locus_tag="Dtpsy_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 25"
FT   gene            204176..204514
FT                   /locus_tag="Dtpsy_0181"
FT   CDS_pept        204176..204514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0181"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   ajs:Ajs_0163 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31666"
FT                   /db_xref="GOA:B9MAL9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAL9"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ACM31666.1"
FT                   /translation="MKMVTAIIKPFKLDEVRESLSDIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVADELVERVIEAIEGAARTGKIGDGKIFVAHLEQVVRIRT
FT                   GETGQEAL"
FT   gene            204561..205982
FT                   /locus_tag="Dtpsy_0182"
FT   CDS_pept        204561..205982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0182"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: ajs:Ajs_0164 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31667"
FT                   /db_xref="GOA:B9MAM0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAM0"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ACM31667.1"
FT                   /translation="MKKLFASLLIGASLLAGGAGALAQTPDAAAAASEPVAVAPAPAAE
FT                   PVAAPAAAPAPAPAAAAPAAPKVDSGDTAWMLTSTLLVILMIIPGLALFYGGLGRTKNM
FT                   LSVLMQVFVIFALVSLLWSIYGYSLAFSGEGQFVGNLSKLFLKGVSQETFGALATIPEY
FT                   VFIAFQGTFAAITVALIVGSFAERMRFAAVLIFALLWFTFSYVPMAHIVWGGGLLAADG
FT                   ALDFAGGTVVHINAGIAGLVGAYMVGKRIGFGKEAFTPHSLTLTMVGASLLWVGWFGFN
FT                   AGSAGAANALAGLAFVNTVLATSAATLSWIAGEALHKGKASMLGAASGAVAGLVAVTPA
FT                   AGFVGPMGSIAIGLIAGLVCLWGVGGLKKMLNVDDAFDVFGVHGVGGIVGAILTGVFAA
FT                   QGLGGTGGLTPDTFSMGAQVWVQVKSVLFTIVWSGVVSFIAYKVADLLVGLRVSEEAER
FT                   EGLDITSHGETAYHR"
FT   sig_peptide     204561..204632
FT                   /locus_tag="Dtpsy_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 24"
FT   gene            206122..207072
FT                   /locus_tag="Dtpsy_0183"
FT   CDS_pept        206122..207072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0183"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: ajs:Ajs_0165 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31668"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAM1"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ACM31668.1"
FT                   /translation="MNTAWTPLAAAPAQLGESPFWHPLESRLYWVDIAGRALWRSGAHG
FT                   SDAQCWPLPAEPGCIAPARQGGTPAGLVVALRDRICHAPRWGGPLLTMAHLPIDPATER
FT                   ANDGKCDALGRLWVGTVHEPAQGPRQPVAALYCIDLRGRDQGGPDAPTVRRMLDGVATA
FT                   NGLAWSPDGRTLYWSDTPSHTIRAWDCNAQLEPIGAPRVLHRFATRDEAVPYGGRPDGA
FT                   AVDAEGAYWCALYEGARVLRLSPRGEVLAELPTPLSCPTMPCVGGPDGHTLFVTSARKG
FT                   RSADELARWPQSGQVLSTRVAVAGLPVAWCEIGQR"
FT   gene            207176..208285
FT                   /locus_tag="Dtpsy_0184"
FT   CDS_pept        207176..208285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0184"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ajs:Ajs_0166 FAD linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31669"
FT                   /db_xref="GOA:B9MAM2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAM2"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ACM31669.1"
FT                   /translation="MDAALRQIIDRVRDSADRRSAVRICGGGTKDFHGPGAPQHAGEPL
FT                   DMRPLAGIVSYEPSELVVTALAGTPLAELEALLARHGQSLPFEPPRFAEGGTVGGMVAA
FT                   GLSGPARASVGAVRDYVLGVEIINGRGELLRFGGQVMKNVAGYDVSRLMAGAWGQLGVI
FT                   TEVSLKVLPVPPAEATLRFDCDQAEALRRLNAWGGQPLPLNASCWVEDAGRGQLYVRLR
FT                   GAQAAVQAACRSMGGELQDAPTVPDDWQACRDQRLPWFAARAADHALWRLSVPQTAPVL
FT                   ALPAGVAPPLVEWHGGLRWVQALPQHGDALHALAAEVGGSASLFIAASADGISARAIFD
FT                   ANSAALAAIHQRLKQAFDPAGIFNPGRLV"
FT   gene            208288..209085
FT                   /locus_tag="Dtpsy_0185"
FT   CDS_pept        208288..209085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0185"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   ajs:Ajs_0167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31670"
FT                   /db_xref="GOA:B9MAM3"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAM3"
FT                   /inference="protein motif:PFAM:PF06912"
FT                   /protein_id="ACM31670.1"
FT                   /translation="MRLLRHLTGRHRTTVTNRTLGLLLAFNAGAINAGGFLVVHMYTSH
FT                   MTGFLSLVADNLVLGNMTLVLSAIGTLWAFMSGAGSTAILVNWARHQHLRSGFALPLLL
FT                   EAVLMLLFGLMGAITLGWRTPFAVPLTVLLLAYIMGLQNAVVTKMSSAQIRTTHMTGIV
FT                   TDLGIEMGKALYWNRSGTPRESQVHANQTRLRMFASLLGMFTAGGVVGAAGFKYVGFIW
FT                   VVPLASILLALSLPPLAADRQRLAQLWRARRAPAPAEDAPARR"
FT   sig_peptide     208288..208389
FT                   /locus_tag="Dtpsy_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.811 at
FT                   residue 34"
FT   gene            209111..210349
FT                   /locus_tag="Dtpsy_0186"
FT   CDS_pept        209111..210349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0186"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: ajs:Ajs_0168 glycolate oxidase
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31671"
FT                   /db_xref="GOA:B9MAM4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAM4"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACM31671.1"
FT                   /translation="MQTQLAPQYQGTPEGQEAEAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGAEPTRKTQLHLDRCLTCRNCESTCPSGVQYGHLVDIGRRIVEE
FT                   KVPRPRGEAAARWMLKEGLPSPLFAPAMKVGQAVRGLLPERLRAKVPPRQDAGAWPTRS
FT                   HARKVLMLEGCVQPSMAPNINNATARVLDAAGIQTVVAREAGCCGAVKFHLNDQEGGLA
FT                   QMRANIDAWWPYVERGEVEAIVMNASGCGVTVKEYGHLLRNDAQYAEKAARVSALTRDL
FT                   SELLPDLVERLRGRIQPPAAPLAYHPPCTLQHGQKLRGGVERHLAALGFELRVARTESH
FT                   LCCGSAGTYSVLNPELSYQLRDRKLGALGEAFTEQPPAAILSANMGCITHLQSGTGIPV
FT                   KHWVEVLDAALLA"
FT   gene            210411..211280
FT                   /locus_tag="Dtpsy_0187"
FT   CDS_pept        210411..211280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0187"
FT                   /product="ProQ activator of osmoprotectant transporter
FT                   ProP"
FT                   /note="PFAM: ProQ activator of osmoprotectant transporter
FT                   ProP; KEGG: ajs:Ajs_0169 ProQ activator of osmoprotectant
FT                   transporter ProP"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31672"
FT                   /db_xref="GOA:B9MAM5"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAM5"
FT                   /inference="protein motif:PFAM:PF04352"
FT                   /protein_id="ACM31672.1"
FT                   /translation="MNDTVNAPAPIHEEGVPPIAAAVPAAEGHATPESPASASPAPAAD
FT                   SGAARAPRANRRGGRGRAGGRRESGAQATGDAPQAGAKGGPAAGAPRRTHPLLEQLAGW
FT                   YPHLFGAQFLPLKRGIFQDLLAAHGEAIDKDALKLALSIHTRSTRYLNAVAQGMKRHDL
FT                   QGQPVEDMAPEHVHHALLEVFRRRKPQDGEDLTAKLRRRIAQAFEASGLTREAYDALVR
FT                   GRDEKANALLDEAFAEVAERDAKAEALLRAFEASGQTPEAFADMYGLPARQAAQMLERA
FT                   RQRRAPGA"
FT   gene            211380..211769
FT                   /locus_tag="Dtpsy_0188"
FT   CDS_pept        211380..211769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0188"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ajs:Ajs_0170
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31673"
FT                   /db_xref="GOA:B9MAM6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAM6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACM31673.1"
FT                   /translation="MTTPSSSQAINWFEIPCADLGRAQSFYERMLDRPMRREDFGSEPM
FT                   ALFSKDDPATGGCLVAGPQRRAAPDAGVRIYLDCEPSVEAALARVVPAGGQVVDACTQL
FT                   PQGMGYIAHVRDTEGNTICLHAMAR"
FT   gene            211862..212332
FT                   /locus_tag="Dtpsy_0189"
FT   CDS_pept        211862..212332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0189"
FT                   /product="transcription activator effector binding"
FT                   /note="PFAM: transcription activator effector binding;
FT                   KEGG: ajs:Ajs_0171 transcription activator, effector
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31674"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAM7"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ACM31674.1"
FT                   /translation="MTPITVQVPAFSVAGVAVRTCNRDEAQPERARIGALWDQFFTESW
FT                   ARQLPGPGADGRLYGVYSAYESDQHGAFDVTAGVSAAVQADPPVGAARIEVQPGSYLVF
FT                   HCEGPMPQMVLDAWAAAWRYFEEHPEVRRRFDTDFECYEGPECVALHIGVLL"
FT   gene            212410..213138
FT                   /locus_tag="Dtpsy_0190"
FT   CDS_pept        212410..213138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0190"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   ajs:Ajs_0172 helix-turn-helix, type 11 domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31675"
FT                   /db_xref="GOA:B9MAM8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAM8"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ACM31675.1"
FT                   /translation="MRRADRLFQIVQLIRGRRLSTAAFLAGRLEVSLRTIYRDVADLQH
FT                   QGIPIEGEAGVGYRLGAGFELPPLMFSQGEANALVAAARLAQTWVDGGMAREIEGALGK
FT                   ILSVLPPAARAAAEAQALYAPGSGLDTRAQAALQALREAVQSCHVVRLDYADVQGRPSL
FT                   RRVRPLGCFYWGKVWTLSAWCELRDDFRGFRIDRIAAFEVLDERFRQEPGKTLADLLRQ
FT                   VEARMRDCPAEGLDGAAFSS"
FT   gene            complement(213405..213890)
FT                   /locus_tag="Dtpsy_0191"
FT   CDS_pept        complement(213405..213890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0191"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="PFAM: glutathione peroxidase; KEGG: ajs:Ajs_0173
FT                   glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31676"
FT                   /db_xref="GOA:B9MAM9"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAM9"
FT                   /inference="protein motif:PRIAM:1.11.1.9"
FT                   /protein_id="ACM31676.1"
FT                   /translation="MTTAYDFDATRIDGAPQPLSDFRGQVLLIVNTASACGFTPQFTGL
FT                   QALHERYGPRGLVVLGFPCNQFGHQDPGSNDAIAGFCQRNYGVQFPMMSKIDVNGSDAH
FT                   PLYRWLTGEAPGVLGTKAIKWNFTKFLVGRDGQVIRRYAPQEAPEKLTVDIEAALAA"
FT   gene            complement(213887..214828)
FT                   /locus_tag="Dtpsy_0192"
FT   CDS_pept        complement(213887..214828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0192"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ajs:Ajs_0174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31677"
FT                   /db_xref="GOA:B9MAN0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAN0"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACM31677.1"
FT                   /translation="MQSPLPALALLFNAFIWGLSWWPFRQMHGAGLHPLWATALMYGAI
FT                   LLVLLALRPGISAQLRQHRSLWLLALCSGLNNVAFNWAITIGDVVRVILLFYLMPAWSV
FT                   LLAWRFLGERPTPQALARLLLAFSGVLLVLWPAEGGLPRLLAALTLADLLAILGGFTFA
FT                   VTNVTLRRLHAVPGQARMVAMFGGCMLMALLAAQLGRSMGLVPPFPPLSATWAWVAALL
FT                   AVVLLIGNWALQFGAARLAAGTTAIIMLSEVVFASGSSTLLGAAQLTGGTLAGGALILL
FT                   AAGWSVWRPRVHAAGTPHAPSDKVTDTRPEAP"
FT   gene            complement(214980..216257)
FT                   /locus_tag="Dtpsy_0193"
FT   CDS_pept        complement(214980..216257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0193"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ajs:Ajs_0175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31678"
FT                   /db_xref="GOA:B9MAN1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAN1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACM31678.1"
FT                   /translation="MKRGFYTIMSAQFFSSLADNALFVTAVELLRTSGAPEWQRAALVP
FT                   MFALFYVVLAPWVGAFADSMPKGRVMFISNAIKVVGCLMMLFGHHPLLAYAVVGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTIASIILGVLVGGQLVAPHIASHLLALDMPG
FT                   IDLGIDLAAEAAILALVPVYMLAAWFNLRIPHTGVEMRPLPPNPLALLPDFWTCNGRLW
FT                   RDKLGQISLSTTTLFWGVSGNLRYIVLAWSAAALGYSTTQASALVGVVAIGTAAGAVAA
FT                   SLHMRLDMATRVIPMGIAMGLLVILMNVISNIWLAIPFLILLGGLGGFLVVPMNALLQH
FT                   RGHNLMGAGRSIAVQNFNEQAAILGMGAFYSLSTKFGLSAFGAITAFGMLVAGVMWLIG
FT                   RWHAHNVRSHPEEVEHLLSIARHDHH"
FT   sig_peptide     complement(216201..216257)
FT                   /locus_tag="Dtpsy_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.632 at
FT                   residue 19"
FT   gene            216398..217495
FT                   /locus_tag="Dtpsy_0194"
FT   CDS_pept        216398..217495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0194"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: ajs:Ajs_0176 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31679"
FT                   /db_xref="GOA:B9MAN2"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MAN2"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ACM31679.1"
FT                   /translation="MPRPILATIHPAAVHHNLERARRAAPDARVWAVVKANAYGHGIER
FT                   VFEGLRAADGFALLDLAEAERVRALGWRGPILLLEGVFEPRDLELCSRLGLWHAVHCDA
FT                   QIDWLAAHKTQVPHRVFLKMNSGMNRLGFTPERYRSAWARLNALPQVDEISCMTHFSDA
FT                   DGPRGIAHQVQAFQTATRDLPGERCIANSAALLRHGGDAQVRLDWVRAGIVLYGSAPDH
FT                   PERRAADWDLQPTMTLASRIIGVQQLQAGDTVGYGSRFTAQGPLGIGVVACGYADGYPR
FT                   HCDTGTPVLVNGVRTRTIGRVSMDMLAVDLTPVPGAGLGAEVTLWGRAANGAVLPIDEV
FT                   AQAGGTIGYELMCALAPRVPVVVQD"
FT   gene            217504..218337
FT                   /locus_tag="Dtpsy_0195"
FT   CDS_pept        217504..218337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31680"
FT                   /db_xref="GOA:B9MAN3"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACM31680.1"
FT                   /translation="MVRVRGRTGASWRGMRLPQRLQEGLRQRHALRLHGWCIGSLILGV
FT                   MWAVSHAQMALGMPSLALRYLVTLGVGYGVYLLVLRLWAAWLLRRRSDAGDAPDGLDLL
FT                   PDAGWPAGPGPQGPAPPLHGGGGDFGGAGATGQWDAPAADGAGGTGWGGDLGDAASGAL
FT                   EAAGSADEAAVVVVPVVAIFVVGVALLGGAGALAWLYFGSEVLLAVAVELAFSVASARA
FT                   LMGAERAGWLGAAWRMTGKPLLGALLCAVALGAALDHWLPQARSLPHAVQLLRGR"
FT   gene            218574..219593
FT                   /locus_tag="Dtpsy_0196"
FT   CDS_pept        218574..219593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0196"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   rme:Rmet_4968 di-haem cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31681"
FT                   /db_xref="GOA:B9MAN4"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAN4"
FT                   /inference="protein motif:PRIAM:1.11.1.5"
FT                   /protein_id="ACM31681.1"
FT                   /translation="MQSQSPSSRPAARFFLGIVSAAALLSMGSAGAQEPVQPIVPHKVT
FT                   NPAQVTLGKKLWFDPRLSRSGFISCNSCHNLSMGGSDNLKTSIGDKWQKGPINSPTVLN
FT                   SSLNLAQFWDGRAKDLKEQAGGPIANPGEMAFSHDLAVDMLRSIPQYVAEFKRVFGHDK
FT                   LTIDEVTAAIAAFEETLVTPNARFDQWLKGDKKAITAQELRGYQLFKTSGCVACHNGPN
FT                   LGGNSFQKMGLVEAYKTDNPAEGRSAVTGNDAERFNFKVPTLRNVELTYPYFHDGAADT
FT                   LAEAVDTMGRIQLGKKFTAQENADIVAFLKTLTGDQPRISLPILPPSSDATKRPQPFD"
FT   sig_peptide     218574..218672
FT                   /locus_tag="Dtpsy_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 33"
FT   gene            complement(219687..220301)
FT                   /locus_tag="Dtpsy_0197"
FT   CDS_pept        complement(219687..220301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0197"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ajs:Ajs_0178 glutathione S-transferase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31682"
FT                   /db_xref="GOA:B9MAN5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAN5"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACM31682.1"
FT                   /translation="MTSLTLYFTPGTCAQAVRIALEEAQAPYTLVRVDFASQQQRSPEY
FT                   LAVNPKGRVPALVTEHGTLTETPALLAYVAQRFADARLAPADPFGFARMQEFHSYLAST
FT                   VHIAHAHRPRASRWADEPEAQAAMQRKVPANMTECFTLIERHYLGDGPWVLGEQYSVAD
FT                   GYLFTVASWLKSDGVDIAQFPKVHAHSQRMAQRPAVQRALA"
FT   gene            complement(220450..220632)
FT                   /locus_tag="Dtpsy_0198"
FT   CDS_pept        complement(220450..220632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31683"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAN6"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0179"
FT                   /protein_id="ACM31683.1"
FT                   /translation="MPLPTLRPLAAPLLTACALALAACDKKPADPPHLPSVPAVPKPSA
FT                   PAAPLPGAQPASVGS"
FT   sig_peptide     complement(220561..220632)
FT                   /locus_tag="Dtpsy_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.760 at
FT                   residue 24"
FT   gene            220742..222124
FT                   /locus_tag="Dtpsy_0199"
FT   CDS_pept        220742..222124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0199"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: ajs:Ajs_0180 DNA repair protein RadA; TIGRFAM:
FT                   DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31684"
FT                   /db_xref="GOA:B9MAN7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAN7"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACM31684.1"
FT                   /translation="MAKEKTIFSCTECGGTSPRWLGKCPSCGAWNTLIESVPDAGPGKN
FT                   RLSGAGQYAGLAQAQAVMPLAAIEATEVARTASGIEELDRVLGGGVVEGGVVLIGGDPG
FT                   IGKSTLLLQAMDALQRAGLPTLYVTGEESGAQVALRSRRLGLDASQVNVLAEIQLEKIL
FT                   ATVEATQPAVCVIDSIQTVYSDQLTSAPGSVAQVRECAAHLTRMAKATGIAVILVGHVT
FT                   KEGALAGPRVLEHMVDTVLYFEGDTHSSFRLVRAIKNRFGAVNEIGVFAMTEKGLKGVA
FT                   NPSAIFLSQHSEPVPGSCVLVTLEGTRPMLVEIQALVDGGGPSPRRLSVGLERDRLAML
FT                   LAVLHRHAGVACADQDVFVNAVGGVRISEPAADLAVMLAITSSLRGKALPKGFIAFGEV
FT                   GLAGEVRPAPRGQERLKEAAKLGFTVAVVPKANAPKKPIAGLEIHAVERVDEAMTAVRG
FT                   LD"
FT   gene            222194..222634
FT                   /locus_tag="Dtpsy_0200"
FT   CDS_pept        222194..222634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31685"
FT                   /db_xref="GOA:B9MAN8"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAN8"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0181"
FT                   /protein_id="ACM31685.1"
FT                   /translation="MNLRKILIPAGIVVLVIAAYRAYGPQGILTVSGGLVMWGLLHYTR
FT                   LMNVMQKARNHPIGYVGSAVMLNAKLKAGVNLLHVVAMTRALGQQLSADGQQPELYRWT
FT                   DGTQSHVTCEFVNGRLVRWELVRPASQEDAGPPAAANPADES"
FT   sig_peptide     222194..222262
FT                   /locus_tag="Dtpsy_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.707) with cleavage site probability 0.676 at
FT                   residue 23"
FT   gene            222681..223619
FT                   /locus_tag="Dtpsy_0201"
FT   CDS_pept        222681..223619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0201"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: ajs:Ajs_0182
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31686"
FT                   /db_xref="GOA:B9MAN9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAN9"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ACM31686.1"
FT                   /translation="MSPVVPSMADRDGKIWMDGQMVDWRDAKIHVLTHSLHYGCGAFEG
FT                   VRAYKTEQGTAIFRLEEHTNRLFNSAKILRMTIPFTKDEVNEAQKAVVRENQLESCYLR
FT                   PLTWIGSEKLGVSPKGNKIHLIVAAWAWGAYLGEEGMQRGIRVKTSSFTRHHVNITMTQ
FT                   AKASSNYTNSILANTEATDDGYDEALLLDNAGFVSEGSGENVFIIKDGVVYTPDLSAGA
FT                   LNGITRNTVLHICKDLGLEVVQKRITRDEVYIADEAFFSGTAAEITPIRELDRVQIGSG
FT                   SRGPLTEKIQSAFFDIVNGRNPKYAHWLTKV"
FT   gene            223626..223832
FT                   /locus_tag="Dtpsy_0202"
FT   CDS_pept        223626..223832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31687"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAP0"
FT                   /inference="similar to AA sequence:KEGG:Aave_0265"
FT                   /protein_id="ACM31687.1"
FT                   /translation="MSQAIVELLAQDLNPQGGVYCPSPKADMKLWNGHPKVYLDVAHTG
FT                   EAKCPYCGTVYRLKAGEVFAGGH"
FT   gene            complement(223878..224813)
FT                   /locus_tag="Dtpsy_0203"
FT   CDS_pept        complement(223878..224813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31688"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAP1"
FT                   /inference="similar to AA sequence:KEGG:Daci_0318"
FT                   /protein_id="ACM31688.1"
FT                   /translation="MTRIPASLFKGVLQLVQPSNLKGSAGYETPAPVMLSGQEDAPEES
FT                   QSIPRILWTYWNQAQPDEFVCECIQSWRLQCPDYEVRLTHPGNLDTYVAAGDLPAQFAQ
FT                   MHPTKQADWLRLYLVAHHGGFWLDASTLLTRSLDWLESPFDAAAEFVGFYLEKFTREAR
FT                   FPVIESWAFGARRDSAFITAWQREFHQALVVEGTQDYLKRQQDLSALRQGIEDPHYLLI
FT                   HITAQKVLRSQEFTRLALYKAEDTAYYYHQSLRWKWYLLYPQLCRVDAPKISAPIVKLR
FT                   GGERRHFTEMFGSHGGAVPGSIWHRAFQRP"
FT   gene            224883..226016
FT                   /locus_tag="Dtpsy_0204"
FT   CDS_pept        224883..226016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0204"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ajs:Ajs_0185 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31689"
FT                   /db_xref="GOA:B9MAP2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAP2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACM31689.1"
FT                   /translation="MENNLTAAHKPVAQCPTRVLHFVTGGFSGATQVAIDLCLAAQKCP
FT                   DMEVMLVLRRKRSTSEAKVQALRDQGLQVHVVSNWLHVLTIWELRKLIRAWKPDVVFAH
FT                   GFSDHIWGRRAAVAEGVPQIFHVEHNSRERYTRRRLKQALALAPFTQASIGVSEGVRTS
FT                   LIQRGFPSDRCVAICNGIDLARFPQDMLPARWEDREAAILMASRFARQKDHVTLIQALG
FT                   LLRQQGLAPRLYLAGAGSKLQRQQAERLVRQLGLQDQVHFLGNVSNLPQRLAHTQIFVL
FT                   STHWEGMPLALVEGMAAACACIGSDVLGVREVIAHEINGLLVPQSDASAMAAALQRLLQ
FT                   NPALARQLGEAARRQALIAHGREHMWEHYRALLVKPG"
FT   gene            complement(226035..226793)
FT                   /locus_tag="Dtpsy_0205"
FT   CDS_pept        complement(226035..226793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0205"
FT                   /product="glycosyl transferase family 25"
FT                   /note="PFAM: glycosyl transferase family 25; KEGG:
FT                   sdn:Sden_0207 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31690"
FT                   /db_xref="GOA:B9MAP3"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAP3"
FT                   /inference="protein motif:PFAM:PF01755"
FT                   /protein_id="ACM31690.1"
FT                   /translation="MSNIPIVYINLAKDTERQQRMQAQFSRLGLETFRLPAVRWSELSA
FT                   EAQAHHFSAELNSHQYFKPMGSGEKGCYCSHITAWRQLLDSAAAAMAVFEDDVRLLPAM
FT                   PEALRAISTLPADCWDMVKLFGREREKIASRRPLVGSLELITYRRVPSFAAGYVISRSG
FT                   ARKMLESRQPFGRPVDVDMRFWFENGMRVFGVHPSVVALDDTSKVSSIWPDREPRALIM
FT                   QRLRKLKMKMELIWGNARHESDAPHVSETL"
FT   gene            226830..228164
FT                   /locus_tag="Dtpsy_0206"
FT   CDS_pept        226830..228164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0206"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: ajs:Ajs_0184
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31691"
FT                   /db_xref="GOA:B9MAP4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAP4"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACM31691.1"
FT                   /translation="MSPYKNFENWGGSLSAFLFFSLSLIVPSGYSYGAAALALLALAGC
FT                   LQKGSHGVASLDTKILLASLCLTGMLWTAPFDRAWSISGLGIGAKYAFAALTLWALSQR
FT                   VLSPHAVVWGVAAGAVGALGIAAYQYLVLHWVKAQGFTNAIEYGGIAMYMGIAAWAMAM
FT                   LGRWRWHQIAALGICGACGVLASLLSESRGSWVTVPLLLAAIWLMAWRNGYRRIASAAI
FT                   AAMLIGGAALVLPAYKKFEQRADLAVQEARHYLAEPQKYAETSIGQRLEQWRLAVDLIE
FT                   ERPVAGWGLDGYPKAKQAMVDKGAAHPSVMQYGHAHNEILDMWVKRGLIGLLILLFFYA
FT                   APLYVFWPTPRRLARVDTTLQPRLLALRAAAALLPLAYFGFGWTQVFFAHNSGQMFYIF
FT                   SLAIFWGAICYLEKTEANTWVVSGHGEVQHKARPVYPNGLRCPLN"
FT   sig_peptide     226830..226931
FT                   /locus_tag="Dtpsy_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.932 at
FT                   residue 34"
FT   gene            complement(228554..229624)
FT                   /locus_tag="Dtpsy_0207"
FT   CDS_pept        complement(228554..229624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0207"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   ajs:Ajs_0188 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31692"
FT                   /db_xref="GOA:B9MAP5"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAP5"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACM31692.1"
FT                   /translation="MNALLQRLQIDLPLFQGPMTGSDTPQLAAAVSQAGGLGFLGCGMR
FT                   SPQAMREAAAAVRAATAKPFGMNLFVLEQPTPDAATVQAAIDRLAPLYADLGLPPPEAP
FT                   ARWCEDFHAQFEALLDARPAVASFTFGILSAAQVRRLKDEADSYVIGTATTLAEAQAWA
FT                   EVGADAVVASGMEAGGHRGTFLEDFEASMVGTLALVPQCVDALSIPVIAAGGIMDGRGI
FT                   AAAQALGAQGVQLGTAFLACPESAIGPAQRTAMAGAQATDTRVTRIYSGRPARGLVNAM
FT                   MERLAMHEAAVPAYPVQNALTGALRRAAAAQGRADYLSLWAGQGVGAARPLPAAQLVAL
FT                   LAQEWRDVSKSTAARH"
FT   gene            complement(229621..230517)
FT                   /locus_tag="Dtpsy_0208"
FT   CDS_pept        complement(229621..230517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0208"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ajs:Ajs_0189 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31693"
FT                   /db_xref="GOA:B9MAP6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAP6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACM31693.1"
FT                   /translation="MDLVALEIFRTVAHEGSVTRAAERLGRAQSNVTTRVQQLEEQLGA
FT                   ALFLREGRRMVLTPAGATLQGYAERLLALAEEARQALHPGTPAGHLRIGAMESTAAARL
FT                   PAPLAQLHARWPALVLELRTAPSRQLVEQVLAHELDCALVAWPPPGLDEEAPVQRTPVW
FT                   TESLLLALPASHPPVETPADLRVHTLAAFAHGCTYRRIGEDWMRQATGQAPQVLELASY
FT                   PAILACVAGGRCAGVVPEAVVDLLHTPPALRWVPLGPCDTVLVHRTGYATPALGRAASS
FT                   AARRPGPPRFFFAELTP"
FT   gene            230597..231865
FT                   /locus_tag="Dtpsy_0209"
FT   CDS_pept        230597..231865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0209"
FT                   /product="protein of unknown function DUF1228"
FT                   /note="PFAM: protein of unknown function DUF1228; KEGG:
FT                   ajs:Ajs_0190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31694"
FT                   /db_xref="GOA:B9MAP7"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAP7"
FT                   /inference="protein motif:PFAM:PF06779"
FT                   /protein_id="ACM31694.1"
FT                   /translation="MEPQATPSIDVPAPRGPALHWSERPHAVALAGMLALAVAMGVGRF
FT                   AFTPLLPMMLHDGVLTLTEGSWLATANYVGYLLGALACMALPWVAPGFYARWHPARLAR
FT                   AGLVATVLLTLAMALPVAAAWPALRFAAGAASAFVLLNVAAWCMVRLAVLGRPAMGGLI
FT                   FCGPGVGIVLTGLAASAMVAAQWRAASGWVVFGMLSVLLCVGVWPVVRGRAVKADPGAQ
FT                   PRAAAQGGNAGTLAARGVHAVAYGLAGLGYIVTATFLPVIARAALPSGSPWPDLFWPMF
FT                   GAGVAVGAALSTRAPSAWDRRWLLLAAYALQALGIVLGLVWPTPAGFALSSALVGLPFT
FT                   AITFYGLQEARRLWPQSADSFASLVTAVYGLGQIAGPPLVAWLLAHADAGQGFARGLAL
FT                   AAGALVAGAAMYGWSAWRWPQRA"
FT   gene            complement(231873..232601)
FT                   /locus_tag="Dtpsy_0210"
FT   CDS_pept        complement(231873..232601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0210"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   ajs:Ajs_0191 MOSC domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31695"
FT                   /db_xref="GOA:B9MAP8"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAP8"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /protein_id="ACM31695.1"
FT                   /translation="MNMTPLPSQPTALGTLRAVLTGRAQPYTRPGSRSAIAKQQRSGPV
FT                   AVGAQGLEDDEQGDLRVHGGPDKAVHCYAWPQYTPWREELAGHAAAQALLAQPGAFGEN
FT                   FSLDGVQEAQVCIADQWRIGSAVFEVSQGRQPCWKLNDRFQVPDMALRVQRSLRAGWYL
FT                   RVLQPGTVQAGDTVWLLARPQPAWPIARLLEVIDRRDCTPATLREILALPLPPSWQRLF
FT                   QRRLDSGQSEAWDARLQGQH"
FT   gene            complement(232598..233161)
FT                   /locus_tag="Dtpsy_0211"
FT   CDS_pept        complement(232598..233161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0211"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: ajs:Ajs_0192 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31696"
FT                   /db_xref="GOA:B9MAP9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAP9"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACM31696.1"
FT                   /translation="MTAAAPFFAPAPPLQVAHWFNTPEPLTLDSLRGRVVVLHAFQMLC
FT                   PGCVEHGIPQARRVHEAFAQDQLVVIGLHTVFEHHAVQGTPEALQAFIHEYRLRFPIGL
FT                   DQPDTPRSIPRTMQSLSLSGTPSLVVLDPQGRVRLHHFGHLDDLRLGALLGRLLAEPTP
FT                   AAPATVPATGCDDGGCPLPDQPRP"
FT   gene            complement(233246..234472)
FT                   /locus_tag="Dtpsy_0212"
FT   CDS_pept        complement(233246..234472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0212"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   ajs:Ajs_0193 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31697"
FT                   /db_xref="GOA:B9MAQ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAQ0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACM31697.1"
FT                   /translation="MSLISPFSRRLYLRIWLAVVGGVLVFAFAVGMAWRWAAEQNQQQP
FT                   PSREIRITDAAGRTLVDGVGLRQRRDPSEGVLYRIESATGEVFEMHLSPRPPRPRPDER
FT                   GPAAWFRPPFGFLWMLALVGIAVTVGVFPIIRRLLQRLEQLQRSVQRFGEGDLSVRVAE
FT                   QGHDEVAALARQFNAAAARIETLVQSHKSLLANASHELRSPLTRIRMGLELMQGGTPSP
FT                   AFRAEIERNIAELDQLVDEILLASRLDSGAADVGTVEPVDLVGLAVEECVRVDAELHVG
FT                   SGDDADAMAAPVEVPGVSKLLRRAVRNLLENARRYSQGEITLTLTREGHDAVLRVCDHG
FT                   PGVPPAQRERIFEPFYRLPGASERSGGVGLGLALVRSIAARHGGSVVCEDRPDGAAGAC
FT                   FTLRLPVTR"
FT   sig_peptide     complement(234359..234472)
FT                   /locus_tag="Dtpsy_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.720 at
FT                   residue 38"
FT   gene            complement(234500..235216)
FT                   /locus_tag="Dtpsy_0213"
FT   CDS_pept        complement(234500..235216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0213"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: ajs:Ajs_0194 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31698"
FT                   /db_xref="GOA:B9MAQ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAQ1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACM31698.1"
FT                   /translation="MSSQLLMIEDDHRLAQMVGEYLGQSGLQVTHMADGASGLARLQAP
FT                   EGGQLPALVILDLMLPDIDGLEVCRRIRALPGAAAQVPVLMLTAKGDPMDRVIGLEIGA
FT                   DDYLPKPFEPRELLARIRAILRRRESGAQPATQVLRFGSLEIDRDARTVSVHGQPAELT
FT                   SYQFDLLVTMAERAGRVLTRDQIMEAVRGRELEAFDRSIDVHMGRIRAAIEADPKNPRR
FT                   ILTVRGVGYVFAKQQD"
FT   gene            complement(235337..236671)
FT                   /locus_tag="Dtpsy_0214"
FT   CDS_pept        complement(235337..236671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0214"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ajs:Ajs_0199 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31699"
FT                   /db_xref="GOA:B9MAQ2"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAQ2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACM31699.1"
FT                   /translation="MPPDAPASAAARRSWRQAWLVYLEPASLRMLALGFSAGLPLLLVL
FT                   GTLSFRLREAGIDRTTIGYLSWVGLAYAFKWVWSPLVDRLPLPLLTRWLGRRRSWLLLA
FT                   QGVVAAGLVGMALADPRQGLDAMVWCALLVAIGSATQDIALDAFRIESADTDHQAALAA
FT                   TYQTGYRLAMIWAGAGVLWVAARAEDASLSGYQAGAWTTAYLVMAASMLVGVVTVLLSP
FT                   EPTPRPLPPARNLGEWLHGAVVAPFADFIRRYRWQAALILALIAVYRISDVVMGIMANP
FT                   FYVDMGYTKDEVAAVTKVFGVVMTLAGAFVGGVLSMRLGVMRVLMLGAVLSALSNLLFA
FT                   WLGQRGHDLTGLVLVVSADNLAGGIASAAFIAYLSSLTNVQYSATQYALFSSMMLLLPK
FT                   WLAGFSGQFVDAQGYSAFFTGTALLGLPVLLLVALASRAQSASSA"
FT   gene            236733..237434
FT                   /locus_tag="Dtpsy_0215"
FT   CDS_pept        236733..237434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0215"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: ajs:Ajs_0200 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31700"
FT                   /db_xref="GOA:B9MAQ3"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAQ3"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACM31700.1"
FT                   /translation="MARSASALLHPVASVRHYGGEHQAHAHAHAQVLYALQGRMELEVA
FT                   GRAAFVDTACGMVVPAGTEHGYLARPDTRILVIDVPAQAAVDRVRRFAVPAAARTVPEP
FT                   GGAAARLALLLQAPRVLARRGLDLAALCAAVDAALHEDWPTARMARLFHLSAARFHARL
FT                   LELTGDTPQQWLRARRLDLAERALARGQSLEATALRCGYASASALAYALRRERGLGARA
FT                   LRIQAKTASSA"
FT   gene            237533..238438
FT                   /locus_tag="Dtpsy_0216"
FT   CDS_pept        237533..238438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0216"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ajs:Ajs_0201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31701"
FT                   /db_xref="GOA:B9MAQ4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAQ4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACM31701.1"
FT                   /translation="MNTASIRSIAMVLLAAMLWGTTGTAQSLAPAGLSPYWVGALRLVI
FT                   ASAFFALLAWPAWRARRGGGLRWGPVLLAGACVATYNLSFFAGVKSAGVALGTALAIGS
FT                   GPIWAGLLQTVAQRRLPAPVWWLGTLLGVAGGAAMALDGGSTVRAPWTGIALCLLAGLA
FT                   YAMYALTNKRLVAQAGAAVVNLAVFGTAGLLSLPVALLLGGAPTVAPGALGIVLYLGLV
FT                   ATGVAYLLFSTALRHISGATGVTLALAEPVTAFALAVAVVGESPSAMAYGGLAAVLAGL
FT                   LLVIWAELRTTRPAAGAAAA"
FT   sig_peptide     237533..237616
FT                   /locus_tag="Dtpsy_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.496 at
FT                   residue 28"
FT   gene            238553..238888
FT                   /locus_tag="Dtpsy_0217"
FT   CDS_pept        238553..238888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31702"
FT                   /db_xref="InterPro:IPR024446"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAQ5"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0202"
FT                   /protein_id="ACM31702.1"
FT                   /translation="MNHRQRAVAALLGLAAACAQAEVNVSVGIGLPGPIYAEPAPVYVA
FT                   PPPAYVVPRPVYAPRPVMVVPQPVYAPHWRDDDDDHDEWKKWRKRHHKEQKKAYKRWRR
FT                   EWEDNDD"
FT   sig_peptide     238553..238618
FT                   /locus_tag="Dtpsy_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 22"
FT   gene            238913..239848
FT                   /locus_tag="Dtpsy_0218"
FT   CDS_pept        238913..239848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0218"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: ajs:Ajs_0203
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31703"
FT                   /db_xref="GOA:B9MAQ6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAQ6"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACM31703.1"
FT                   /translation="MALCLPAYMQAVTRAARLLPMNSPTVSVPPLPVDAGCRCCAARGG
FT                   TWQARRAFVLAAAGTLVLPAAAQVEVGSASGMRRLVPAETLEDSAVQQYSQLLAQAKAK
FT                   RALAPDNHPQLLKLRAIARQIIPYAAQWNSRAAQWRWEVNLIGSKQINAFCMPGGKIAF
FT                   YTGILDQLKLTDDEIAMVMGHEMAHALREHARSRVAKSQATSIGLSLGAQLLGLGDLGN
FT                   AAANLGTQLLTLKFSRSDETDADLVGLELAARAGYNPQAAVSLWRKMGEATGNGGIAFL
FT                   STHPSGPDRIRELEQNVPKVQGLYQASRRG"
FT   gene            complement(239869..240411)
FT                   /locus_tag="Dtpsy_0219"
FT   CDS_pept        complement(239869..240411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: neu:NE1984 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31704"
FT                   /db_xref="GOA:B9MAQ7"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACM31704.1"
FT                   /translation="MSSGPPDLPTLAGGVGTSGALPVQRDTALMAAATVGVCIGCVAGL
FT                   SLTLAAAKWLPGRVQDMAAWHVGIYYAVFFASVVWAFFRGAARAAAPLLWLAVACTLAI
FT                   PASSLLGWLAPGAGAWADGALLGVDLTALAGALALAWMARATARRVRSGPRDSVWSAPR
FT                   RRKESESKKLQRLFHKR"
FT   gene            complement(240494..241132)
FT                   /locus_tag="Dtpsy_0220"
FT   CDS_pept        complement(240494..241132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0220"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ajs:Ajs_0228 beta-lactamase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31705"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9MAQ8"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACM31705.1"
FT                   /translation="MLHYRTLPVTAFQQNSSIVWCDETMDAAVIDPGGDLDALVAEVQR
FT                   LGLQLKAIWLTHAHIDHAGGTGELAERLSLPIIGPHTGDQYWIDALPQQSAMFGFPPAR
FT                   QFAPTRWLHDGDTVTIGHETLNVRHCPGHTPGHVVFHAPQIGRAFVGDVLFAGSIGRTD
FT                   FPQGNHQQLIASITQRLWPMGDQTVFIPGHGPESTFGRERRSNPYVGNT"
FT   gene            complement(241227..241367)
FT                   /pseudo
FT                   /locus_tag="Dtpsy_0221"
FT   gene            complement(241380..242468)
FT                   /locus_tag="Dtpsy_0222"
FT   CDS_pept        complement(241380..242468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0222"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ajs:Ajs_3918 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31706"
FT                   /db_xref="GOA:B9MA99"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B9MA99"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACM31706.1"
FT                   /translation="MRGNQDFQGAMFSYISLEERVPQAHPLRKLRAVVDALLATMNREF
FT                   EAVYARRGRPSVPPEMLLKALLLQILFSIRSERQLVEAINYNLLYRWFVGLNIEDKVWD
FT                   HSTFSANRERLFNEDLARTFFERVKLSAQWGKLASDEHFSVDGTLIDAWASHKSFKRKD
FT                   DDSGTPPGRNPEVDFKGQERCNDTHKSTTDADARLFKKSRGDKSRLCHMGHILMENRNG
FT                   LIVDVEITHASGTAEREAALAMLERRGNRNKRATVGADKGYDSKAFIKGCRKLKVTPHV
FT                   AAKDKHSAVDARVTRHEGYKTSLKVRKRIEEAFGWIKTVGGLAKTKLIGQAKLTGQALL
FT                   CFATYNLVRMGSIGGWWNAHHA"
FT   gene            complement(242660..243361)
FT                   /locus_tag="Dtpsy_0223"
FT   CDS_pept        complement(242660..243361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0223"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH; KEGG:
FT                   ajs:Ajs_0229 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31707"
FT                   /db_xref="GOA:B9MB23"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB23"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACM31707.1"
FT                   /translation="MTSIAPPLPDSPDTGADAPQSAADAVFHGIVQGLAQQRFVPGQRL
FT                   VEVDLAAQFGVSRNSVREALQRLAAQGLVDLFRNKGAAIRTLSPQETLEVLDVAERMTG
FT                   LLARSAARGIAHGAPTAPIQAALAQLHEADRSQDADAFASARRGMYRALLAASGSRELR
FT                   RLLPSIHMPIVYAQHRPATLQQVRMRDYQAMCDAVLAGDAAAADAAGMQHVRNVREAIA
FT                   RRLGAVGLAAD"
FT   gene            243483..244673
FT                   /locus_tag="Dtpsy_0224"
FT   CDS_pept        243483..244673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0224"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ajs:Ajs_0230
FT                   acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31708"
FT                   /db_xref="GOA:B9MB24"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB24"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACM31708.1"
FT                   /translation="MDFSLSPELRALRDKVRQFIAEQVIPLENDERQSHHGPSEALRDE
FT                   LVARGKAAGLLTPHASRAMGGMGLTHVEKAVVFEEAGYSWLGPTALNIHAPDEGNIHLM
FT                   EEVATPAQKERWLRGQVAGDWRSCFAMTEPAPGAGADPSMLDTTAVRDGDDYVINGRKW
FT                   FITGAEGAHYAIVMARMEDGSATMFLTDMGRPGIVLERNMDAMDSCFTGGHGVLRFDNL
FT                   RVPASDVLGEIGKGFRYAQVRLAPARLTHCMRWLGQARRAHDTALEYARKRQAFGKPLA
FT                   EHEGVGYMLADNDMDLHTARLHIWHTAWLLDQGEKCNFESSRAKVVCSEAEWRVVDRSV
FT                   QILGGQGVTGETPVMRIFTDMRAFRIYDGPSEVHRWSMARKLVHMAENAAAAKEVA"
FT   gene            244670..245443
FT                   /locus_tag="Dtpsy_0225"
FT   CDS_pept        244670..245443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0225"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ajs:Ajs_0231 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31709"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB25"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACM31709.1"
FT                   /translation="MSDALTPFRLDGRVVLVTGASSGLGQHFARLLASVGARIAVAARR
FT                   ADKLQGVVDDIAAAGGEARAFTLDVTDAASVRACLDAVGAWGVPDVVINNAGVTVTRPL
FT                   LEQSEEDFDQVLDTNLKGCWLVATEAARRMVAADKGGAIVNVASILGERVAGGVAPYAI
FT                   SKAGVVQATKAMALELARHRIRVNALLPGYVVTDLNRDFLTSEAGDKLRSRIPSRRFGE
FT                   LTDLDGPLLLLASDAGAAMSGATVAVDGAHLVSSL"
FT   gene            245440..246480
FT                   /locus_tag="Dtpsy_0226"
FT   CDS_pept        245440..246480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0226"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   ajs:Ajs_0232 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31710"
FT                   /db_xref="GOA:B9MB26"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB26"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACM31710.1"
FT                   /translation="MSGASTSLPLDALGDYLRAQGLAGTGPLAATVLAGGQSNPTFRIT
FT                   TAEGRNYVLRKKPPGALIASAHAIDREYRVMRALQDTAVPVPRMLAYCDDAALLGTPFY
FT                   VMEFLQGRVFMDQSLPGVEPAERTAIYREMNRVIAALHAVDYAAVGLADYGKPGNYVGR
FT                   QVARWSRQCREATVPVTPAMERLMDWLPQHLPQDDETTLVHGDYRLDNLVFHPNEPRVI
FT                   GVLDWELSTLGHPLADLAYQCMAWRIPPSLWRGIGGLDLAALGIPPESEYVGWYEQATG
FT                   RQAAEHWDFYLAYNLFRMAAILHGIAQRAQDGNAAAADAVETGAKAGPLAELGWEAAQR
FT                   YMAGRK"
FT   gene            complement(246585..247388)
FT                   /locus_tag="Dtpsy_0227"
FT   CDS_pept        complement(246585..247388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0227"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: ajs:Ajs_0233 exodeoxyribonuclease III Xth;
FT                   TIGRFAM: exodeoxyribonuclease III; exodeoxyribonuclease III
FT                   Xth; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31711"
FT                   /db_xref="GOA:B9MB27"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB27"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ACM31711.1"
FT                   /translation="MFKLTSLNLNGIRSATSKGVEAWIAQSRPDCICVQEIKAQSADMQ
FT                   GRFEELAGLKGYFHFAVKKGYSGVGIYARHEPSDVVIGYGSSEFDTEGRYVELRFDTPA
FT                   RRLSIISAYFPSGSSGEERQLAKFRFLEEFHPHLMRLKAEREFILCGDINIAHQQIDLK
FT                   NWRSNQKNSGFLPEERAWMTKLLHISDPTGGLVDVYRQLQPEATDACYTWWSNRGQAYA
FT                   NNVGWRLDYHLATPAIAALARTEEIYKAQKFSDHAPITVGYELSL"
FT   gene            247399..248109
FT                   /locus_tag="Dtpsy_0228"
FT   CDS_pept        247399..248109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0228"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: ajs:Ajs_0234 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31712"
FT                   /db_xref="GOA:B9MB28"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB28"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACM31712.1"
FT                   /translation="MVTDSAQTVEQGASQARLAQDFVRFAVDSGVLRFGEFKTKAGRMS
FT                   PYFFNAGLFDDGAKLGRLAQFYAQALLASGVEFDMVFGPAYKGIPLAATVAVELARLGK
FT                   NVPFAYNRKEAKDHGEGGTLVGAPLQGKVLIIDDVMSAGTAARESIALIRAAGATPHAI
FT                   AIALDRQEKATENGQDVDHSAVQYVRRELGMQVCAIAKLADLLQYLSAGGGDTQMREHH
FT                   ERVLAYRQRYGVND"
FT   gene            248142..248858
FT                   /locus_tag="Dtpsy_0229"
FT   CDS_pept        248142..248858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31713"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB29"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0235"
FT                   /protein_id="ACM31713.1"
FT                   /translation="MKAGTRHAGWFMAGATAAALGLLSPVAWAQPKPPQEVYTCIDKTG
FT                   RRITADRPIADCVDREQRILDHTGAERRRIGPTLTEHERAALEVQRRKEAQERARIAEE
FT                   RRRERVLMARYPDEAAHQVEREAALVQVDEVMAVARKRIQELQVERKRIDGEMEFYRRD
FT                   PLKAPMKLQRQIAENDEAVAEQQRFLTAQDQEKRRIHQRFDAELAQLRQLWAAQRAAAS
FT                   QLVPPQSTLVSPGASR"
FT   sig_peptide     248142..248231
FT                   /locus_tag="Dtpsy_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(248930..250387)
FT                   /locus_tag="Dtpsy_0230"
FT   CDS_pept        complement(248930..250387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0230"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB region; GatB
FT                   central domain protein; KEGG: ajs:Ajs_0236
FT                   aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31714"
FT                   /db_xref="GOA:B9MB30"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB30"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ACM31714.1"
FT                   /translation="MTAKLIQGYEVVIGFETHTQLATRSKIFSRASTAFGAEPNTQACA
FT                   VDLALPGTLPVMNREAVACAIKLGLALGSHIAPESIFARKNYFYPDLPKGYQISQFEIP
FT                   VVQGGEVSFYLGDEKKTVRLVRAHLEEDAGKSLHEDSSLGGGGQSGIDLNRAGTPLLEI
FT                   VTEPDIRSSEEAVAYAKELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGQPLGTRREI
FT                   KNLNSFKSMQQAIDYEIRWQIEEIEDGRAIQQATVLFDPDTGETRAMRTKEDAADYRYF
FT                   PDPDLPPLRIAAPWIDDIKAQMPELPRAMAARFVQQYGLPEYDATTLTQSQAMAAYFED
FT                   AAKGCGQPKLASNWVMGEISRRLNAEEIGVEQAKVDSAQLAALIGRINDGTISNNAARQ
FT                   VFEALWSGEGHDVDAVIEAKGLKQMNDTGALEKIIDEVIAANAANVEQYKAGKDKAFNA
FT                   LVGQVMKASKGKANPQQVNDLLKAKLV"
FT   gene            complement(250390..251892)
FT                   /locus_tag="Dtpsy_0231"
FT   CDS_pept        complement(250390..251892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0231"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: ajs:Ajs_0237
FT                   aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31715"
FT                   /db_xref="GOA:B9MB31"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB31"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ACM31715.1"
FT                   /translation="MSNTPSSELHDLGIAQLTSALRSKQVSAVEAAQHFLARARQHLNL
FT                   GAYVAMNEDATLAQARAQDAALAAGTAAPLAGVPIAHKDIFVTRDFPSTAGSKMLAGYQ
FT                   SPFDATVVTRLADAGCVTLGKLNCDEFAMGSANENSAVAPVGYDAPAPVRNPWDTSRIP
FT                   GGSSGGSAVAVSARLAPAVTGTDTGGSIRQPASFCGVTGIKPTYGRASRYGMIAFASSL
FT                   DQAGPMARSAEDCALLLSAMCGPDPDRDSTSLDVPAEDFSAKLNDSIDGLRIGIPAEFF
FT                   GDGLAGDVRAAVDAALKEYEKLGAKLVPISLPRTELSIPVYYIIAPAEASSNLSRFDGV
FT                   KFGHRAKDYADLVDMYKKTRAEGFGDEVKRRIMIGTYVLSHGYYDAYYLQAQKIRRMIA
FT                   DDFQNAFKDCDLIAGPVAPSVAWKLGEHGNDPLADYLADIFTLPASLAGLPGMSVPAGF
FT                   GAGGMPVGLQLIGNYFQEGRLLNAAHRLQQATDFHLRAPEGI"
FT   gene            complement(251903..252202)
FT                   /locus_tag="Dtpsy_0232"
FT   CDS_pept        complement(251903..252202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0232"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; KEGG: ajs:Ajs_0238 aspartyl/glutamyl-tRNA(Asn/Gln)
FT                   amidotransferase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31716"
FT                   /db_xref="GOA:B9MB32"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB32"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ACM31716.1"
FT                   /translation="MALTPQDIGRIANLARLELSPGESERMLTQLNGFFGIVEKMQAVD
FT                   THGIAPLSHPVAVVRDVQLRLREDVASEPDQREANQRSAPAVERGLFLVPKVIE"
FT   gene            252408..253451
FT                   /locus_tag="Dtpsy_0233"
FT   CDS_pept        252408..253451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0233"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: ajs:Ajs_0239 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31717"
FT                   /db_xref="GOA:B9MB33"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB33"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACM31717.1"
FT                   /translation="MFGAFRRYFSTDLAIDLGTANTLIFARDKGIVLDEPSVVAIRHEG
FT                   GPHGKKVIQAVGHEAKAMLGKVPGNIEAIRPMKDGVIADFVITEQMIKQFIKMVHPRSV
FT                   LTPSPRIIICVPCGSTQVERRAIKDAAEAAGATAVYLIEEPMAAGIGAGLPVSEASGSM
FT                   VVDIGGGTTEVGVISLGGMVYKGSVRVGGDKFDESIINYIRRNYGMLIGEPTAEAIKKN
FT                   IGSAFPGSEVKEMEVKGRNLSEGVPRSFTISSNEVLEALTEPLNQIVSAVKNALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEEPLTCVVRGCGIALERMDRQ
FT                   GSIFTSD"
FT   gene            253481..254398
FT                   /locus_tag="Dtpsy_0234"
FT   CDS_pept        253481..254398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0234"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: ajs:Ajs_0240 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31718"
FT                   /db_xref="GOA:B9MB34"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB34"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ACM31718.1"
FT                   /translation="MPLGTLDRSAPTLFKQGPSPLSRLTLYSALALFLMVADARFHLTE
FT                   PLRKAVSTALYPLQWLMLQPVEFADKGAGYFQSLQAAQQGMDDAQRTMAQMSVRAGEAE
FT                   QLLRENAELRQLLALRERLTTEATAAQVIYDTADPYTRRVMVDRGQLAGVEPGSPVMDA
FT                   SGVLGQVTRVFPMLSEVTLLIDRDQAIPVLNLRTGARSVAYGDPVAGHGGGMELRFTPG
FT                   NADVQEGDLLTTSGVDGLYPAGLPVARVLRVERRADSAFARIYCAPVAQMYGARHVMVL
FT                   KPVVADLPPRPEPAPAAPKRGGRK"
FT   gene            254395..254916
FT                   /locus_tag="Dtpsy_0235"
FT   CDS_pept        254395..254916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0235"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; KEGG:
FT                   ajs:Ajs_0241 putative rod shape-determining MreD
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31719"
FT                   /db_xref="GOA:B9MB35"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB35"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ACM31719.1"
FT                   /translation="MIMPKGQQLLLPVNPVFIAASLVAALALNMLPLGRVVWTPDWVMV
FT                   LLVFWGMHQPQRVGLGVAFLMGLCLDVYQSALLGQHALVYCLLMFGAQYTHRRLLWFGP
FT                   LLQALQLLPLFFAAHALELLLRVAIGGGILPGFEGLVAPLLEATLWPLASWVLLAPQRR
FT                   PPDRDENRPL"
FT   gene            254944..256884
FT                   /locus_tag="Dtpsy_0236"
FT   CDS_pept        254944..256884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0236"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: ajs:Ajs_0242 peptidoglycan
FT                   glycosyltransferase; TIGRFAM: penicillin-binding protein 2;
FT                   PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31720"
FT                   /db_xref="GOA:B9MB36"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB36"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ACM31720.1"
FT                   /translation="MTELRNAEADVWHFRLRVFVVGVVVLLAFLLIVARLVVLQVVRHE
FT                   DLADQAESNRTAVVPIVPNRGLILDRNGVVLATNYSAYTLEITPSRTMDLEATIDALAE
FT                   VVDIQPRDRRRFKRLREESRSFDSLPIRTRLSDEEVARFAAQRYRFPGVDIKARLFRNY
FT                   PLGEVASHAIGYIGRINQREKERIEDSDDAANYRGTDYIGKLGVEQSFESTLHGQTGFE
FT                   RMETSAGGHAVRRLNSHPATPGNTVMLSLDIKLQKLIEDMFGERRGALVALDPRNGEVL
FT                   ALVSKPTFDPNLFVEGIDQENWQALNESINKPLLNRALRGTYPPGSTYKPFMALAALEL
FT                   GKRTAGQVFNDPGYYNYGGRTFRSHEGGLGGVDMHRAIQYSSNTYFYSLAVEMGVDAIH
FT                   DFMKPLGFGQITGIDLGGEVRGVLPSTEWKRNTYKRPEAKRWYSGETVSLGIGQGYNNF
FT                   TMLQLAVAEATLANGGTRHRPHLIKAVKDQVGGQVTEVQQPPGERLGYNPKHVAIVNNA
FT                   LMAVNQAGTGRRVFAGAPYTSAGKTGTAQAVSLGQNVRYNAKLLEEHQRDHSLFAAFAP
FT                   VEEPRIAVAVIVENAGFGAAAAAPIVRRVFDYWLLGQYPSEQDLAAVSKGQAGAPMGTP
FT                   RNVADVPLAMP"
FT   gene            complement(256901..257800)
FT                   /locus_tag="Dtpsy_0237"
FT   CDS_pept        complement(256901..257800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0237"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ajs:Ajs_0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31721"
FT                   /db_xref="GOA:B9MB37"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB37"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACM31721.1"
FT                   /translation="MRSERQGLLALLLVVAVWGTTFPAMKMMSAHLDALQIIWARFAIA
FT                   LLVLAPLWRGLRRTELRWGLLLGALLFLAFWLQIEGLARTSSNRNAFVTGLNVLVVPLL
FT                   AMAVLGRRYGAALWAACAMALAGMVLMFHENEPWNLGDTLTLASTLFYAIYILTLEECA
FT                   RRTAARPLRATRMAAVQALVMFAAASVLLLARHGEVATTLQALADLPAHALTALAYLGV
FT                   VASVLVVTLQAWGQQRVDAMRSAIVFGLEPVFAAATAWLLIGERLGAAGLAGAALIVCA
FT                   LVVSQLPPPRALARPSAP"
FT   sig_peptide     complement(257720..257800)
FT                   /locus_tag="Dtpsy_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.684 at
FT                   residue 27"
FT   gene            complement(257933..258685)
FT                   /locus_tag="Dtpsy_0238"
FT   CDS_pept        complement(257933..258685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0238"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ajs:Ajs_0244 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31722"
FT                   /db_xref="GOA:B9MB38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB38"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACM31722.1"
FT                   /translation="MSHAASANPYIVCKDVRKAFGSHEVLKGVSTVFRTGEVTVIIGAS
FT                   GSGKSTLLRAINRLEPHDSGSITIDGVEVTDDPRTLQLQRSEVGMVFQQFNLFGHMTVL
FT                   DNVTLAPRRIRHTSRREANDKAMALLKRVGMQDHAHKYPWQLSGGQQQRVAIARALAMA
FT                   PKVMLFDEPTSALDPEMVQEVLDVMRELARGGMTMIVVTHEMGFAREVADRVMFFDQGC
FT                   IAHDAPPAEFFSNPANDRIRSFIGRMSH"
FT   gene            complement(258682..259464)
FT                   /locus_tag="Dtpsy_0239"
FT   CDS_pept        complement(258682..259464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0239"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ajs:Ajs_0245 polar
FT                   amino acid ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31723"
FT                   /db_xref="GOA:B9MB39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB39"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACM31723.1"
FT                   /translation="MLLALWPAHWSRTQRSNATLVAALVLMALVLALLGQFLSFFPEPI
FT                   GSNAELFSEGALTTLYLTLVSGTVGLLLGTAAALARTSRLAWLRWVASFYIWAIRGTPL
FT                   LVQILFVYFALPVLVPGLNLPDFAAAVVALGLNVGAYNAEAIRAGLLAVPRGQTEAARA
FT                   LGLSRTHVFFDVVFPQAFKIALPPLVSNFVALLKDSSLAYAIGVVELTNVGNRIQSATF
FT                   QPVATLTTVAITYLILTTLVTQVTHAIEYRFDVEGRVK"
FT   sig_peptide     complement(259366..259464)
FT                   /locus_tag="Dtpsy_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.625 at
FT                   residue 33"
FT   gene            complement(259504..260265)
FT                   /locus_tag="Dtpsy_0240"
FT   CDS_pept        complement(259504..260265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0240"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   ajs:Ajs_0246 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31724"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB40"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACM31724.1"
FT                   /translation="MKMFKTLATAVALCAAVVVQARPLEEIQKSGTIILGSEGQYAPFN
FT                   FFKGKQLTGYEIEVAEAVVKKMGLKYEWKTVGFDALLTGLAQDRWDLVIASHAITDERS
FT                   KAVTFTLPHYCSGGIIVSMKPEVAKAADLNGKVVAVQTGTTYLDAVKKVPGVKDVKNFP
FT                   TDEAARNALASKRVDAWVTDRFVAKEMLAKAPKAGFRTGDMLFVEQVASAVSKGNQGLA
FT                   DAWNKALKEAIADGTVGKISQKYFQEDVTCK"
FT   sig_peptide     complement(260200..260265)
FT                   /locus_tag="Dtpsy_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(260431..261351)
FT                   /locus_tag="Dtpsy_0241"
FT   CDS_pept        complement(260431..261351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0241"
FT                   /product="arginase"
FT                   /note="TIGRFAM: arginase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: ajs:Ajs_0247
FT                   arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31725"
FT                   /db_xref="GOA:B9MB41"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB41"
FT                   /inference="protein motif:TFAM:TIGR01229"
FT                   /protein_id="ACM31725.1"
FT                   /translation="MTTLTLIGAPTDVGASVLGASMGPDALRIAGIARAMQARGFDVRD
FT                   QGNLAGPGNPQAEPASGFRHLAEVAAWNRAVYEATHAALQAGQLPLLMGGDHCLAIGSI
FT                   SAVAQHCRARGRRLKVLWFDAHADANTPESSPSGNLHGMPVACLLGHGPAQLTRLAGPD
FT                   APPALQSGQITLIGVRSVDATEKRFVNEHGIEVYDMRTIDELGMRAVMQAALADVDQDT
FT                   HLHVSFDMDCLDPSVAPGVGTGVRGGPTYRETQLCMEMLADCGALGSADLVELNPALDV
FT                   RNQTAELAVDLLESLFGKSTLMRPQ"
FT   gene            complement(261389..262147)
FT                   /locus_tag="Dtpsy_0242"
FT   CDS_pept        complement(261389..262147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0242"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   ajs:Ajs_0248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31726"
FT                   /db_xref="GOA:B9MB42"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB42"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACM31726.1"
FT                   /translation="MEWIIVSLASLLAGFVDAIVGGGGLILLPALFATFPTAPPATLMG
FT                   TNKSAAIWGTGIATWQYSRRVQMRWRAMLPAALAGFVGAFAGAWVVTLISADFLRKLLP
FT                   LVLVALLIYTLARKDLGRHHAPRLAAGRETLAACAIGVTIGFYDGFFGPGTGSFFVFLF
FT                   VRVLGYDFLNASVSAKLLNLATNVAALILFTAKGHVWWHFALPLAVANVVGSLLGAHLA
FT                   LKHGAGFVRGIFILVVGMLILKTGYDAFLR"
FT   gene            complement(262447..264141)
FT                   /locus_tag="Dtpsy_0243"
FT   CDS_pept        complement(262447..264141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0243"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: ajs:Ajs_0249 glucose-methanol-choline
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31727"
FT                   /db_xref="GOA:B9MB43"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB43"
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /protein_id="ACM31727.1"
FT                   /translation="MSDTTFDYIIIGGGTAGALLANRLSADPKNRVLLVEAGRRDDYHW
FT                   IHIPVGYLYCIGNPRTDWLYHTEADTGLNGRSLRYPRGKVLGGCSSINGMIYMRGQARD
FT                   YDQWAQITGDDAWRWDSVLPAFRRHEDHWRLDQPEGVNENFKRLHGSKSTGSSGEWRVE
FT                   KQRLRWDILDAFAQAAQQAGIPATDDFNRGTNEGVGYFEVNQKNGWRWNTAKAFLRPTC
FT                   YGRPNFEMWTSAQVTRLILDRQPDGSLRCTGVQVWTGEEMVTAHAQQEVILSAGAVNSP
FT                   QILQLSGIGPGALLQRHGIDIQADLPGVGANLQDHLQIRAVYKVQGVPTLNMLAGNLLG
FT                   KARIGLEYAFKRSGPMSMAPSQLGAFTRSQPDLPHPNLEYHVQPLSLEAFGEPLHRFPA
FT                   FTASVCNLNPTSRGTIQIKSPDFRTAPAIAPNYLSTPEDRQVAADSLRVTRRIVAQPAL
FT                   APYQPEEYKPGPQYQSDEDLARLAGDIATTIFHPVGTTRMGRLDDPQAVLDARLRVRDG
FT                   RGGVVAGLRVVDAGAMPTITSGNTNAPTLMMAEMAAQWIRSEARAPV"
FT   gene            264477..265595
FT                   /locus_tag="Dtpsy_0244"
FT   CDS_pept        264477..265595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0244"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   ajs:Ajs_0250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31728"
FT                   /db_xref="GOA:B9MB44"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB44"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ACM31728.1"
FT                   /translation="MPVTHPPSVVQDHAARPLAQPQGEWVAAAFADRRAWRRVAAQLKD
FT                   CGPGVAWSLQGVQRLDHVGAQILWNHWGRAWPEQLELTENQREMLERVAQYTTPCEPPA
FT                   PWRLGDQVDRLGVLVLHALDHVRHLVILVGQLVLDVLRLLRNPRRGPWRDISGHLYRMG
FT                   ATALPITALVGFLIGVVLAYLMSLQLRQFGAEAFIVNILGISLIRELGPMLGAILVAGR
FT                   SGSAITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRALALALAMPLVALWTTLAALAGG
FT                   MLAADLTMGISSAYFAQALPAAVNVSNLWLAMSKSVVFGVFIALIGCHWGLRVKPNTQS
FT                   LGEGTTASVVSAITMVIIVDALFAVAFKNVGF"
FT   gene            265598..266440
FT                   /locus_tag="Dtpsy_0245"
FT   CDS_pept        265598..266440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0245"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ajs:Ajs_0251 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31729"
FT                   /db_xref="GOA:B9MB45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB45"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACM31729.1"
FT                   /translation="MDATRPAADADTRAVVEPPVVDIRGLATVFGRGDEAFTVHDDLQL
FT                   TVQRGEILSLVGGSGTGKTVLLRHILGLTRPTRGSVEVLGRSAAELVGGERASSRVGML
FT                   FQHGALFSAFNVLDNIAFALRELGTLPPALVNDAAMVKLRLAGLKPEHATRMPADLSGG
FT                   MIKRVALARALIMDPPLLLLDEPTAGLDPSSSDEFCALLRELHAALGLTVIMVTHDLDT
FT                   LYALSTRVAVLADRRVIVTGTPQEVARFDHPFIHHFFLGERGRRAMAQPPAASSSKEA"
FT   gene            266440..267417
FT                   /locus_tag="Dtpsy_0246"
FT   CDS_pept        266440..267417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0246"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: ajs:Ajs_0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31730"
FT                   /db_xref="GOA:B9MB46"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB46"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ACM31730.1"
FT                   /translation="MENKSHALAAGIFVIAVAALLAGLGMWLTRDQTDYQLYELSSKDS
FT                   VSGLQPQAAVRYKGVAVGKVTHIGFDPQVAGNVLIRIAVNADAPISPTTFATLGYQGVT
FT                   GLAHVQLDDAEAPLPAPPPGASGLPRLPLHSSSFSQLAEQGPAILGQVQEATQRINTLL
FT                   GDENQQRFSTALKQLGDAAGSIDQLARRLDNTVTTRLDPALAGVPPLVQDTQQTLQALR
FT                   QAGSSAATAANDVSQAIRTLQAEGGALDEIAAGAKSLAGAADRFGRVTLPRINHAADET
FT                   ARAARRLGRTASGINDNPQSLIYGPGRSAAGPGEPGFTAPAAQP"
FT   sig_peptide     266440..266508
FT                   /locus_tag="Dtpsy_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.500 at
FT                   residue 23"
FT   gene            267438..268112
FT                   /locus_tag="Dtpsy_0247"
FT   CDS_pept        267438..268112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0247"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   ajs:Ajs_0253 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31731"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB47"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ACM31731.1"
FT                   /translation="MTIKMIAVGAHQISVKAIFGFTFMALMAGCSILPEPPVRADVYDF
FT                   GPGPLQAPGPAASAPLPPIALAEVTATGLPEGSTALLYRLAYTNAQQLRPYTQARWSLP
FT                   PAVLLHQAVRERLGQRRAVLSGDDGMAVLLERGRMPSVLRLELEEFSHVFGAPQASAGL
FT                   VRVRAVLADASTAGETLVTQRVFVARRDAATPDAAGGAKALADAAAQVAEELAAWVEQS
FT                   GR"
FT   gene            268088..268273
FT                   /locus_tag="Dtpsy_0248"
FT   CDS_pept        268088..268273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31732"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACM31732.1"
FT                   /translation="MGGAVRPLSACAFPTPRDMLRMSLFFCPPRTGDGAEAYMPLSPWA
FT                   DAACVRAPTRCRRAPA"
FT   gene            268358..268573
FT                   /locus_tag="Dtpsy_0249"
FT   CDS_pept        268358..268573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0249"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: ajs:Ajs_0254 CsbD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31733"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB49"
FT                   /inference="protein motif:PFAM:PF05532"
FT                   /protein_id="ACM31733.1"
FT                   /translation="MNEDRIEGNWKQFKGKVKEQWGKLTDDDLDVIAGKRDQLLGKLQE
FT                   RHGLAREAAEEQLKGWEQRNPDFRYD"
FT   gene            268650..269228
FT                   /locus_tag="Dtpsy_0250"
FT   CDS_pept        268650..269228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31734"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB50"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0255"
FT                   /protein_id="ACM31734.1"
FT                   /translation="MKNARNLLALAAAALMATSGMAMTKEEYNAGKDRIGADYKAAKAQ
FT                   CDTLQGNAKDVCMKEAKGREKVAKAELEAQYKPSDKATYNVNEARADADYEVAKEKCDD
FT                   QKGDAKDICVKDAKAAHVAAKENAKVQRAQAKPADSTAEKRADVAEAKKDAAEAQREAN
FT                   YKAAKERCDTMSGDAKDKCVADAKRTHGQ"
FT   sig_peptide     268650..268724
FT                   /locus_tag="Dtpsy_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.666 at
FT                   residue 25"
FT   gene            269376..269882
FT                   /locus_tag="Dtpsy_0251"
FT   CDS_pept        269376..269882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0251"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   ajs:Ajs_0256 hemerythrin-like metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31735"
FT                   /db_xref="GOA:B9MB51"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB51"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ACM31735.1"
FT                   /translation="MAALQWSEELALDLPQMDHTHQEFVALLQAVESADDAALIGAWED
FT                   LVAHTDAHFAQEDRWMQATRFAAGNCHSTQHQVVLKIMREGTDRARQGELHVLREMAAE
FT                   LAVWFPQHTDAMDASLAQHLRRVGFDPATGSVQKPGALPDDLIHGCGGACSSGDDTSAQ
FT                   PAAVA"
FT   gene            270065..270997
FT                   /locus_tag="Dtpsy_0252"
FT   CDS_pept        270065..270997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0252"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: ajs:Ajs_0257 diguanylate cyclase with PAS/PAC
FT                   sensor; TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; PAS fold-3 domain
FT                   protein; SMART: PAS domain containing protein; GGDEF domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31736"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB52"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACM31736.1"
FT                   /translation="MTPHEPPESALYRTLLESTRAIPWKIDWATATFAYIGPQIEDLLG
FT                   WAPTSWRTVQDWADRMHPDDRDRVVNFCISQSQSGVDHEADYRALTTGGDYVWIRDVVH
FT                   VVRDLQGNVVSLVGFMFDITERKQNEHQLLQLQQELQELSFRDGLTGVNNRRKFDAVYE
FT                   REWQEAQRTGEPLSLLMFDVDFFKSYNDQYGHVEGDECLRRVARALQQAAHRPRDCLAR
FT                   YGGEEFVLLLPGADASSARAVAQRCMQEVAHAGIVHAASPLGQQLTVSVGMGTALPGTQ
FT                   DDSKRFLETVDRCLYRAKHAGRNRIEATA"
FT   gene            complement(271001..271639)
FT                   /locus_tag="Dtpsy_0253"
FT   CDS_pept        complement(271001..271639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0253"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: ajs:Ajs_0258 multiple antibiotic resistance
FT                   (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31737"
FT                   /db_xref="GOA:B9MB53"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB53"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ACM31737.1"
FT                   /translation="MDLKPLITLLAIVNPLAIVPFFIHYTSGFNAAQRRRTVQVAAFSA
FT                   FCVIAACALVGLQILDFFNISLQSFQVGGGMLLLISAMNMLNAQPAEAKPHTHELEQGA
FT                   EKAAAGSSIAVVPLTIPLLTGPAAMSTVVIYADRAQSIWQHLALVGYGVVVGAATALCF
FT                   ALAEPIERVLGKTGINVMTRLMGLILAALAVEVMADGLSKLFPVLAARS"
FT   gene            complement(271639..272385)
FT                   /locus_tag="Dtpsy_0254"
FT   CDS_pept        complement(271639..272385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0254"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ajs:Ajs_0259 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31738"
FT                   /db_xref="GOA:B9MB54"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB54"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACM31738.1"
FT                   /translation="MDKIVLITGGSRGIGAAAALLAAQRGWAVAINYLRHAEAANGVVR
FT                   QIEAAGGRAIAVQADVAVEADVVTLFETVDHRLGRLTALVNNAGVVDRPARVDEMHGER
FT                   LRRMFSINVLGAFYCVREAVLRMSTRHGGAGGSIVNVSSIAARLGAPHQYVDYAASKGA
FT                   LDTLTIGLAHEVGGEGIRVNAVRPGLIDTDIHASGGLPHRVRDLAGQVPMGRGGTPEEV
FT                   AEAIVWLMSDAASYTSATLMDIAGGR"
FT   sig_peptide     complement(272317..272385)
FT                   /locus_tag="Dtpsy_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.370 at
FT                   residue 23"
FT   gene            272493..273182
FT                   /locus_tag="Dtpsy_0255"
FT   CDS_pept        272493..273182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0255"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: ajs:Ajs_0260
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31739"
FT                   /db_xref="GOA:B9MB55"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB55"
FT                   /inference="protein motif:PRIAM:3.1.1.45"
FT                   /protein_id="ACM31739.1"
FT                   /translation="MGQWVDLTASDGFTAPAWVARTDGAPRGAVVVLQEIFGVNAHIRA
FT                   VTDRLAMRGYLAVAPSTFARVQKGVDLGYSDADMKAGRALKAAVEGLPAPGVMPDIQAA
FT                   IDYAARHSDCKVGVVGFCWGGLLTWRAACMLQGLSAAVPYYGGGMTTPAEVARQPRVPV
FT                   LAHFGERDQWIPLDSVQAFARAHPEAQVHVYAADHGFNCDQRASYDEAAAMTARDRTLA
FT                   FLARHVG"
FT   gene            complement(273270..274838)
FT                   /locus_tag="Dtpsy_0256"
FT   CDS_pept        complement(273270..274838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0256"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ajs:Ajs_0261 EmrB/QacA family drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31740"
FT                   /db_xref="GOA:B9MB56"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB56"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACM31740.1"
FT                   /translation="MTAPAHTPPLPPPPLTGSARLWGTLALSAATFMNVLDTSIANVSL
FT                   PAIAGDLGVSPTQGTWVITSFAVANAIAVPLTGWLSQRFGQVRLFVASVALFVIASLLC
FT                   GLAPNMTLLIAARALQGFVAGPMIPLSQSLLLSSYPRALAGLAMAMWSMTTLIAPVMGP
FT                   LLGGWITDNMTWPWIFYINVPVGIAAVMVTWGIFHQRETEQRALPIDSIGLALLVIWVG
FT                   AMQVMLDIGKEHDWFESPWVVACGLVALVGLVAFVVWERGEDHPVVDLALFRIRNFWAG
FT                   ALATSVGYGLFFGNVVLLPLWLQQYMGYTATQAGEVMAPVGLLAMVLSPLVGKNIAKVD
FT                   PRRFATLAFLVFALVLWMRSNFNTQADLATIMVPTIIQGVAMAFFFIPLVTITLSGIAP
FT                   DRIPAASGLSNFMRITAGAVGTSVTTTLWERRASLHHAQLTEGLHQGHLPFTQALQGLQ
FT                   AGGLTPEQALAQVERLVNQQAFMLAANDIFYASALLFLLLIPLVWLAHPTRAASGSADA
FT                   AAGAH"
FT   gene            complement(274849..276057)
FT                   /locus_tag="Dtpsy_0257"
FT   CDS_pept        complement(274849..276057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0257"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   ajs:Ajs_0262 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31741"
FT                   /db_xref="GOA:B9MB57"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB57"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACM31741.1"
FT                   /translation="MTATPSTPSTASKASRRKALFTLAGVVVLAGCAWGLYDWLVASHY
FT                   EHTDNAYVQGNVIQITPQTGGTVMSILADDTDFVRAGAALVQLDPADARVALQQAEANL
FT                   AQAVRQTRTLYANNSALAAQVRLREAEAARAQAEIARAEDDLRRRQALTGEGAVSQEEL
FT                   RHAQSQLQTARTQLAAAQAGVAAAREQLVSNQSLTQGVAVAQHPSVQAAAAKVREAYLA
FT                   DRRTALPAPVDGYVARRTVQLGQRVAAGTPLMTIVPLREVWVDANFKENQLRNLRLGQR
FT                   ATLVADLYGKKVEYTGTVAGLGVGTGAAFALLPAQNATGNWIKVVQRVPVRIALDAGQL
FT                   AEHPLRVGLSMNVSVDTQDRSGPALADAPRKEAVASTAVYDALDKGADADVARIIRANL
FT                   GTL"
FT   sig_peptide     complement(275950..276057)
FT                   /locus_tag="Dtpsy_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.624 at
FT                   residue 36"
FT   gene            complement(276096..277649)
FT                   /locus_tag="Dtpsy_0258"
FT   CDS_pept        complement(276096..277649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0258"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: ajs:Ajs_0263 RND efflux system outer
FT                   membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31742"
FT                   /db_xref="GOA:B9MB58"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB58"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ACM31742.1"
FT                   /translation="MKNHLSPSSAPALIPATAPRGSALLYGATLAVALLALPLLSGCAD
FT                   MAGIDSHARMRDPASLGLAAAPSSSADSAVQPQTAVSADWWRSFGDAQLDALITQALQG
FT                   NPGLQQAAARIARAEAFADTARAAQSPQVNGSLDATRQRYSANGPYPPGQAGAVRSVET
FT                   ARLSGSWELDFFGKHRAALAAALGEAQAARADAEAARLLLASRVAQGYFQLARLQAQRA
FT                   VAERTLQQRTEMLQLVQRRVQAGLDTQLELRQSEGALPEARQQIEALREQEALARNALG
FT                   ALIADPQTAQTLTPQALAAIHFSETPAAVPADLLGRRPDVAAARWRVEAATQDMGVARA
FT                   QFYPNVSLTAFVGLASVGLDRFIEAGSREWGVGPALRLPIFDAGRLRANLRGKAADRDA
FT                   AVESYNAALLEAVRDAADQLASSSSIARQIAEQHQAGESAQAAYGIARRRYEAGLGTYL
FT                   QVLSAESQVLAQRRLAVDLAARRLDNQVGVMRALGGGYAATPPPTAQAPQAAPTVAAAR
FT                   "
FT   sig_peptide     complement(277566..277649)
FT                   /locus_tag="Dtpsy_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.230 at
FT                   residue 28"
FT   gene            complement(277708..278223)
FT                   /locus_tag="Dtpsy_0259"
FT   CDS_pept        complement(277708..278223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0259"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: ajs:Ajs_0264 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31743"
FT                   /db_xref="GOA:B9MB59"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB59"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACM31743.1"
FT                   /translation="MNLPSVPPPLSADAACPLSDPELPVPFEIERSIGFQMRRITTLLG
FT                   YEVERRMEPLGLTDAQWKPLLRLLLDPPGTAAALARMCHLDAGGLTRLLDRLEAKGLCQ
FT                   RERSQEDRRVVHVALTSEGQAVAAQLPALLGEVQDQLLQGFSAEEEAQLRDFLKRIYAN
FT                   VRPPEGGP"
FT   gene            complement(278328..279533)
FT                   /locus_tag="Dtpsy_0260"
FT   CDS_pept        complement(278328..279533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0260"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: ajs:Ajs_0265 Mg2+ transporter protein, CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31744"
FT                   /db_xref="GOA:B9MB60"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB60"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ACM31744.1"
FT                   /translation="MTLTPQAIRIFHLQPGAQARELPELPTQPPARGFYWIACTRAAFS
FT                   TELPRLQGVLQALTGQQLVDLHVSDLLNAQLPSHYDYTSQYDMLVVRRLSASLAPAAAP
FT                   LMPAAARGGPPVLRRIDTSPVGFAVFDQVLLSVHPADCSVRDAYAARLITPPAPTTTPP
FT                   PEAPKDSAPPTTPAEAVVRELRTGPVAGTRLPASPADLMLRMVNQIVDNYLDLRRELSR
FT                   QLDHWQAELLQPRTRFNNWRALMDARLTLHQLDEICEDQRAAVQAWCAVLETWAPSSDT
FT                   PAALRELDLLKVRSRDVLEHIERVVHHVRRLEQSTEATVQMHFSAQSNRTNDIMRTLTA
FT                   LTAVFLPLNLIAGIFGMNFEFIPLVHKQDGFWWAMGSMTATAVGLTLFFWRKRYLARTG
FT                   QG"
FT   gene            complement(279573..280580)
FT                   /locus_tag="Dtpsy_0261"
FT   CDS_pept        complement(279573..280580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0261"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   ajs:Ajs_0266 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31745"
FT                   /db_xref="GOA:B9MB61"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB61"
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /protein_id="ACM31745.1"
FT                   /translation="MHLSSPTPFPANRPRRLRRDAFTRNLVRETVLTPHDFIYPVFVHE
FT                   GSNLSVPVASMPGVERLSLDLLLPVAEECVKLGIPVLALFPSIDAALKTPDGKEALNPD
FT                   GLIPRVVRKLKAEFPDLGVMTDVALDPYTSHGQDGLLDDTGYILNDETVELLVGQALTH
FT                   AQAGVDMVAPSDMMDGRIGAIREALEAHGQIYTRIMAYSAKYASAFYGPFRDAVGSAAN
FT                   LGRSNKNVYQMDPANTDEALREVALDLAEGADMVMVKPGMPYLDVVRRVKDEFKVPTFA
FT                   YQVSGEYAMLKAAAANGWLDHDKVMMESLLAFKRAGADGVLTYFALDAARLLAK"
FT   gene            280741..281454
FT                   /locus_tag="Dtpsy_0262"
FT   CDS_pept        280741..281454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0262"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="KEGG: ajs:Ajs_0267 biotin/lipoate A/B protein
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31746"
FT                   /db_xref="GOA:B9MB62"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB62"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0267"
FT                   /protein_id="ACM31746.1"
FT                   /translation="MQTAVTRPYWRVWTYETPAVVLGCSQRAYLDGARARLAPGMELLQ
FT                   RPSGGGAVLCGPWMVSCSVVLPPSHPWVQGRLPDSYQGLGQLHAQVLAPWGVAARALPP
FT                   DQVAAANARGGPVVPWACYSSLAPWEVVDAAGRKLVGLAQRRQRAGVLLVAGTLVTPPD
FT                   WALLCQALDQQGDEAALRARTVSCAELSARAPDAQQMASALRVALTQTLGEEAGDGAGE
FT                   AADDSARQATAPNRP"
FT   gene            281664..282092
FT                   /locus_tag="Dtpsy_0263"
FT   CDS_pept        281664..282092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31747"
FT                   /db_xref="GOA:B9MB63"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB63"
FT                   /inference="protein motif:PFAM:PF03653"
FT                   /protein_id="ACM31747.1"
FT                   /translation="MLWVKAFHIVFVASWFAGLFYLPRIFVNLAMVAPGSVAERERLLL
FT                   MARKLLRFTTLLSVPAIALGLWLWLGYGIGKGPGNGWLHAKLAVVLLVVGYHHACAVLL
FT                   RRLASNADQHSHRWFRWFNEVPVLLLLVAVVLVVVKPF"
FT   gene            282190..283287
FT                   /locus_tag="Dtpsy_0264"
FT   CDS_pept        282190..283287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0264"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: ajs:Ajs_0269 VanZ
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31748"
FT                   /db_xref="GOA:B9MB64"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB64"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ACM31748.1"
FT                   /translation="MHKTSAWPLALIYAALIVFASLFPFDGWREQGISPWVFFSARIPP
FT                   PYWTWFDVNMNIAGYAPLGFLLALAGLRSGWPRAAVPLAALAGALLSLSMEYLQIFLPR
FT                   RVPSNMDFALNATGALLGALAAALLERFGAIAHWSRFRERWFVPHARGALVLLALWPWA
FT                   LLFPAALPFGLGQMWERLEAALIDALQDTPFLQWLPVREAPLEPLSPGAELMAVALGLL
FT                   IPCLLGYCVMRHAGRRMAFALATAAVGVGVTALSSLLSYGPTHAWEWLTLPARMGVLVA
FT                   LGAALAMAAVPRRGCAALLLLALMLHLNLLNQAPTSAYFAQTLQAWEQGRFIRFYGLGQ
FT                   WLGWLWPYGALVYVVLRVSRRDGDS"
FT   sig_peptide     282190..282252
FT                   /locus_tag="Dtpsy_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.973 at
FT                   residue 21"
FT   gene            283297..283638
FT                   /locus_tag="Dtpsy_0265"
FT   CDS_pept        283297..283638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0265"
FT                   /product="ferredoxin-like protein"
FT                   /note="KEGG: ajs:Ajs_0270 ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31749"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB65"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0270"
FT                   /protein_id="ACM31749.1"
FT                   /translation="MSDTTPQYYQRHIFFCLNERTNGENCCAHHGAQQAFDRCKMLVKQ
FT                   QGLMGPGKVRVNKAGCLDRCAGGPIAVVYPEGTWYTYVDESDIDEIVESHLKNGVVVER
FT                   LLTPPELGR"
FT   gene            283723..284370
FT                   /locus_tag="Dtpsy_0266"
FT   CDS_pept        283723..284370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0266"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: ajs:Ajs_0271 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31750"
FT                   /db_xref="GOA:B9MB66"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB66"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0271"
FT                   /protein_id="ACM31750.1"
FT                   /translation="MNAQTERLTLTGAAGAIEAARDAAADGVPPRGVAVIAHPHPLFGG
FT                   TMDNKVVQTLARAFVACGWTAVRFNFRGVGGTAGVHDEGRGELEDLLAVVRQVAPEGPG
FT                   AVPIALAGFSFGAFVTSHALARVWGERAVERAVLVGTAASRFKVADVPAEAHLRTLVVH
FT                   GEADDTVPLSAVMDWARPQTLPVTVVPGGGHFFHGQLPLLKGLVMRHLQSAP"
FT   gene            284449..285612
FT                   /locus_tag="Dtpsy_0267"
FT   CDS_pept        284449..285612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0267"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: beta-lactamase; peptidase S11
FT                   D-alanyl-D-alanine carboxypeptidase 1; Penicillin-binding
FT                   protein 5 domain protein; KEGG: ajs:Ajs_0272
FT                   penicillin-binding protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31751"
FT                   /db_xref="GOA:B9MB67"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB67"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ACM31751.1"
FT                   /translation="MKSLLSSLRTFACAALMAPAILWAQVPQPPEIAARNYMLVDVTAG
FT                   QVLATKDIDAPVEQASLTKLMTGYLVFDALRAKKITLEQRLPVSERAWKMPGSRMFIDP
FT                   KMQVPVDDLLKGMIVQSGNDATVALAEGVGGTVENFVRLMNEQAKALGMTNTAYKNPEG
FT                   LTEPGHTTTARDLATLATRLMQDFPEYMHYYSTKQYRYEGTPASNSNNRNMLLFRDPSV
FT                   DGLKTGHTAAAGYCLVATSKREFPNVGQRRLLSIVLGAASENARANESQKLLNWGYTAF
FT                   DSVKLFDAGQAAATPAVWKGTQSTLKIGRPEAIVITVPSGSAGKVTTEIVRKDPLVAPF
FT                   TKGQAIGTLKVKLGEQQVAEVPLVALEDVAQAGIFGRAWDAIRLWIK"
FT   sig_peptide     284449..284523
FT                   /locus_tag="Dtpsy_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            285763..286140
FT                   /locus_tag="Dtpsy_0268"
FT   CDS_pept        285763..286140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0268"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: ajs:Ajs_0273 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31752"
FT                   /db_xref="GOA:B9MB68"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB68"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ACM31752.1"
FT                   /translation="MPTINQLVRQGRTVEVVKSKSPAMENCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDL
FT                   QGVKDRKQARSKYGAKKPKAK"
FT   gene            286311..286784
FT                   /locus_tag="Dtpsy_0269"
FT   CDS_pept        286311..286784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0269"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: ajs:Ajs_0274 30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31753"
FT                   /db_xref="GOA:B9MB69"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB69"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ACM31753.1"
FT                   /translation="MPRRREVPKREILPDPKFGNVELSKFMNVIMEGGKKAVAERIIYG
FT                   ALDLISQKQPEKDALEVFVTAINNVKPMVEVKSRRVGGANYQVPVEVRPVRRLALSMRW
FT                   IKEAARKRGEKSMAQRLANELMEATEGRGGAMKRRDEVHRMAEANKAFSHFRF"
FT   gene            286942..289050
FT                   /locus_tag="Dtpsy_0270"
FT   CDS_pept        286942..289050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0270"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: ajs:Ajs_0275 translation elongation factor 2
FT                   (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31754"
FT                   /db_xref="GOA:B9MB70"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB70"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ACM31754.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVTHKLGEVHD
FT                   GAATTDWMEQEQERGITITSAAVTCFWKGMDMSYPEHRFNIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVVDQIKTRLK
FT                   GNPVPVVVPIGAEDNFKGVVDLLKMKAIIWDEASQGMKFEYADIPAEVKETAEKWRENM
FT                   VEAAAEASEELMNKYLDEGTLSEEDIKAGLRARTLAVEIQPMLCGTAFKNKGVQRMLDA
FT                   VIDYLPSPVDIPDVEGTDPDDEEKKLARKADDGEKFSALAFKLMTDPFVGQLTFVRVYS
FT                   GVLSKGDTVFNSVKGKKERIGRIVQMMANERIEVDEIRAGDIAACVGLKDVTTGETLSD
FT                   VDNPIILERMVFPEPVIAQAVEPKSKADQEKMGIALSRLASEDPSFRVRTDEESGQTII
FT                   AGMGELHLEIIVDRMKREFNVEANVGKPQVAYRETVRKTVTDVDGKFVRQSGGKGQYGH
FT                   VVFTLEPQEAGKGFEFVDEIKGGVVPREYIPAVEKGVIEALTSGVLAGYPVVDVKVRLT
FT                   FGSYHDVDSSEQAFKMAAIFGFKEAARKANPVILEPMMAVEVETPEDYAGTVMGDLSSR
FT                   RGMVQGMDDMVGGGKAIKAEVPLSEMFGYATQLRSMTQGRATYTMEFKHYAEAPRNVSE
FT                   AIVAARAK"
FT   gene            289235..290425
FT                   /locus_tag="Dtpsy_0271"
FT   CDS_pept        289235..290425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0271"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: ajs:Ajs_3904
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31755"
FT                   /db_xref="GOA:B9MB71"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB71"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACM31755.1"
FT                   /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAK
FT                   GYDQIDNAPEEKARGITINTSHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLDKYDF
FT                   PGDDTPIIRGSAKLALEGDQSDKGEPAIMRLAEALDTYIPTPERAVDGAFLMPVEDVFS
FT                   ISGRGTVVTGRVERGIIKVGEEIEIVGIRDTQKTTVTGVEMFRKLLDQGQAGDNVGLLL
FT                   RGTKREDVERGQVLCKPGSIKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPADKEMVMPGDNVSITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            290453..290764
FT                   /locus_tag="Dtpsy_0272"
FT   CDS_pept        290453..290764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0272"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: dac:Daci_0390 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31756"
FT                   /db_xref="GOA:B9MB72"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB72"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ACM31756.1"
FT                   /translation="MSKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTR
FT                   MKRFDILRSPHVNKTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ"
FT   gene            291016..291690
FT                   /locus_tag="Dtpsy_0273"
FT   CDS_pept        291016..291690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0273"
FT                   /product="ribosomal protein L3"
FT                   /note="TIGRFAM: ribosomal protein L3; PFAM: ribosomal
FT                   protein L3; KEGG: ajs:Ajs_0278 50S ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31757"
FT                   /db_xref="GOA:B9MB73"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB73"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ACM31757.1"
FT                   /translation="MSLSNSLGLLGRKVGMMRLFTDDGDAVPVTVVDVSNNRVTQVKTQ
FT                   ENDGYVSLQVTFGSRKASRVTKPEAGHLAKAGVEAGEIIREFRVTPEVAGKYAAGAAVP
FT                   VADVFAVGQKVDVQGTSIGKGFAGTIKRHNFGSQRASHGNSRSHNVPGSIGMAQDPGRV
FT                   FPGKKMTGHLGDVTVTTQNLDVVRIDEARQLLLIKGAVPGSKGGFVTVRPAVKAQASKG
FT                   AN"
FT   gene            291690..292310
FT                   /locus_tag="Dtpsy_0274"
FT   CDS_pept        291690..292310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0274"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: ajs:Ajs_0279
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31758"
FT                   /db_xref="GOA:B9MB74"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB74"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ACM31758.1"
FT                   /translation="MQLELLNEQGQAASKVDVPETVFDRQYNEDLIHQIVVAYQANARQ
FT                   GTRAQKDREQVKHSTKKPFKQKGTGNARAGMTSSPLWRGGGRIFPNLPEENFSQKINKK
FT                   MYRAGMASILSQLAREGRLAVVDSLKLDTPKTKVLADKFKAMNLQSVMVIADEVDENLY
FT                   LASRNLKNVFVTEPRYADPVSLVHYKKVLVTKGAIDKLKEMFA"
FT   gene            292307..292621
FT                   /locus_tag="Dtpsy_0275"
FT   CDS_pept        292307..292621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0275"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: ajs:Ajs_0280
FT                   50S ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31759"
FT                   /db_xref="GOA:B9MB75"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB75"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ACM31759.1"
FT                   /translation="MSTLKFDEGRLMQVLVAPIVSEKATMVAEKSNAVTFKVLQNATKP
FT                   EIKAAVELMFKVEVKGVSVVNTKGKTKRFGKTMGRRDNVRKAYVLLKEGQELNLSGEAA
FT                   "
FT   gene            292625..293449
FT                   /locus_tag="Dtpsy_0276"
FT   CDS_pept        292625..293449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0276"
FT                   /product="ribosomal protein L2"
FT                   /note="TIGRFAM: ribosomal protein L2; PFAM: ribosomal
FT                   protein L2; KEGG: ajs:Ajs_0281 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31760"
FT                   /db_xref="GOA:B9MB76"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB76"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ACM31760.1"
FT                   /translation="MAVIKIKPTSPGQRGTVKISRDHLYKGEAFAGLLEPQFQKAGRNN
FT                   NGHITTRHKGGGHKHHYRVVDFRRNKDAIPAKVERIEYDPNRTAHIALVCYADGERRYI
FT                   IAPRNLEVGATIVSGSEAPIRVGNTLPIRNIPVGSTIHCIELKPGAGAQIARSAGTSAT
FT                   LLAREGVYAQVRMRSGEVRKIHIECRATIGEVANEEHSLRQLGKAGVKRWMGIRPTVRG
FT                   VAMNPIDHPHGGGEGRTGEGRHAVDPWGNLTKGYRTRNNKRTQVMIVSRRKK"
FT   gene            293460..293738
FT                   /locus_tag="Dtpsy_0277"
FT   CDS_pept        293460..293738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0277"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: ajs:Ajs_0282 SSU ribosomal protein
FT                   S19P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31761"
FT                   /db_xref="GOA:B9MB77"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB77"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ACM31761.1"
FT                   /translation="MTRSLKKGPFVDHHLVAKVEKAIATKDKKPVKTWSRRSMVLPEFI
FT                   GLTIAVHNGKQHVPVYVTDQMVGHKLGEFALTRTFKGHPADKKVQKK"
FT   gene            293748..294080
FT                   /locus_tag="Dtpsy_0278"
FT   CDS_pept        293748..294080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0278"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: ajs:Ajs_0283 50S ribosomal protein
FT                   L22P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31762"
FT                   /db_xref="GOA:B9MB78"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB78"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ACM31762.1"
FT                   /translation="MSETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNILAFTQKKAA
FT                   VIVKKVLESAIANAEHNDGADIDDLKVKTIFVEQGTTLKRFTARAKGRGNRISKPTCHI
FT                   YVTVGN"
FT   gene            294097..294963
FT                   /locus_tag="Dtpsy_0279"
FT   CDS_pept        294097..294963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0279"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: ajs:Ajs_0284 30S ribosomal protein S3;
FT                   TIGRFAM: ribosomal protein S3; PFAM: ribosomal protein S3-
FT                   domain protein; KH type 2 domain protein; Ribosomal protein
FT                   S3 domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31763"
FT                   /db_xref="GOA:B9MB79"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB79"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ACM31763.1"
FT                   /translation="MGQKIHPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREYLKA
FT                   KLKNAAVSRILIERPAKNARITIFSARPGVVIGKKGEDIENLKKELATRLGVPVAVNIE
FT                   EVRKPEIDAKLIADSITQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIA
FT                   RTEWYREGRVPLHTLRADIDYGTSEAKTTYGVIGVKVWVYKGDTLGRNDLPAAETPRPE
FT                   EERRPRGPRRDGRPGDRAGAGRGGRRPMGTNAAPADGSDKPAGAGGDSVKRVKSAPAAA
FT                   AADGKGE"
FT   gene            294966..295382
FT                   /locus_tag="Dtpsy_0280"
FT   CDS_pept        294966..295382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0280"
FT                   /product="ribosomal protein L16"
FT                   /note="TIGRFAM: ribosomal protein L16; PFAM: ribosomal
FT                   protein L16; KEGG: ajs:Ajs_0285 50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31764"
FT                   /db_xref="GOA:B9MB80"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB80"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ACM31764.1"
FT                   /translation="MLQPARRKFRKEQKGRNTGVATRGNSVAFGDFGLKCTDRGRLTAR
FT                   QIEAARRAISRHVKRGGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKVVF
FT                   EIVGVPEELAREAFRLAAAKLPLRTTFVARQIGA"
FT   gene            295395..295592
FT                   /locus_tag="Dtpsy_0281"
FT   CDS_pept        295395..295592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0281"
FT                   /product="ribosomal protein L29"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: ajs:Ajs_0286 50S ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31765"
FT                   /db_xref="GOA:B9MB81"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB81"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ACM31765.1"
FT                   /translation="MTKSAELRQKDVAGLEAEIKSLQKAHFGLRMQKATQQLGNTATLK
FT                   ATRRDIARAKTILAEKQAAK"
FT   gene            295602..295871
FT                   /locus_tag="Dtpsy_0282"
FT   CDS_pept        295602..295871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0282"
FT                   /product="ribosomal protein S17"
FT                   /note="TIGRFAM: ribosomal protein S17; PFAM: ribosomal
FT                   protein S17; KEGG: ajs:Ajs_0287 SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31766"
FT                   /db_xref="GOA:B9MB82"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB82"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ACM31766.1"
FT                   /translation="MTEAKKSLKRTLVGKVVSDKRAKTVTVLVERRVKHPIYDKIMIKS
FT                   SKYHAHDENGEYKMGDTIEITESRPLSKTKNWVATRLVQKAGLL"
FT   gene            295986..296492
FT                   /locus_tag="Dtpsy_0283"
FT   CDS_pept        295986..296492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0283"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ajs:Ajs_0288 redoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31767"
FT                   /db_xref="GOA:B9MB83"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB83"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACM31767.1"
FT                   /translation="MIQVGDTLPAITLMEYSEVEGNGCSLGPNPVDVQKAAAGKTIALF
FT                   AVPGAFTPTCSAKHVPGYVEQAGDLKAAGVDEIWCLSVNDAFVMGAWARDQKTDGKVRM
FT                   LADGDAAFAKATGLTLDLNGKGLGLRSNRYSMLVKDGKVVALNVEAPGKFEVSDAATLL
FT                   GQAKG"
FT   gene            complement(296636..297151)
FT                   /locus_tag="Dtpsy_0284"
FT   CDS_pept        complement(296636..297151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0284"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ajs:Ajs_0289 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31768"
FT                   /db_xref="GOA:B9MB84"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB84"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACM31768.1"
FT                   /translation="MPDSFCTVDHSPDVTLLSPALPHEMHVVRDIFQEYADSLDVDLSF
FT                   QNFAQELATLPGEYAPPRGHILLAEVEGSIAGCCALRPLDTADYPNACEMKRLYVRKAF
FT                   RGFGLGRQLAEAMLDQARQAGYACVLLDTLDGMESARALYSELGFEEIPPYYHNPLPGS
FT                   HYLKAEIY"
FT   gene            complement(297193..297861)
FT                   /locus_tag="Dtpsy_0285"
FT   CDS_pept        complement(297193..297861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0285"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: ajs:Ajs_0290 cytochrome
FT                   b561"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31769"
FT                   /db_xref="GOA:B9MB85"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB85"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ACM31769.1"
FT                   /translation="MPHTVRIWDLPTRLFHWSLAVTTVALVVTAKLGGNAMQWHLRLGY
FT                   VMLALLAFRLAWGLVGGRWSRFASFLPTPARLRSHFANQEGKVTSPGHSPLGALSVFAL
FT                   LAVLLAQVGTGLLSDDEIAFAGPLTRFVSGEWVSQATWYHKDVGQFLLLGLVALHLAAI
FT                   VFYALVRRQALVGAMVHGDRQLPGATPASRDDALSRAGAALVAALSALLAWWVASLGAF
FT                   "
FT   gene            298042..298503
FT                   /locus_tag="Dtpsy_0286"
FT   CDS_pept        298042..298503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0286"
FT                   /product="cytochrome c prime"
FT                   /note="PFAM: cytochrome c prime; KEGG: ajs:Ajs_0291
FT                   cytochrome c, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31770"
FT                   /db_xref="GOA:B9MB86"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="InterPro:IPR015984"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB86"
FT                   /inference="protein motif:PFAM:PF01322"
FT                   /protein_id="ACM31770.1"
FT                   /translation="MPIKALALAATAAAATLVSLPAAAQFAKPEDAIKYRQGALFVMGQ
FT                   HFGRIGAMANGRVPFDAKAAQENADTVAALAALPWAGFGPGTDKGAPTKAKPGVWTEQA
FT                   KFQEHADKFQAEAAKLAAAAKTGSLDNLKAAFGPAANSCKACHDAYRAR"
FT   sig_peptide     298042..298116
FT                   /locus_tag="Dtpsy_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.822 at
FT                   residue 25"
FT   gene            complement(298599..299102)
FT                   /locus_tag="Dtpsy_0287"
FT   CDS_pept        complement(298599..299102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0287"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ajs:Ajs_0292 redoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31771"
FT                   /db_xref="GOA:B9MB87"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB87"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACM31771.1"
FT                   /translation="MQIKKWLAAGALVAGAAVGAVVVLGSGTSQAPQSTFVLLDGSQQT
FT                   TADLKGKVALVNFWATSCTTCVAEMPEIVATYDKYKGQGFETLAVAMSYDPPSYVVNFT
FT                   ETRKLPFKVAIDNTGAVAKAWGDVKLTPTTYIVNKRGEIVKSYIGAPDFEELHKLIERL
FT                   LAEA"
FT   sig_peptide     complement(299025..299102)
FT                   /locus_tag="Dtpsy_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.735 at
FT                   residue 26"
FT   gene            299356..299919
FT                   /locus_tag="Dtpsy_0288"
FT   CDS_pept        299356..299919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31772"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB88"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0293"
FT                   /protein_id="ACM31772.1"
FT                   /translation="MTLAPAGARRLLTLAFAASMLALAACSPALNWRSVTLPDAGLALT
FT                   LPCKPEYASRPVDLGTGAVPLAMVGCEADGATFAVSHMPLAEAAQAGAMLARWQAAVQA
FT                   GMRASQPAAPVAFVPTRALAVPQSVRLQAQGQAPGGSAVTVDAVWFARLEGGQARLYHA
FT                   AVYAPRRTTATAADTFFASLALQP"
FT   sig_peptide     299356..299451
FT                   /locus_tag="Dtpsy_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.552 at
FT                   residue 32"
FT   gene            299916..301154
FT                   /locus_tag="Dtpsy_0289"
FT   CDS_pept        299916..301154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0289"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ajs:Ajs_0294 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31773"
FT                   /db_xref="GOA:B9MB89"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB89"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACM31773.1"
FT                   /translation="MSVLTRRTAVVVFLAFAFTYFISALLRAITATLAPTLEAEFQLHA
FT                   RDLGLLAGGYFLGFSLTQLPLGRWLDRHGPRVVLLGFLGVAVAGCLVFSWATGFSGLLA
FT                   GRMLCGAGVSACLMAPLTGFRRWLEPGAQLRANSWMLMTGSLGMVASTLPVQWLLPLAG
FT                   WRPLFWGLAALIVLAMALLALGVPRWPQAPAESGAGVETGYAQVWRHPYFLRTAPLGFF
FT                   CYGGMVAVQTLWAAPWMQHVAGYTPLQAATGLFWINVSMLITFWTWGMASPWLLRRVGG
FT                   ADPVMAASLPLSLLVLAGIVLAGGRAGAAAWALYCVSCTSVALSQPAVALAFPQALAGR
FT                   ALSAYNLVIFAGVFAVQWGIGLAVDAFVAAGLDMARAYRAAMALHLACTAGAYAWFMAR
FT                   RGHGDNALHCSTP"
FT   sig_peptide     299916..300002
FT                   /locus_tag="Dtpsy_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.771 at
FT                   residue 29"
FT   gene            301151..301600
FT                   /locus_tag="Dtpsy_0290"
FT   CDS_pept        301151..301600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0290"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: ajs:Ajs_0295 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31774"
FT                   /db_xref="GOA:B9MB90"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB90"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ACM31774.1"
FT                   /translation="MNTRLLIIAHAPLAHALRECALHVFPDCWQEVLALDVPPHEAPEA
FT                   TLLAARALMEQQGEASVLVLSDLFGATPCNVAQRLVDGLQSRLVAGVNLPMLLRAVSYR
FT                   SEPLDALVARALVGGTQGVMQVGAAAPQNQNRRPSHDQEEHHHQQ"
FT   gene            301569..301838
FT                   /locus_tag="Dtpsy_0291"
FT   CDS_pept        301569..301838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0291"
FT                   /product="phosphocarrier, HPr family"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: ajs:Ajs_0296
FT                   phosphotransferase system, phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31775"
FT                   /db_xref="GOA:B9MB91"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB91"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ACM31775.1"
FT                   /translation="MIKKNITISNKLGLHARASAKLTKMAGSFPCDVWMSKGERRINAK
FT                   SIMGVMMLAAGMGSEVEIETDGAQEQEAMDALVALIDGKFGEGE"
FT   gene            301857..303626
FT                   /locus_tag="Dtpsy_0292"
FT   CDS_pept        301857..303626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0292"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein; KEGG: ajs:Ajs_0297
FT                   phosphoenolpyruvate--protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31776"
FT                   /db_xref="GOA:B9MB92"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB92"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ACM31776.1"
FT                   /translation="MTFSIHGLAVARGIAIGRAVLAVSSRMEVVHYFIEPGQVEAEILR
FT                   ARRGRDAVAEELQRLQADMPHDAPPELAALLDVHLMLLQDEMLVNGVKHWITDRLYNAE
FT                   WALTTQLEIISRQFDEMEDDYLRERKADLEQVVERILRHMRGVASPVAPPPSAPRRQAE
FT                   AGAEAEFLLGGAADAPLVLVAHDLSPADMLQFKQSVFAGFVTDVGGKTSHTAIVARSMD
FT                   IPAVVGARSASQLVRQDDWVIIDGDAGVVIVDPTPIILAEYGFRQRQITLERERLMRLR
FT                   HTPAVTLDAQAIELLANIEQPGDAGAALRAGAAGVGLFRSEFLFMGRSGRLPDEEEQYR
FT                   AYREAVEGMQGLPVTIRTVDVGADKPLDKGYKDSSLNPALGLRAIRWSLADPAMFRTQL
FT                   RAVLRAAAHGPVRLLFPMLAHVSEIRQTLAQVDLARAELDARSAAYGAVQLGAMIEVPA
FT                   AALMVRQFLRYFDFLSIGTNDLIQYALAIDRADEAVAHLYDPLHPAVLRLVADVIAEGA
FT                   RQGKSVSVCGEMAGDVAMTRLLLGLGLRSFSMQPAQILAVKQEVLRADARKLGEWAQQL
FT                   LDADDPAASLQAP"
FT   gene            complement(303698..304678)
FT                   /locus_tag="Dtpsy_0293"
FT   CDS_pept        complement(303698..304678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0293"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: ajs:Ajs_0298 lipoyl synthase; TIGRFAM: lipoic
FT                   acid synthetase; PFAM: Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31777"
FT                   /db_xref="GOA:B9MB93"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB93"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ACM31777.1"
FT                   /translation="MSTPDVVREAQSTEAYNPLAKQKAAAKLSRIPIKVEQGEVLKKPE
FT                   WIRVKAGSPTTRFYEIKNILREHKLHTVCEEASCPNIGECFGRGTATFMIMGDKCTRRC
FT                   PFCDVGHGRPDPLDKDEPLNLAKTIAALRLKYVVITSVDRDDLRDGGSGHFVECIQRTR
FT                   ELSPSTQIEILTPDFRGRDDRALEILKAAPPDVMNHNLETVPRLYKEARPGSDYQFSLN
FT                   LLKKFKQLHPGVPTKSGLMVGLGETDEEILEVMRDMRAHGIEMLTIGQYLAPSNSHLPV
FT                   RRYVHPDTFKMFEEEAYKMGFSHAAVGAMVRSSYHADQQAHAAGV"
FT   gene            complement(304696..305376)
FT                   /locus_tag="Dtpsy_0294"
FT   CDS_pept        complement(304696..305376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0294"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: ajs:Ajs_0299
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31778"
FT                   /db_xref="GOA:B9MB94"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB94"
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /protein_id="ACM31778.1"
FT                   /translation="MLGRVDYPATVAAMQRFTEERTDETPDELWICEHPAVYTQGLAGK
FT                   SDHVLSPGGIPVVATNRGGQVTHHGPGQVVAYPLIDLRRAGYYVKEYVYRIEEAVIRTL
FT                   GHYGVTGHRVAGAPGIYVRLDDPHGHSMLPQRPQKRAHADGPPQPDFTGLGKIAALGIK
FT                   VARHCTYHGVALNVAMDLEPFSRINPCGYAGLQTVDLSTIGVHIPWDDAAAMLGQQLAR
FT                   RLAP"
FT   gene            complement(305400..305696)
FT                   /locus_tag="Dtpsy_0295"
FT   CDS_pept        complement(305400..305696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0295"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   ajs:Ajs_0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31779"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB95"
FT                   /inference="protein motif:PFAM:PF04359"
FT                   /protein_id="ACM31779.1"
FT                   /translation="MTTPSQPSSADPRKDSLIEYPSRFPIKVMGANVNGFVHAVTEVAR
FT                   RFDPDFDASTIELRDSRAGNYLGVTITVTATSREQLDDLYRALTSHPMVKVVL"
FT   gene            305937..306425
FT                   /locus_tag="Dtpsy_0296"
FT   CDS_pept        305937..306425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0296"
FT                   /product="ATP synthase I chain"
FT                   /note="PFAM: ATP synthase I chain; KEGG: ajs:Ajs_0301
FT                   putative ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31780"
FT                   /db_xref="GOA:B9MB96"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB96"
FT                   /inference="protein motif:PFAM:PF03899"
FT                   /protein_id="ACM31780.1"
FT                   /translation="MAQASSNDKKIASETESEVEDSDFKPLTAQEAREWRSRHPALSVW
FT                   RIVWGQAAVGAVVALLAWWLTGRLPVAWSAGYGALSVVVPAALFARGMARRRSTAGAAM
FT                   VGLLGWELVKIALTVAMLAAAPRVVPGLSWLALLVGMVVTMKTYWIALLARPGVRRTD"
FT   gene            306448..307311
FT                   /locus_tag="Dtpsy_0297"
FT   CDS_pept        306448..307311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0297"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   ajs:Ajs_0302 F0F1 ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31781"
FT                   /db_xref="GOA:B9MB97"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB97"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACM31781.1"
FT                   /translation="MAADAHAPTASEYIVHHLQHLQNIKQKSIIDFSVVNLDSVAVSVI
FT                   LGVLGLFVMWLAARTATSGVPGRFQAAVEMLVEMVDNQAKANIHNAQSRKFIAPLALTV
FT                   FVWIFLMNAMDLLPVDLLPVLWQGATGDSHAYLRVVPTADLSTTLGLSSAVLILCFVYS
FT                   IKIKGMGGWAHELVTAPFGTSKNPVFALILGVVNLLMQIIEYVAKTVSHGMRLFGNMYA
FT                   GELVFMLIALMGGAAAMSLSGVLLPVGHIIAGSIWAIFHILIITLQAFIFMMLTLIYLG
FT                   QAHEAH"
FT   gene            307363..307611
FT                   /locus_tag="Dtpsy_0298"
FT   CDS_pept        307363..307611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0298"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   dac:Daci_0415 F0F1 ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31782"
FT                   /db_xref="GOA:B9MB98"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MB98"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ACM31782.1"
FT                   /translation="MENILGLVALACGLIVGLGAIGASIGIALMGGKFLESSARQPELI
FT                   NELQTKMFILAGLIDAAFLIGVAIALLFAFANPFVLA"
FT   sig_peptide     307363..307431
FT                   /locus_tag="Dtpsy_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.812 at
FT                   residue 23"
FT   gene            307647..308117
FT                   /locus_tag="Dtpsy_0299"
FT   CDS_pept        307647..308117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0299"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   ajs:Ajs_0304 F0F1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31783"
FT                   /db_xref="GOA:B9MB99"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:B9MB99"
FT                   /inference="protein motif:TFAM:TIGR01144"
FT                   /protein_id="ACM31783.1"
FT                   /translation="MSINATLFVQAIVFLILVLFTMKFVWPPIAKALDERAQKIADGLA
FT                   AADRAKTELAAADQRVKQELAAASNETATRLADAERRAQAIIEEAKARANDEGNKIVAA
FT                   ARAEAEQQAIQAREALREQVAALAVKGAEQILRKEVNAGVHADLLNRLKTEL"
FT   gene            308129..308671
FT                   /locus_tag="Dtpsy_0300"
FT   CDS_pept        308129..308671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0300"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: ajs:Ajs_0305 F0F1 ATP synthase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31784"
FT                   /db_xref="GOA:B9MBA0"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBA0"
FT                   /inference="protein motif:TFAM:TIGR01145"
FT                   /protein_id="ACM31784.1"
FT                   /translation="MAELATIARPYAEALYKACTDQAGVDLNGATAWVDELAAIAANPQ
FT                   LRQLADNPKVTGEQVFDVIVGVARSALPDLAKNFLRTVIDNGRVQALPEIAAQFRTLVN
FT                   RSHGTSDAVVYSAFPLDAGALTDVGATLEKRFGRKLNLSVQLDETLIGGVRVVVGDEVL
FT                   DTSVKARLEQMKAALTA"
FT   gene            308717..310276
FT                   /locus_tag="Dtpsy_0301"
FT   CDS_pept        308717..310276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0301"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: ajs:Ajs_0306 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31785"
FT                   /db_xref="GOA:B9MBA1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBA1"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ACM31785.1"
FT                   /translation="MQLNPAEISELIKSRIEGLAASSDIRNQGTVVSVTDGIVRVHGLS
FT                   DVMQGEMLEFPAAADGQPSFGLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPV
FT                   GPELIGRVVNALGQPIDGKGPINAKMTDVIEKVAPGVIARQSVDQPLQTGLKSIDSMVP
FT                   IGRGQRELIIGDRQTGKTAVAIDAIINQKGQGVTCIYVAIGQKASSIKNVVRALEQAGA
FT                   MEYTIVVAASASESAAMQYVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLL
FT                   LRRPPGREAFPGDVFYLHSRLLERAARVNADYVEAFTKGEVKGKTGSLTALPVIETQAG
FT                   DVSAFVPTNVISITDGQIFLETSLFNAGIRPAINAGISVSRVGGAAQTKLIKGLSGGIR
FT                   TDLAQYRELAAFAQFASDLDEATRKQLDRGARVTELLKQPQYSPLSTALMGATLFTVNK
FT                   GFLDDVDVKKVLAFEAGLHQYLKTSHGALLDRLQQNRAFDKEGKDEAELTQAITAFKKS
FT                   FV"
FT   gene            310295..311161
FT                   /locus_tag="Dtpsy_0302"
FT   CDS_pept        310295..311161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0302"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: ajs:Ajs_0307 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31786"
FT                   /db_xref="GOA:B9MBA2"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBA2"
FT                   /inference="protein motif:TFAM:TIGR01146"
FT                   /protein_id="ACM31786.1"
FT                   /translation="MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMRAARPY
FT                   AEKVRNIAAHLGEANPEYVHPFMKANDAKAAGIIVVTTDKGLCGGMNTNVLRAVTTKLR
FT                   ELQSTGVDVQSVAIGNKGLGFLNRVGAKVVAHATGLGDTPHLDKLIGPVKVLLDAYAEG
FT                   KINAVYLSYTKFINTMKQESVVEQLLPLSSEQMQAQKTGHGWDYIYEPDAQSVIDELLV
FT                   RYVESLIYQAVAENMASEQSARMVAMKAATDNAGNVINELKLVYNKTRQAAITKELSEI
FT                   VAGAAAV"
FT   gene            311204..312610
FT                   /locus_tag="Dtpsy_0303"
FT   CDS_pept        311204..312610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0303"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; KEGG: ajs:Ajs_0308 F0F1 ATP synthase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31787"
FT                   /db_xref="GOA:B9MBA3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBA3"
FT                   /inference="protein motif:TFAM:TIGR01039"
FT                   /protein_id="ACM31787.1"
FT                   /translation="MAQVQGKIVQCIGAVVDVEFPRDQMPKVYDALKLEGSPLTLEVQQ
FT                   QLGDGVVRTIALGSSDGLKRGLMVTNTGNPITVPVGKATLGRIMDVLGNPIDERGPVDQ
FT                   SLTASIHRKAPAYDELSPSQELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   INNIAKAHSGLSVFAGVGERTREGNDFYHEMADSGVVNLENLGESKVAMVYGQMNEPPG
FT                   NRLRVALTGLTIAESFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAE
FT                   EMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIAALGIYP
FT                   AVDPLDSTSRQLDPQVVGEEHYQVARQVQGTLQRYKELRDIIAILGMDELAPEDKLVVA
FT                   RARKIQRFLSQPFHVAEVFTGSPGKYVPLSETIRGFKMIVAGECDHLPEQAFYMVGTID
FT                   EAFEKAKKVA"
FT   gene            312686..313102
FT                   /locus_tag="Dtpsy_0304"
FT   CDS_pept        312686..313102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0304"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: ajs:Ajs_0309 F0F1 ATP synthase subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31788"
FT                   /db_xref="GOA:B9MBA4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBA4"
FT                   /inference="protein motif:TFAM:TIGR01216"
FT                   /protein_id="ACM31788.1"
FT                   /translation="MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRI
FT                   KPGSVRIELPDGNEEFVFVAGGILEVQPDCVTVLSDTAIRGRDLDDQKAQEAKAAAEEA
FT                   LKNAKSEIDLARAQSELAVMAAQIAALRKFRQKR"
FT   gene            313233..314333
FT                   /locus_tag="Dtpsy_0305"
FT   CDS_pept        313233..314333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0305"
FT                   /product="putative mRNA 3-end processing factor"
FT                   /note="KEGG: ajs:Ajs_0310 putative mRNA 3-end processing
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31789"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBA5"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0310"
FT                   /protein_id="ACM31789.1"
FT                   /translation="MVNPLAESAADALVVARPEGLYCPPGGFYIDPWRPVDRAVITHGH
FT                   GDHARRGHGHYLAHEHSAGVLRGRLGADIALQTLAYGEPLHHNGVRISLHPAGHVLGSA
FT                   QVRLEHGGRVWVASGDYKLEADGTCAPFEPVRCDTFITESTFGLPIYRWPAQAVLQAQI
FT                   NDWWRSNAAMRRPSVLFCYAFGKAQRILHGVDASIGPLLMHGAVEPLNAAYRAAGVRLP
FT                   PTQGATDASLDAATRETALVLAPPSAQGTPWMRRFPRHADAFASGWMQLRGTRRRRGVD
FT                   RGFVLSDHADWPGLQQAIAATGAERVFVTHGSVAVMVRWLREQGLDAQAFATEYGDEDE
FT                   AAPTDAPTAAPTAPEGDAGDAAGGTS"
FT   gene            314333..316012
FT                   /locus_tag="Dtpsy_0306"
FT   CDS_pept        314333..316012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0306"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase domain protein; ATP
FT                   dependent DNA ligase; KEGG: ajs:Ajs_0311 ATP-dependent DNA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31790"
FT                   /db_xref="GOA:B9MBA6"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBA6"
FT                   /inference="protein motif:PFAM:PF01068"
FT                   /protein_id="ACM31790.1"
FT                   /translation="MQAFAALYQALDASTSSLAKQAALRDYLRGAPPEDAAWAVYFLAG
FT                   GKPRQLVPTKLLRAVAREAAGLPEWLFDESYEAVGDLAETIALLLPPPTQAHALGLAAW
FT                   MREHLLPLRGLAPDTQAERLGAQWARLAPEERLVYFKLITGAFRVGVSRLQVTQALAAV
FT                   SGVDAKRIAQRLMGYTHVGAQPGAADYQRLVAPEGDSAGAQAAEAQGHPYPFFLAHPLQ
FT                   LPVAQFDAALGPPADWIVEWKWDGIRAQLVRRAGATWLWSRGEELVTDRFPELQALGDE
FT                   ALPDGTVLDGEIVVWQPARADAPAQPRPFADLQKRIGRKSLGSKLLREVPVVLLAYDLL
FT                   EEHGQDLRGLPLQARRARLDALLARTDHPALVPSPVLQGQSWAELARLRDSARALGVEG
FT                   MMLKRRTAHYGVGRTRDVGIWWKWKIDPMSVDAVLIYAQRGHGRRASLYSDYTFAVWSA
FT                   PQGTEGRTLVPFAKAYSGLTDAEMARVDAIIRKTTVESFGPVRSVRPTLVFELGFEGIA
FT                   RSARHKSGIAVRFPRMLRWREDKPVDEADSLDTLAALLPATS"
FT   gene            316104..319016
FT                   /locus_tag="Dtpsy_0307"
FT   CDS_pept        316104..319016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0307"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: helicase domain protein; DEAD-like helicases; KEGG:
FT                   ajs:Ajs_0312 DEAD/DEAH box helicase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31791"
FT                   /db_xref="GOA:B9MBA7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBA7"
FT                   /inference="protein motif:PFAM:PF08494"
FT                   /protein_id="ACM31791.1"
FT                   /translation="MPWLRGATGGAVTAPRFPLATGWLATRGWAPFAFQRQVWRAIAQG
FT                   RSGLLHATTGAGKTYAVWLGALQAFADWESKRPVAPVHPAVHAINNEAAPRTAPLTVVW
FT                   ITPMRALAADTLRALAAPLQALAAQHAGLARWSLGARTGDTGSAERSAQARRLPTVLVT
FT                   TPESLSLLLARADAREQLARVRLVVADEWHELLGNKRGVQVQLALARLAGWNPQLMVWG
FT                   MSATLGNLPEAMQTLLGREGGTLVRGRVEKRLVVDTLLPERPERFTWAGHLGLAMLPAV
FT                   VRALEESPGTTLVFVNVRSQAEQWYQALLDARPDWAGQIAIHHGSLDRGVREWVEAGLK
FT                   SGSLRAVVCTSSLDLGVDFLPVQRVLQIGSAKGVARLLQRAGRSGHAPGRPSRITLVPT
FT                   HSLELVEAAAARAAVHAERVEKRVSPHQPVDVLVQHLATVALGGGFEPEALYAEVRRTT
FT                   AYRTLPRGVWQWCLDFVARGGSALAAYPDYRRVVPDENGVWRLPDARLARRHRANIGTI
FT                   VSDASMQVQILQGARLGAVEEGFIARLSPGDCFVFAGQVLELVRTREMTAFVRRAPGRQ
FT                   PTVPRWNGSRMPLSTVLADYVVQQLAQAGRGRYASPELRAVRPLLEVQRRWSALPTPGT
FT                   LLAETLHTREGWHLFLYPFAGRHAHIGLASLFAWRAAQGVPGTFSIAVNDYGLELLSAT
FT                   ERDWPALLPDLLRTDAAAPQAARQAHGLAPDEALAIRNTANATAPEGVPQERDARAALL
FT                   HEVLASLNATEMARRRFREIARVAGLIFQSHPGEQRSARQLQASSQLFFEVFRRYDAGN
FT                   LLLRQADQEVLSQELDVAQLLAALTRMQAQQLMVRPLVRPGPLAFPLMVERFREQLSNE
FT                   ALADRIARMLGDMEAAASARKPVPAPPVQDVVPPDPPRRRRAAPPAAPPRQEASSAVTD
FT                   ALRCTLDFADASEGTGAAPAAARGRSPRRARKPSRPLPRL"
FT   gene            319020..319694
FT                   /locus_tag="Dtpsy_0308"
FT   CDS_pept        319020..319694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0308"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ajs:Ajs_0313
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31792"
FT                   /db_xref="GOA:B9MBA8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBA8"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACM31792.1"
FT                   /translation="MHAPDLPADLAVDLAGTTVWLLPERALWWPEGAMLCLADLHLGKA
FT                   ATFRARGLPVPAGTTQGNLDRLAQLLARHPGVQRLVVLGDFLHAAEAHAPALLRALAAW
FT                   REDHAALELVLVRGNHDRHAGDPPAWLRARIVEEPWSLGPFACCHHPQHRAGQWVLAGH
FT                   LHPTAVLYGGGRDALRMPCFVAEPGLLVLPAFGEFTGGHAVPAAPGRQRFAVGAGRVWA
FT                   LP"
FT   gene            complement(319743..320294)
FT                   /locus_tag="Dtpsy_0309"
FT   CDS_pept        complement(319743..320294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0309"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   ajs:Ajs_0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31793"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBA9"
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /protein_id="ACM31793.1"
FT                   /translation="MVTPSSSPPSGVLARLARLLRHRWSDGGLHQALPPEVLERLGQRV
FT                   AASERRHTGQIRICVEGGLPLSYLWRGATARERAVTQFGKLRVWDTEHNNGVLIYLMLA
FT                   EHAIEIVADRALARRVPPATWRSMVSHMAEAFRQGRHEDGLTQALSEVSALLVEHFPAT
FT                   EGVDRPNELPDAPVIPGTVD"
FT   gene            complement(320320..321228)
FT                   /locus_tag="Dtpsy_0310"
FT   CDS_pept        complement(320320..321228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0310"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   ajs:Ajs_0315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31794"
FT                   /db_xref="GOA:B9MBB0"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBB0"
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /protein_id="ACM31794.1"
FT                   /translation="MPLALALQALIAIFLVAIGALPATAQPLRAVPALQARVIDQTGTL
FT                   NDAQRQRLEARLAAIEQQHGSQVVVLMVPTTAPEDIAAFANRVGNAWKIGRKDVGDGVL
FT                   VVVAKDDRRMRIEVAKALEGAIPDIAAARIIDGAMKPRFREGDFAGGLDAAVQQIGARI
FT                   AGENLPAPQSSQQGDGQGRGASAGFDWTDLAVFLFFGVMVAGPVVRRLFGQRLGGLVMG
FT                   GGAGFLAFIVTSSLLLAGGAGLLALLYTWIFAGRGGPVVWHGGGGGWGGGHGGGWGGGG
FT                   GGGFGSGGGGDFGGGGASGDW"
FT   sig_peptide     complement(321151..321228)
FT                   /locus_tag="Dtpsy_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            complement(321250..321855)
FT                   /locus_tag="Dtpsy_0311"
FT   CDS_pept        complement(321250..321855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0311"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: ajs:Ajs_0316 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31795"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBB1"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ACM31795.1"
FT                   /translation="MKRLIAMLSAVLALSGCGYNDFQRLDEQSKAAWSEVLNQYQRRAD
FT                   LVPNIVATVKGEAAFEQETLTKVIEARAKATSIQVTPETLNNPEAFNKFQQAQGELSSA
FT                   LSRLMVVAERYPQLQANQAFRDLRVTLEGTENRITVARNRYIQTVQEYNVLARSFPTNL
FT                   TAMVFGYEPKPSFTVANEAEISAPPQVDFSSPAPASKP"
FT   sig_peptide     complement(321793..321855)
FT                   /locus_tag="Dtpsy_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.584 at
FT                   residue 21"
FT   gene            322000..322449
FT                   /locus_tag="Dtpsy_0312"
FT   CDS_pept        322000..322449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31796"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBB2"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0317"
FT                   /protein_id="ACM31796.1"
FT                   /translation="MPRTPLRAAALAGSPDDLEAAFYDALQAGDVERVMACWADEDDIV
FT                   CVHPGAARHVGPAAIRAAFATLLQQGGLNVHPAQVMRVQALASAVHSVLEHVRVMLPDG
FT                   PREAVVQATNVYHKTPQGWRLVAHHASAAGMHEAEGAAPAGHLLH"
FT   gene            322522..323526
FT                   /locus_tag="Dtpsy_0313"
FT   CDS_pept        322522..323526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0313"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="KEGG: ajs:Ajs_0318 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31797"
FT                   /db_xref="GOA:B9MBB3"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBB3"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0318"
FT                   /protein_id="ACM31797.1"
FT                   /translation="MKYEAPWWLPGGHAQTIWPALWARRTLGPPPAYVRERWLAPDGDF
FT                   VDVDFLRPCAAAGAAPAPLLVLFHGLEGSSRSHYAQAFAGVARERGWGFAVPHFRGCSG
FT                   EINRAPRAYHSGDHEEIDWILRRLAGLQRTGGGARAPLLAVGVSLGGNALMRWAGEQGG
FT                   SALASADAIASVCAPLDLAAGGHAIGRGFNRQVYTRMFLRTMVPKALAKLAQYPGLFDR
FT                   AALLAARDLHAFDDIFTAPLHGFRDADDYWRRASAKPLLPAVRVPALLVNARNDPFVPG
FT                   ASLPRDGEVAPVVTLWQPAHGGHVGFAQGGWPGHVRALPEAVAAWLADHAALG"
FT   gene            323567..324106
FT                   /locus_tag="Dtpsy_0314"
FT   CDS_pept        323567..324106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31798"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBB4"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0319"
FT                   /protein_id="ACM31798.1"
FT                   /translation="MDDIVKQAIAKWPNVPACYGWLGLDARGHWYLRDDAVQLQGGFAV
FT                   ARGTRLEHAKLIEFIHRNYEADGEGRWFFQNGPQRVYVELEATPLIWRLGADGEPVAHT
FT                   GRPAGRANECLVDEAGRVYLACTAGLGLVHSLDVEALARQIDQGRWTPREVLAADLPGA
FT                   YGFVPSPQAVAGPLPA"
FT   gene            complement(324183..324722)
FT                   /locus_tag="Dtpsy_0315"
FT   CDS_pept        complement(324183..324722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0315"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: ajs:Ajs_0320
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31799"
FT                   /db_xref="GOA:B9MBB5"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBB5"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACM31799.1"
FT                   /translation="MSDTHDEAHTGPIKNPKQLLVTVIFAFVLPVFAIIGLVLFVTADK
FT                   KPAAGSANPELAVAQRIQKIGNVEVRDANRPLRTGEAVFQGQCAACHATGAAGAPKLGD
FT                   AAAWAPRIATGFEALVQSALKGKGAMAPQGGGDFDDTEIARGVAYMANAAGAKFEEPNR
FT                   PGAEGGAAAASAPASN"
FT   gene            complement(324843..326288)
FT                   /locus_tag="Dtpsy_0316"
FT   CDS_pept        complement(324843..326288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0316"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: ajs:Ajs_0321 RND efflux system outer
FT                   membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31800"
FT                   /db_xref="GOA:B9MBB6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBB6"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ACM31800.1"
FT                   /translation="MQSHTLNRARPARALSPLLAAALVAGCSFIPTYERPAAPVPQAYP
FT                   LAGAESTTSARAAADIDWKEYFTDPRLQRLIGMALGNNRDLRVAMLNVEQARAQFQIQR
FT                   ANQFPTVNAIASGTRQPSATTGSYANQFQVGLGISAWEIDFFGRVAALKEQALAQYLAT
FT                   DEARKSAQISLVAAVASGWLTLMADEELLDISRRTLETRDESVKLTRLRLENGVSSELD
FT                   NRQAESLAQAARATYAQQQRQRMLDENALVLLLGQPLPDDIRASLPSSRLADATPMQAL
FT                   PAGLPSDLLVRRPDVRMAEQQLIGANANIGAARAAFFPRISLTAQFGTVSDELSGLFKS
FT                   GSWAFSLAPQLALPIFDAGRNQAGLESARAGREIAVAQYEKSIQTAFREVSDALAGQAT
FT                   LQEQVDAQRAQAQADAKRFELSDLRYRNGVASYLDLLDAQRSLFATQQSLVVTRLQQLQ
FT                   NQVTLYKVLGGGWTAPAEETPRS"
FT   sig_peptide     complement(326184..326288)
FT                   /locus_tag="Dtpsy_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.615) with cleavage site probability 0.356 at
FT                   residue 35"
FT   gene            complement(326313..329459)
FT                   /locus_tag="Dtpsy_0317"
FT   CDS_pept        complement(326313..329459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0317"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   aav:Aave_0388 transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31801"
FT                   /db_xref="GOA:B9MBB7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBB7"
FT                   /inference="protein motif:TFAM:TIGR00915"
FT                   /protein_id="ACM31801.1"
FT                   /translation="MAKFFIERPIFAWVIAIFIMVIGAVSITQLPVAQYPTVAPPTIQV
FT                   TVAYPGATAQTLEDNVLSVIEREMNGATGLAYMETTSQANGTGTIVLSFEPGTNDDLAQ
FT                   VDVQNRLSRATPRLPAAVTQQGVRVEKSRSNFLLFSILTSDNPDINIDALNDYAARNVV
FT                   PELQRLPGVGGVTQFGSERAMRIWIDPAKLKGFNLSLDQVNASIRAQNVQVSAGNLGEL
FT                   PSPAGQTISATIVVKGQLSTPEEFGNVILRANTDGSTVRLKDVARIELGAQTYNFSGRL
FT                   NGSPSVGMGVQLTSSANALATADAVKSKLAELQRYFPQGVAYTIPYDTSTFISVSIEKV
FT                   VYTLLEAIGLVFLVMFLFLQNFRYTIIPTIVVPVALLGTFGALLAMGFSINVLTMFGMV
FT                   LVIGIVVDDAIVVVENVERIMAEEGLPPLQATRKAMGQISSAVIGMTVVLVSVFVPLAF
FT                   FAGSTGNIYRQFAVTMATSIAFSAFLALSLTPALCATLLKPVTEGHHDKTGFFGWFNRS
FT                   FKHATHSYESFLARLVRRSGRMMIIYAVLLGAVAVVYMRLPTSFLPNEDQGFLISNVQL
FT                   PPGASQERTRAALTKVEEFMLKQPEVRDIVTVSGFSFSGQGQNAGLAFITLKDWSERPG
FT                   PDQTAQAVAGRAMGALGGFRDAFIFTLSPPPIPELGSASGFTFRLQDRGSKGHDALLAA
FT                   RNQLLGMASQSKVLAAVRPDGMEDAPQMQIDIDRDKANALGVSYDRIASALATALGSTY
FT                   VNDFPNQGRLQRVVVQADGFARMQPESVLDIPILNDKGQVLPLSTFASTRWITGAMQTV
FT                   RYNGYPSMKIAGDAAPGYSTGDAMAEMERLASQLPEGFSFEWTGQSREEKLAGSQALVL
FT                   YAFALLAVFLCLAALYESWSIPFSVMLVVPLGVLGVVLGVLLRGMANDVYFQIGLVTII
FT                   GLSAKNAILIVEFAKDLQAQGKNIIEAALEAAHLRFRPIVMTSLAFTLGVVPLYLASGA
FT                   SSASQRAIGTGVVGGMITGTLLAVVFVPVFFVVVRSFFKGSRRQQEHDAQQALQHRGEA
FT                   "
FT   gene            complement(329478..330788)
FT                   /locus_tag="Dtpsy_0318"
FT   CDS_pept        complement(329478..330788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0318"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ajs:Ajs_0323 RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31802"
FT                   /db_xref="GOA:B9MBB8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBB8"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACM31802.1"
FT                   /translation="MPRLNNATARAIRPFQRTPVPAALAVALAAALALGACGQKSDAPA
FT                   AGASPRAPEVGVVTVQPGDIGLVTELPGRLEASRVAEVRARAAGILQKRLFREGSDVKA
FT                   GQQLFLIDSAPYQASVAQAEASVAQAEASLAQSRALAERYRPLVAVNAISKQEYDNAVA
FT                   AQKTAEANVAAAKAALTTSRINLGYATVTAPISGRIGRALVTEGALVGQGTPTELAVIQ
FT                   QIDPLYINFTQSASEAIKLKAAMASGKYKQSSANAANVRVVLEDGSVYPQAGRLLFTDL
FT                   TVDATSGQVTLRAEVPNSDRSLLPGLYVRVRLEQAQVDNGILLPQQAVTRSGKADTVLV
FT                   VGADNHVTPRVVKLGPAQGAHWVVLEGLKSGEQVMVDGFQKLPRGKPGDPIVVKPVAWQ
FT                   AAGAAQQPAAAPASAPAAPATPASAASSQPAPAAAKQ"
FT   sig_peptide     complement(330672..330788)
FT                   /locus_tag="Dtpsy_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.546 at
FT                   residue 39"
FT   gene            330960..331580
FT                   /locus_tag="Dtpsy_0319"
FT   CDS_pept        330960..331580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0319"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracycline
FT                   transcriptional repressor MAATS-type domain protein; KEGG:
FT                   ajs:Ajs_0324 TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31803"
FT                   /db_xref="GOA:B9MBB9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBB9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACM31803.1"
FT                   /translation="MARRTKEDADATRNSLLDAAERVFYEKGVSRASLSDIAQAAGATR
FT                   GAIYWHFKDKVALFNAMMDRVTHPLEQVGSKSASMATLPPLERLRSMVDFVQRTIVQDE
FT                   RTRRVFEIALYRVEYVNDLAAVRDNHIEGCADFCALIEGELRSAAEDQNLQLPMEPHTA
FT                   AMGVQALFDGLLQSWLLTHGRFDLVTVSRGAIDAYLRGLGFRL"
FT   gene            331635..331710
FT                   /locus_tag="Dtpsy_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            331635..331710
FT                   /locus_tag="Dtpsy_R0001"
FT                   /product="tRNA-Arg"
FT   gene            331879..332208
FT                   /locus_tag="Dtpsy_0320"
FT   CDS_pept        331879..332208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31804"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBC0"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0331"
FT                   /protein_id="ACM31804.1"
FT                   /translation="MANTNQGNQNQGNRNQSQGSRDNNQGQSGSGRGFASMDPDRQREI
FT                   AAEGGRAAHASGNAHEFTSQEARAAGAKSHGGGGNNASSGSGNTRGSSSEQQARAGSQS
FT                   HKNDR"
FT   gene            332421..332882
FT                   /locus_tag="Dtpsy_0321"
FT   CDS_pept        332421..332882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31805"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBC1"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0332"
FT                   /protein_id="ACM31805.1"
FT                   /translation="MTTSTPHPWGTNLQKAQTFQPDWDSYVVTKVKHVRAALLSGIDTF
FT                   SAEGFTVPMATGFIELTGMRAGSFRTFLKIGFSESNRVMLPTFQLVDNAAVGTLILPSP
FT                   CFGSALQFVNSPMAHFRIGGDGRRNALATDVTLLNSALIEAGEPEGMEI"
FT   gene            332946..334109
FT                   /locus_tag="Dtpsy_0322"
FT   CDS_pept        332946..334109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0322"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   nmu:Nmul_A2149 zinc-containing alcohol dehydrogenase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31806"
FT                   /db_xref="GOA:B9MBC2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBC2"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACM31806.1"
FT                   /translation="MKALTYQGAKDVRVENVPDPVLLAQDDVLLRVTATAICGSDLHIY
FT                   RGKIPGMKDGDILGHEFMGIVEEVGPAVTALRPGDRVVVPFVIACGSCFYCDKTLFAAC
FT                   ENTNPGRGAILNKKNATAGAGLFGYSHLYGGYPGGQAEYVRVPHGNVGPLKVPQVLSDE
FT                   QVLFLSDILPTGYQAAVNAQIGAGSSVAIFGAGPVGLMSALAARFLGAEQVFMVDHNEY
FT                   RLQFAQATYGVVPINFDKDEDPAETILSATGGHGVDATIDAVGFEAKGSALETALTAVR
FT                   LEGSSGKALRQCIAATRRGGVLSVPGVYAGFIHGFLFGDAFEKGLTFRMGQTHAQKYMP
FT                   QLLEHIANGRMRPEVIISHRMKLADAARGYEIFEKKEEECRKVVLTP"
FT   gene            complement(334242..334751)
FT                   /locus_tag="Dtpsy_0323"
FT   CDS_pept        complement(334242..334751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0323"
FT                   /product="putative outer membrane protein"
FT                   /note="KEGG: ajs:Ajs_0334 putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31807"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBC3"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0334"
FT                   /protein_id="ACM31807.1"
FT                   /translation="MPKICTARLVTAACGLVLAAAAHADASTKDREFLTQAATGGLYEV
FT                   QAGKLAQNRATANEVKSFGAMLVKDHTAANDELRALAARKGVALPTTLPGDKQKQLDQL
FT                   AKAQKFDQEFLSQVGLNDHRRDIALFEAAGKDADDPEIQTFALKALPKLKAHKDHAEDL
FT                   AVSIKR"
FT   sig_peptide     complement(334677..334751)
FT                   /locus_tag="Dtpsy_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 25"
FT   gene            complement(334878..335645)
FT                   /locus_tag="Dtpsy_0324"
FT   CDS_pept        complement(334878..335645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0324"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   ajs:Ajs_0335 glutamine amidotransferase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31808"
FT                   /db_xref="GOA:B9MBC4"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBC4"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ACM31808.1"
FT                   /translation="MCQLLGMNANTPTDVTFSFTGFAQRAGNTADHTDGWGIAFFEGRG
FT                   LRHFVDHERATDSPVAELIRRYPIKSRNVIAHIRKATQGVVSLENCHPFVRELWGRYWV
FT                   FAHNGDLKDFRPRLHAHFHPVGTTDSEHVFCWLMQELSKSHAGMPSIEELTLTLRELAA
FT                   RIAPHGTFNFLLSNGQALWAHASTHLYYIERRHPFSQAQLCDEDLRVDFSAHTTPHDKV
FT                   AVVVTAPLTSNEQWTAFQSGEMRVFVDGQCQAA"
FT   gene            complement(335679..335867)
FT                   /locus_tag="Dtpsy_0325"
FT   CDS_pept        complement(335679..335867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0325"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: ajs:Ajs_0336
FT                   4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31809"
FT                   /db_xref="GOA:B9MBC5"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBC5"
FT                   /inference="protein motif:TFAM:TIGR00013"
FT                   /protein_id="ACM31809.1"
FT                   /translation="MPTYHIEMMEGRTVEQKRKLVEEITRVSVEILGGSPESVDILITD
FT                   VKRENWATGGKLWLDRQ"
FT   gene            complement(335891..336127)
FT                   /locus_tag="Dtpsy_0326"
FT   CDS_pept        complement(335891..336127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31810"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBC6"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0337"
FT                   /protein_id="ACM31810.1"
FT                   /translation="MPTAAPTTTHCPLCGQSNGCAVAAGLPAQQCWCMHESVSRDALAR
FT                   LPAEARGRACICPLCAREEPAAPQAPAPVVPNP"
FT   gene            complement(336235..338436)
FT                   /locus_tag="Dtpsy_0327"
FT   CDS_pept        complement(336235..338436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0327"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: ajs:Ajs_0338 malate synthase G; TIGRFAM:
FT                   malate synthase G; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31811"
FT                   /db_xref="GOA:B9MBC7"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBC7"
FT                   /inference="protein motif:TFAM:TIGR01345"
FT                   /protein_id="ACM31811.1"
FT                   /translation="MTARTHVHGLQVANELHAFINEQVLPGTGVEPAAFWKGFDALVAD
FT                   LAPKNAALLAERDRLQKELDTWHKANPGPIQDMAGYRAFLSQIGYLVEPPKGAQATTTN
FT                   VDAELAIQAGPQLVVPILNARYALNAANARWGSLYDALYGTDVIGEEGGAEKGKGYNPV
FT                   RGAKVIAFARDFLDQAAPLASGSHKDATAYRVEGGTLAVTLQGGATTGLKNAAQFVGYQ
FT                   GNAAEPSSVLLVNNGLHIDIRVDRNTPIGKGDAAGVADVVVEAALSTILDLEDSVAAVD
FT                   AEDKVLGYSNWLGILKGTLTDTFDKGGKQVTRGLNPDREYNGADGKPVKLHGRSLMFVR
FT                   NVGHLMTNPAILWGAEGKEIPEGILDAMVTTAIAIHDLKGGAGGIRNSRTGSVYIVKPK
FT                   MHGPAEVAFANELFGRVEQVLGLPANTVKLGIMDEERRTSVNLKACIAAAPARVAFINT
FT                   GFLDRTGDEMHTAMQAGPMIRKGDMKSSAWIQAYERNNVLVGLSMGLSGRAQIGKGMWA
FT                   APDLMKAMLEQKIAHPKAGANTAWVPNPTGATLHTLHYHQVNVAAVQAELLKVDADAER
FT                   DNLLTGLLTVPVSSNPHWSETEKQQELDNNIQGILGYVVRWIDQGVGCSKVPDINDIGL
FT                   MEDRATLRISSQHVANWLLHGVVTEGQVRATFERMAAKVDQQNGGDPLYQRMHGRFAES
FT                   MAYQAACDLVFKGVEQPSGYTEPLLHAWRQKVKAAQKKA"
FT   gene            338663..339601
FT                   /locus_tag="Dtpsy_0328"
FT   CDS_pept        338663..339601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0328"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ajs:Ajs_0339 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31812"
FT                   /db_xref="GOA:B9MBC8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBC8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACM31812.1"
FT                   /translation="MDKLKAFESFVSVATRGSLTAAAKAEGVAPAIMGRRLDALEEHLG
FT                   VKLLVRTTRRITLTHEGSAFLEDCQRLLSDVANAEASVSAGGVKATGHLRVTAPAGFGR
FT                   RHVAPLVPRFHDLHPEVTLSLNLSDRVVDLAGEGYDCAVRVGDLPDSSLVSVRMADNRR
FT                   LCVATPQYLQRRGTPTHPGELAQHDCLTLSSDASQTRGWAFRVPVAGGGGATEVVHFKP
FT                   GGPLDCSDGQVLHDWCLGGWGIAWRSTWEVESEIAAGRLVAVLEEFAAPPNGIYVVFPQ
FT                   RKHLPLRVRLWIEYLKHHYAQPEFWARPASV"
FT   gene            339693..340277
FT                   /locus_tag="Dtpsy_0329"
FT   CDS_pept        339693..340277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31813"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBC9"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0340"
FT                   /protein_id="ACM31813.1"
FT                   /translation="MRIPILSVLPALPAARWMLAVMALALVAGCALPARHAETTPRAHG
FT                   VPAGMVSVTYADPAGFAEAREQTPHEPAAARRAWMDALCEHLAERVAAALPEGERAEVH
FT                   ITDVRRAGAFEPVARATAQAVRVVRDVHPPRIALEFKRLSPDGRTLAEGSRTLPGLAFQ
FT                   MRGDRYPGDKLRHEKTLIDDWVAQEFSARRP"
FT   sig_peptide     339693..339806
FT                   /locus_tag="Dtpsy_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.887 at
FT                   residue 38"
FT   gene            340317..340772
FT                   /locus_tag="Dtpsy_0330"
FT   CDS_pept        340317..340772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0330"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: ajs:Ajs_0341 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31814"
FT                   /db_xref="GOA:B9MBD0"
FT                   /db_xref="InterPro:IPR018706"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBD0"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0341"
FT                   /protein_id="ACM31814.1"
FT                   /translation="MTTEALLAYAHIMAFLMAATFLASETALCRKEWMNAAAVERLARV
FT                   DMLYGISALLVLATGLARTWWGIKGGAWYWSQPLLHAKVTLFVVIGLMSIVPTMRFLRW
FT                   RRAVRAGGALPSDDQVRSTRRLVMIEAHLLALIPLLAVFLARGVGTR"
FT   gene            complement(340873..341205)
FT                   /locus_tag="Dtpsy_0331"
FT   CDS_pept        complement(340873..341205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0331"
FT                   /product="PsiF repeat protein"
FT                   /note="PFAM: PsiF repeat protein; KEGG: ajs:Ajs_0342 PsiF
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31815"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBD1"
FT                   /inference="protein motif:PFAM:PF07769"
FT                   /protein_id="ACM31815.1"
FT                   /translation="MKKLLPLLAAAGFALSFAAHAADAPAAGASAPAKAPTAQQTRMKT
FT                   CNADAGAKNLKGDERKAFMKECLSGNKASTQQDKMKSCNADAGAKNLKGDARKAFMKEC
FT                   LSGAAS"
FT   sig_peptide     complement(341140..341205)
FT                   /locus_tag="Dtpsy_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            341331..343034
FT                   /locus_tag="Dtpsy_0332"
FT   CDS_pept        341331..343034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0332"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: ajs:Ajs_0343 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31816"
FT                   /db_xref="GOA:B9MBD2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBD2"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACM31816.1"
FT                   /translation="MLSVKQELLAALADELEKVSPGAGSRAAFESPKVAAHGDLACTAA
FT                   MQLAKPLKQNPRALGEQLQAALEATPAFQKWVQAIEIAGPGFLNIRLKPAAKQQVVREV
FT                   LAQGAQYGYQPARGEKVLVEFVSANPTGPLHVGHGRQAAIGDAISHLYATQGWSVHREF
FT                   YYNDAGVQIDTLTKSTQLRAKGFKPGDDCWPTDSENPLAKNFYNGDYIQDIADAFLAKA
FT                   TVQADDRAFTANGDVEDYENIRQFAVAYLRNEQDKDLQAFNLQFDQYYLESSLYANGHV
FT                   DATVQRLVANGKTYEQDGALWLKSTDYGDDKDRVMRKQDGTYTYFVPDVAYHIQKFQRG
FT                   FTKVVNIQGTDHHGTIARVRAGLQAADVGIPQGYPDYVLHTMVRVVRNGEEVKISKRAG
FT                   SYVTLRDLIEWTSKDAVRFFLLSRKPDTEYTFDVDLAVAQNNDNPVYYVQYAHARICSV
FT                   LRGWREDYDVAALRDVDLSPLEGPQAQALMLLLAKYPEMLTAAAAGNAPHDVTFYLRDL
FT                   AAAYHSYYDAERILVDDEAVKQARLALVAATAQVLHNGLAVLGVSAPARM"
FT   gene            343047..343673
FT                   /locus_tag="Dtpsy_0333"
FT   CDS_pept        343047..343673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0333"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: ajs:Ajs_0344
FT                   sporulation domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31817"
FT                   /db_xref="GOA:B9MBD3"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBD3"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ACM31817.1"
FT                   /translation="MKKQQRGGTIVGFILGVIVGLGAALAVAVYVTKVPVPFLNKSTPR
FT                   ASEQDEATKNKNWDPNAPLYGKNPVRPAAPAAAPASDTATAAAQPASGPRAAASRPGAA
FT                   PTSADPLGDLARAKANAAPAPTTSADPFEYFVQAGAFRTQQDADAQRAKLAMLGWEARV
FT                   SEREQNGRTVFRVRVGPFGKRDDAESLKEKLDGAGVESALVRVQR"
FT   sig_peptide     343047..343127
FT                   /locus_tag="Dtpsy_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.686 at
FT                   residue 27"
FT   gene            343732..344382
FT                   /locus_tag="Dtpsy_0334"
FT   CDS_pept        343732..344382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0334"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: ajs:Ajs_0345 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31818"
FT                   /db_xref="GOA:B9MBD4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBD4"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ACM31818.1"
FT                   /translation="MKRREFSLTVASAATALSLPLAAPALAQGRQFKEGKDYVKLGKPV
FT                   ATEAPAGKIEVIEFFWYSCPHCNTFEPSLEAWIKSAPKDLHIRRVPVAFNASFVPQQKL
FT                   YYALEGMGKLPELHAKVFRAVHVERLPLNKDELIFDWIGKQGVDVAKFKEVYNSFTVSN
FT                   QVRKASQLQDGYQVEGVPSMGVAGRYYTDGTMAGNMQSVLQVVEHLVGVARKG"
FT   sig_peptide     343732..343815
FT                   /locus_tag="Dtpsy_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            344532..345215
FT                   /locus_tag="Dtpsy_0335"
FT   CDS_pept        344532..345215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0335"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="TIGRFAM: lipopolysaccharide transport periplasmic
FT                   protein LptA; PFAM: OstA family protein; KEGG: ajs:Ajs_0346
FT                   OstA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31819"
FT                   /db_xref="GOA:B9MBD5"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBD5"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ACM31819.1"
FT                   /translation="MIARFVPSMRTRLPFLLLSRAAALALALAASPLVHAEKADRNKPM
FT                   NIEADALRHDELKQTSVFTGRVVMTKGTIVLRGAQLEVRQDADGFQYGVVTAEPGKRAF
FT                   FRQKRDTAPGAPDEFVEGEGEVIEYDGRADVVKLIRRAELRRYREATLTDELAGALIVY
FT                   NNLTDVFTVDGQKTAPAGATAGTPGGRVRAVLAPKEPASGTSATPPVRTEPPALRTSPS
FT                   LDGAK"
FT   sig_peptide     344532..344642
FT                   /locus_tag="Dtpsy_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 37"
FT   gene            345239..345991
FT                   /locus_tag="Dtpsy_0336"
FT   CDS_pept        345239..345991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0336"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ajs:Ajs_0347 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31820"
FT                   /db_xref="GOA:B9MBD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBD6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACM31820.1"
FT                   /translation="MSEGVSRLEALHLEKSYGSRKVVKDVSVVVQKGEVVGLLGPNGAG
FT                   KTTSFYMIVGLVRSDGGRISIDGQDVTDMPIHRRSRLGLSYLPQEASIFRKLNVEDNVR
FT                   AVLELQTDEAGRSLPRAEVERRLTALLQELRVDHLRKSPALALSGGERRRVEIARALAT
FT                   QPRFILLDEPFAGIDPIAVIEIQRIIGFLKARGIGVLITDHNVRETLGICDHAFIISDG
FT                   QVLAQGTPSDIVDNAEVRRVYLGEHFRM"
FT   gene            346044..347621
FT                   /locus_tag="Dtpsy_0337"
FT   CDS_pept        346044..347621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0337"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: ajs:Ajs_0348 RNA
FT                   polymerase, sigma 54 subunit, RpoN"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31821"
FT                   /db_xref="GOA:B9MBD7"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBD7"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ACM31821.1"
FT                   /translation="MKPGLSLRVSQHLALTPQLQQSIRLLQLSTLELAQEVEQMLDENP
FT                   FLERTLEEAPREEFGLAQADAPVSEQDREAEDAIYSGAVSAGQESATSQNDAETSSAES
FT                   TAEPADWEGDGSVDLAPDDSEWGGDAPARNGAGAGSDDEVDATELARSQESLTAFLHRQ
FT                   ALALRLSELDMAALRFLIESLNDDGYLDESLQDLAASLAGTEDPEQLDELVHRFTVALR
FT                   LLQSLEPAGVGARGLAECLTLQLRAMDQDEEGDPDVIQAALAICGQPLDLLAKRDVRRL
FT                   AQACGTSEERTRAAMALIARLEPRPGRRFADVDRNIIVPDVIVKKTGRGGQQNFSVQLN
FT                   PDVMPRLRVHDIYAGALRGGRGEGHQALQARLQEARWFIKNIQQRFDTILRVSRAIVER
FT                   QKNFFVHGELAMRPLVLRDIADELGLHESTISRVTTAKYMATPQGTYELKYFFGSGLGT
FT                   ETGGNASSTAVRALIKQFIAAENPHKPLSDSQIAEMLKEQGIECARRTVAKYREALKIA
FT                   PANLRKAL"
FT   gene            347625..348068
FT                   /locus_tag="Dtpsy_0338"
FT   CDS_pept        347625..348068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31822"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBD8"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0349"
FT                   /protein_id="ACM31822.1"
FT                   /translation="MARVVFDLPPHFGFSTELQIYISHVNQGGHLDNAQLLSLVSEARV
FT                   RFFKSLGYPEADVAGLSTVVGDIVAQYKSEAFHGETLRVEMTPQDFNRYGFDLVFRLTE
FT                   KSQGREIARGKTGIVFIDRAARKPAPIPESVLQPLLQRAAQPQ"
FT   gene            348065..349378
FT                   /locus_tag="Dtpsy_0339"
FT   CDS_pept        348065..349378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0339"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: ajs:Ajs_0350 putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31823"
FT                   /db_xref="GOA:B9MBD9"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBD9"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ACM31823.1"
FT                   /translation="MNQLQLFLPCAAGVEGYLADEVHSLTGLAGQDLLVGRAGVLLRAS
FT                   WRDALRLNLHSRLAQRVLVQLAERPYRNEDDIYAAAADVAWEIWFTPRQSFKVEVTAQH
FT                   SPLKSLNFAALRVKDAVADRFRAKAGVRPDVQTQWPDVRVHLHLTSDRAQIYIDTSGEP
FT                   LFKRGWREDKGDAPLKETLAAAMIAATGWDPHGEQPLPLYDPCCGSGTVVIEAAQIACR
FT                   IAPGLQRRFAFEKLLPHQAHVWSAIKDEAASAVTAASVPIFGSDVSHRMVDFAQRNAVR
FT                   AGVADAVQLRGGDALQRMPPSEQPGVMLLNPPYGERIAAAGTAGRNARERMSTVERMGR
FT                   ETAQTEDGVDFFAQLAAHWKKHYAGWQAWMLTPDLKLPSKMRLKESRRVPLWNGPIECR
FT                   LFRFDLVAGAVRDRPRASHTGEGGAASGAPAGGASDAS"
FT   gene            349368..349853
FT                   /locus_tag="Dtpsy_0340"
FT   CDS_pept        349368..349853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31824"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBE0"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0351"
FT                   /protein_id="ACM31824.1"
FT                   /translation="MRPELRLPAVAPAGESARVVVLDTNIVLDLFIFADAAVAAVRALL
FT                   QAQRLDWIATQHMRDELERVLQYTHLQPRMAYYGVGADDVLTAFDAGVRLVEVAPRAPW
FT                   ACKDADDQKFIDLAVAHRAIIVSKDKAVLCMRKRLLTQDTHAVAAIVFEEVCEPCPT"
FT   gene            349841..351142
FT                   /locus_tag="Dtpsy_0341"
FT   CDS_pept        349841..351142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0341"
FT                   /product="EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase)"
FT                   /note="PFAM: EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase); KEGG: ajs:Ajs_0352
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31825"
FT                   /db_xref="GOA:B9MBE1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBE1"
FT                   /inference="protein motif:PFAM:PF00275"
FT                   /protein_id="ACM31825.1"
FT                   /translation="MSNLIVHGGTPLRGRVTPSANKNAVLPVLCATLLTRAPLRLVGVP
FT                   DITDVRKILEIFRTLGSEVRWDHASATLELHHQATHFDAATHRLPEEMRSSIMLVPPLL
FT                   ARFGVARLEDNVKGCTLGVREIDPHVEVFRSFGGQVERAEGSLLVRRVGMLTPVHHWLD
FT                   YASVTTTENFVLCAVAAQGTSTLTNAASEPHVQEFCRFMQMLGAQIEGVGTSRLTVHGG
FT                   GDLGGGEFRFAEDFHEITTFLALGAITGGDVVVKNSAPENFPLIDRTFAKFGVRVEHRD
FT                   GWSRAFVDGPLTVQTPFTPNVLTKVEAAPWPYFPVDLLPIFIALGVRAQGNAMFWNKVY
FT                   DGALGWTGELSKFGAHVYQSDPHRIVTFGGGPLAPAVVESPYIIRVAIALFMVAASIPG
FT                   RSEIRNATPIRRAHPHFVENLRSLGARVEWTAEE"
FT   gene            351624..352454
FT                   /locus_tag="Dtpsy_0342"
FT   CDS_pept        351624..352454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0342"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG: ajs:Ajs_0353
FT                   SecC motif-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31826"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBE2"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACM31826.1"
FT                   /translation="MNATSDTPASAAAPALGPDELDELDSLLDDLRTREEDVPQWEFCD
FT                   GFLTALVCTRRPVPAAEWLPMLLGDGLELDVAEGEPLPLVPTFKDLAQQERFLALWELR
FT                   RAEVQAQLDEQAESLDADNAFQPEVIDMRGAIASLPEEERAEMAGQEIPSFGQVWALGF
FT                   MFAVENWPEDWATPRDKEAAQWLDGALESIVALTEDDTGKPEICMYAEDGPPSTSQERL
FT                   EVFGEAIWGVYDLRQLWRSLGPRQETIVKGEQPGRNDPCPCGSGKKYKKCCGAA"
FT   gene            complement(352641..353210)
FT                   /locus_tag="Dtpsy_0343"
FT   CDS_pept        complement(352641..353210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0343"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: ajs:Ajs_0354 CinA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31827"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBE3"
FT                   /inference="protein motif:PFAM:PF02464"
FT                   /protein_id="ACM31827.1"
FT                   /translation="MELSKIELPALDGQALEADLIHISTALLARGWMLATAESCTGGLI
FT                   AAACTDLSGSSQWFERGFVSYSNAAKTALLGVPADLITAHGAVSEPVARAMAEGAVRHS
FT                   AAQVSVAVTGVAGPHGRQPGQAGGHGVVRLVRGGRHPFGAAALCRRPRRRARRHGAPRA
FT                   GTAGAVAGPGARPFALLTVPLGLAAP"
FT   gene            complement(353216..353746)
FT                   /locus_tag="Dtpsy_0344"
FT   CDS_pept        complement(353216..353746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0344"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   ajs:Ajs_0355 phosphatidylglycerophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31828"
FT                   /db_xref="GOA:B9MBQ8"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBQ8"
FT                   /inference="protein motif:PFAM:PF04608"
FT                   /protein_id="ACM31828.1"
FT                   /translation="MPDTPPPTPLPPHALRRFLFVHPAHCIALGFGSGLSRVAPGTVGT
FT                   LWGWLAFLVLQLWLTPRGMGLLIALSLLLGWWACTVTARHMRVADPGHIVWDEIVAIWI
FT                   VLWLAMPMGFWGQLAAFALFRYFDAAKPGPVAWADRLFKGFGWRGGLGIMLDDLVAAFC
FT                   TLLVIALWRHWFG"
FT   gene            complement(353810..354784)
FT                   /locus_tag="Dtpsy_0345"
FT   CDS_pept        complement(353810..354784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0345"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="KEGG: ajs:Ajs_0356 thiamine-monophosphate kinase;
FT                   TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR synthase
FT                   related protein; AIR synthase related protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31829"
FT                   /db_xref="GOA:B9MBQ9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBQ9"
FT                   /inference="protein motif:TFAM:TIGR01379"
FT                   /protein_id="ACM31829.1"
FT                   /translation="MGEFDLIARYFTRPVRRAALGVGDDCALLSVTPGMQLAVSSDMLV
FT                   EGRHFFADVDPAHLGHKALAVNLSDLAACGARPLAFTLALALPRVDAPWLQAFADGLLR
FT                   LADAHQCELVGGDTTQGPLNLCVTVFGEVPTGQALLRSGARVGDDIYVSGTPGEARLAL
FT                   DALRGRLALPPAALQQLRPRLEQPTPRVALGLALRGVASSAIDVSDGLLGDLGHILKAS
FT                   GVGACVDATVATNLLAASAQQAVATADFGAQTLMQCALAGGDDYELVFTAPPAQQAAVQ
FT                   AAAQASGTRATRIGRVEPAPGLRVVDGQGQPVAQHFASFDHFA"
FT   gene            complement(354800..355924)
FT                   /locus_tag="Dtpsy_0346"
FT   CDS_pept        complement(354800..355924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0346"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   ajs:Ajs_0357 carboxylate-amine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31830"
FT                   /db_xref="GOA:B9MBR0"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBR0"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ACM31830.1"
FT                   /translation="MSLEAFHHSEPLTLGVELELQLVSTNDYDLAPYAEDMLRLMKKVP
FT                   LPGSVVPEMTNSMIEISTGVCHSSSEVLGQLTQIRDALVKSADKLNIAVVGGGTHPFQQ
FT                   WHERRIYDKPRFQELSQLYGYLSKQFTIFGQHVHIGCPDADSALLMLHRMSRYIPHFIA
FT                   LSASSPYVQAQDTQFDSARLNSVFAFPLSGRAPCVLTWSEFEQYFNKMTRTGVVKSMKD
FT                   FYWDIRPKPEYGTIEIRVFDTPLTIERAAALAGYVQSLAAWFLAEQPFTPTEDDYLVYT
FT                   YNRFQACRFGLDAVYVDPASGDHMPLRDHILQTLDHVARYAGTHGASGALHMLRGETAL
FT                   GQNDARWLRERQREEQLLAEVSRQAALRFRGHDI"
FT   gene            complement(355914..357179)
FT                   /locus_tag="Dtpsy_0347"
FT   CDS_pept        complement(355914..357179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0347"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: ajs:Ajs_0358
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31831"
FT                   /db_xref="GOA:B9MBR1"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBR1"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACM31831.1"
FT                   /translation="MNELMSFWAQWLRPSAGLPTVQWSLLLAVASITGYLVQRYSGLPK
FT                   VVGYTLVGTIVGLLGFGGAVWPLQGIGLFLVELGVAVVLFEAGGRIPLRWFRHNPMVLV
FT                   QSIAESAFTYFAVYWTMLWFDVPERAAGPLALVAMAASPAVLTRVVSDTRAAGPVTDRA
FT                   VVLATLSSLYALALGSAQAELINRPGVGLVGTLYPALVVLGVSVAVGALLSLILRLALR
FT                   VMSPTSENTSMLLMALIAASTAVTAHMGGSAPLAALLGGMLLKQLHPRPWAWPRQMGTA
FT                   SSLLTMLMFVLVSTVAAQADWSGPVVGAVLALIFVRLLAKALGVGVGNVGSGASWRQAM
FT                   WLSCAMAPMSAIALLVASQFVVASASTGHLIARIALPAILVMEVLGAVIATVAIYRAGE
FT                   SSKPWAPLSSRGSNTGDTQRES"
FT   gene            complement(357361..359343)
FT                   /locus_tag="Dtpsy_0348"
FT   CDS_pept        complement(357361..359343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0348"
FT                   /product="putative site-specific recombinase transmembrane
FT                   protein"
FT                   /note="KEGG: ajs:Ajs_0359 putative site-specific
FT                   recombinase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31832"
FT                   /db_xref="GOA:B9MBR2"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBR2"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0359"
FT                   /protein_id="ACM31832.1"
FT                   /translation="MSRSGPDLAQLLAGIDPTAPLAQRHLQLIAVLDWVRGDGQSTEGA
FT                   AGRVALLVDAAERSPDIQVRLQAWWAALTQQVDITTLLADFGFAQRTSMASELAERVRY
FT                   KLLPSSPETLDASELFMLALPGDFDARWLASLDETLLGRLLAVLVPACEQGGASHWQRA
FT                   LLDAITYCAGQILSTGFAPELRLRMSEEAREAQPFHALIRDVESLRVEVEHPLRTGDRL
FT                   QEAVQRLRERLDACRAATNTVYAHFEDNGISVGLVFRLRQLRERILRVRELLECLLSPR
FT                   PAVAAAKFLARLVTVGRERRSLRALVASNSSMLAAKVAERSAETGAHYITRTAGEYLAM
FT                   VRKAAGGGLVMAFTTLAKFGLYALALSAFWGGFMAGVNYAVSFVLIQLLHFTVATKQPA
FT                   MTAPAMAAKLKDLDEAQGLESFVDEVAHLVRSQVAAVLGNVLLVFPGALALALLIAQML
FT                   GQPAIGTAQAEHVLQSLHLLGPSLLFAAFTGVLLFASSIFAGWVENWFVLRRLDSAIQY
FT                   NPRITDMLGAARAARWARFLRGNISGFAANISLGFMLGLTPAFAAFFGLGLDVRHVTLS
FT                   TGQIGVASATLGMDVLHQPAFWWAVAMVPFNGALNVLVSFYLAFRLALRAHNVGSVDRA
FT                   RIYRALLARWRSAPLGFFLPRRRTV"
FT   gene            complement(359340..359747)
FT                   /locus_tag="Dtpsy_0349"
FT   CDS_pept        complement(359340..359747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0349"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: ajs:Ajs_0360 ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31833"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBR3"
FT                   /inference="protein motif:PFAM:PF04379"
FT                   /protein_id="ACM31833.1"
FT                   /translation="MPKYQFQVEVQPQYLPDESAPDEGVYSFAYTITITNTGDVTAQLI
FT                   SRHWIISDANGHTEQVKGLGVVGQQPLLKPGEAFQYTSGCRLRTASGSMHGSYFCVAED
FT                   GEPFTCPIELFVLEAFSPGQPGQPMAARVLH"
FT   gene            359869..360549
FT                   /locus_tag="Dtpsy_0350"
FT   CDS_pept        359869..360549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0350"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="KEGG: ajs:Ajs_0361 ribulose-5-phosphate 3-epimerase;
FT                   TIGRFAM: ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31834"
FT                   /db_xref="GOA:B9MBR4"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBR4"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ACM31834.1"
FT                   /translation="MSRTYRIAPSILSADFARLGEEVRNVIAAGADWIHFDVMDNHYVP
FT                   NLTFGPMVCQALKPHAVTPAGHAVPIDVHLMVQPVDELATAFAKAGADLISFHPDASAH
FT                   VHRSIQNIRAQGCKAGLTFNPAMPLDVLDWVIEDIDLILLMSVNPGFGGQSFIDSTLRK
FT                   IEAARRRIEASGKDIRLEVDGGIKADNIRRVADAGADTFVAGSAIFGKSDYKAVIDAMR
FT                   AELA"
FT   gene            complement(360589..360954)
FT                   /locus_tag="Dtpsy_0351"
FT   CDS_pept        complement(360589..360954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31835"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBR5"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0362"
FT                   /protein_id="ACM31835.1"
FT                   /translation="MALHRFTALLPAALLLCAGAAQAANEVRSQYSSDRAACASVPAES
FT                   RAACVREAGAAAQAARAGQLSSSDTSIYERNALARCEAFKTPHDRSDCEARVRSSATVS
FT                   GSVEGGGVLREATTPVQ"
FT   sig_peptide     complement(360883..360954)
FT                   /locus_tag="Dtpsy_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            361121..361846
FT                   /locus_tag="Dtpsy_0352"
FT   CDS_pept        361121..361846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0352"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   ajs:Ajs_0363 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31836"
FT                   /db_xref="GOA:B9MBR6"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBR6"
FT                   /inference="protein motif:TFAM:TIGR01449"
FT                   /protein_id="ACM31836.1"
FT                   /translation="MERVQQDLAALLARTDAAIVDLDGTMVDTLGDFAEALNRMLRDLQ
FT                   LPAIAPAAIERMVGKGSEHLLRSVLKHVLAPDQQALTAMQLEAKAEALYPQAWERYQHH
FT                   YLAINGQYAALYAGVAEGLAALHRTGRPLVCLTNKPTDFARPLLRAKGLDGFFTHVFGG
FT                   DAFARKKPDPLPLLKACEAVGTSPARTLMIGDSSNDAQAARAAGCPVVLVTYGYNHGQP
FT                   VRGVDADGYVDALTELIAS"
FT   gene            complement(361898..363592)
FT                   /locus_tag="Dtpsy_0353"
FT   CDS_pept        complement(361898..363592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0353"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; Cache type 2 domain protein;
FT                   SMART: chemotaxis sensory transducer; KEGG: aav:Aave_2643
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31837"
FT                   /db_xref="GOA:B9MBR7"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBR7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACM31837.1"
FT                   /translation="MQMFYRLPVSRRLGGLVALAILAMLALVASIMWTERSLIMGERQA
FT                   SVRQTVEAAHGIVVHFHAQASKGTITEEEAKQRAMDALRPLRYSGSEYFWINDMHPRMV
FT                   MHPIRPELQGQDLSSNKDPTGKHLFVEFVNTVKRSGAGFVSYLWPKPGSDQPVEKASYV
FT                   MGFEPWGWVIGSGVYVDNVQATFVSRLARSGAVTAVLALLLLAIGWLVARSILRQLGAE
FT                   PSQLNAITHEMAQGNLAVEIPPARDSDSVIHGIQTMRDNVAEIVQGVRRSSEHVATASA
FT                   EISQGNHDLSGRTESQASALEETAASMEQLGATVRQNADNARQANQLAMNASTVAVQGG
FT                   EVVSEVVDTMRGINESSRKIADIIGVIDGIAFQTNILALNAAVEAAKEIKQLITASVER
FT                   VEQGSQLVDKAGATMTEVVTAIRRVTDIMGEISAASSEQSSGVAQVGEAITQMDQATQQ
FT                   NAALVEEMAAAASSLSGQARELVEAVAVFKLAQKVSALPRMAPVHAPAVPAPVPATSAT
FT                   PAAPARPATPPASTRAPAAALARPAAARPQPAQAARTAADNDEWESF"
FT   sig_peptide     complement(363503..363592)
FT                   /locus_tag="Dtpsy_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.698 at
FT                   residue 30"
FT   gene            complement(363628..365364)
FT                   /locus_tag="Dtpsy_0354"
FT   CDS_pept        complement(363628..365364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0354"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; SMART: histidine kinase HAMP
FT                   region domain protein; chemotaxis sensory transducer; KEGG:
FT                   ajs:Ajs_0364 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31838"
FT                   /db_xref="GOA:B9MBR8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBR8"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACM31838.1"
FT                   /translation="MHLSNLKVGTRLALSFGLVLLITVVIAAVGIWRLQELASVTHQLT
FT                   STDNERLRAASTWRQAIDLNWVRTRAAILDADTSHLSSWQSEIAKTSEEASKAQEVVER
FT                   LVTTDEGRRLLADIAKTREAYRGPRAELLKRKAAGESVGELLDSQLKPLADAYLQSIVA
FT                   MEQRQRALYESTRDNAAKQATLSRAILMVVTAVALLVGAGAAILLSRSVTGPLQLAVRG
FT                   AGLIAEGDLTQSIQAHGRDEAAALLKALGHMQGNLARVVAGVRANAESVASASAEISQG
FT                   NHDLSGRTESQASALEETAASMEQLGATVRQNADNARQANQLAMNASTVAVQGGEVVSE
FT                   VVDTMRGINESSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRA
FT                   LAQRSAEAAKEIKQLITASVERVEQGSQLVDKAGATMTEVVTAIRRVTDIMGEISAASS
FT                   EQSAGVAQVGEAITQMDQATQQNAALVEEMAAAASSLSGQARELVEAVAVFKLASHGHA
FT                   LATPAAIRTPQPSAPAVTRAAPPARPASAPVQPAARQARPVSASPKAAPAPSADDGAWE
FT                   SF"
FT   sig_peptide     complement(365281..365364)
FT                   /locus_tag="Dtpsy_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.958 at
FT                   residue 28"
FT   gene            complement(365486..366088)
FT                   /locus_tag="Dtpsy_0355"
FT   CDS_pept        complement(365486..366088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0355"
FT                   /product="putative lipoprotein transmembrane"
FT                   /note="KEGG: ajs:Ajs_0365 putative lipoprotein
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31839"
FT                   /db_xref="GOA:B9MBR9"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBR9"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0365"
FT                   /protein_id="ACM31839.1"
FT                   /translation="MPFTRRRTLQWGALALPLCLALPAPASTEPTTAAGVKFEPTLDLG
FT                   GSKLQLNGAGVRYKAVFKVYAAGLYLEKKASTPAEVYALRGPKRISVTMLRDIDSTELG
FT                   KLFSRGMEDNMDKAAFSKLIPGVLRMSQIFSEHKKLMAGEQFVVDWLPGTGTQVTVKGV
FT                   PQGEPFKEPEFFNALLGIWLGSQPADWKLKDALLGKE"
FT   sig_peptide     complement(366002..366088)
FT                   /locus_tag="Dtpsy_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 29"
FT   gene            366445..367944
FT                   /locus_tag="Dtpsy_0356"
FT   CDS_pept        366445..367944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0356"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: ajs:Ajs_0366 anthranilate synthase component
FT                   I; TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I domain protein;
FT                   Chorismate binding-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31840"
FT                   /db_xref="GOA:B9MBS0"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBS0"
FT                   /inference="protein motif:TFAM:TIGR00564"
FT                   /protein_id="ACM31840.1"
FT                   /translation="MITELEFKSLASEGYNRIPLMAEAFADLETPLSLYLKLAHGKGDG
FT                   KHSFLLESVVGGERFGRYSFIGLPARTLLRSSGFGDAARTEVVTDGQVVETHPGNPLDF
FT                   IAAYQKRFKVALRPGLPRFCGGLAGYFGYDAVRYIEKKLEATCPPDTLGCPDILLLQCE
FT                   ELAVIDNLSGKLYLIVYADPAQPEAYAKGKKRLRELKDQLKYSVSAPVVRPTESHTAQR
FT                   SFAKADYLAAVERAKELIAAGDFMQVQVGQRIHKRYTESPLSLYRALRSLNPSPYMYYY
FT                   NFGDFQVVGSSPEILVRQESTPEGQKVTIRPLAGTRPRGATPEADKATEVELVNDPKER
FT                   AEHVMLIDLARNDIGRIAKTGTVKVTEAFAVERYSHVMHIVSNVEGILNDGMTSMDVLK
FT                   ATFPAGTLTGAPKVHAMELIDQLEPSKRGLYGGACGYLSYAGDMDVAIAIRTGIVKDGT
FT                   LYVQAAAGVVADSVPELEWKETEHKARALLRAAELVEEGLE"
FT   gene            367941..368285
FT                   /locus_tag="Dtpsy_0357"
FT   CDS_pept        367941..368285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0357"
FT                   /product="Chorismate mutase"
FT                   /note="PFAM: Chorismate mutase; KEGG: ajs:Ajs_0367
FT                   chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31841"
FT                   /db_xref="GOA:B9MBS1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBS1"
FT                   /inference="protein motif:PFAM:PF01817"
FT                   /protein_id="ACM31841.1"
FT                   /translation="MTTRAIDKTQPCASMAEVRARIDALDDILVPLLVERGGYMTQAAL
FT                   NKPREDQVRDEARIEAIVQRVRARAAAEGGEPDVIEAIYRSMMEAYIAYEHREFARLCA
FT                   EGRKGQEVTP"
FT   gene            368282..368854
FT                   /locus_tag="Dtpsy_0358"
FT   CDS_pept        368282..368854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0358"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   ajs:Ajs_0368 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31842"
FT                   /db_xref="GOA:B9MBS2"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBS2"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACM31842.1"
FT                   /translation="MTRVLMVDNYDSFTYNIVQYFGELGAEVEVFRNDEITLEGIAARA
FT                   PDRLVISPGPCSPAEAGISVAAIQHFAGKLPILGVCLGHQSIGAAFGGKIIRAQQLMHG
FT                   KTSVITTTQTGVFAGLPKQFTVNRYHSLSIERASCPEVLEVTAWTDDGEIMGIRHRELA
FT                   IEGVQFHPESILTEHGHAMLKNFLDQK"
FT   gene            368952..369986
FT                   /locus_tag="Dtpsy_0359"
FT   CDS_pept        368952..369986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0359"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: ajs:Ajs_0369 anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase
FT                   family 3; Glycosyl transferase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31843"
FT                   /db_xref="GOA:B9MBS3"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBS3"
FT                   /inference="protein motif:TFAM:TIGR01245"
FT                   /protein_id="ACM31843.1"
FT                   /translation="MTPITPQEALQRTIEHREIFHDEMLHLMRMIMSGELSPVMTAAIT
FT                   TGLRVKKETIGEITAAAQVMREFSHKVQVHDTKHLVDIVGTGGDGANTFNISTCATFVI
FT                   AAAGAKVSKHGGRSVSSKSGSADAMEALGVHINLQPAQIAQCIGDVGIGFMFAPNHHPA
FT                   MKNVAPVRKELGVRTIFNILGPLTNPAGAPNILMGVFHEDLVGIQVRALQRLGAEHALV
FT                   VYGRDGLDEISLGAGTLVGELKDGAVREYEIHPEDFGLRMAGTRALRVENPTESKAMLM
FT                   GVLQGDEGPARDIVCLNAGAALYAANVADSLEDGLRRAQQALASGAALAKLQQLVAYTQ
FT                   KLAA"
FT   gene            369997..370170
FT                   /locus_tag="Dtpsy_0360"
FT   CDS_pept        369997..370170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31844"
FT                   /db_xref="GOA:B9MBS4"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBS4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACM31844.1"
FT                   /translation="MSLLDAPIWNDPATWIVLGVSLLFIVVGIVMHRIIMKVVRGPAPP
FT                   TQGHKGPVPPHE"
FT   gene            370241..371041
FT                   /locus_tag="Dtpsy_0361"
FT   CDS_pept        370241..371041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0361"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   ajs:Ajs_0370 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31845"
FT                   /db_xref="GOA:B9MBS5"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBS5"
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /protein_id="ACM31845.1"
FT                   /translation="MSDILKKICDVKVEEVAAAQKRVSFTDMRRDAESRVLTRDFVGAL
FT                   RAKIDQGQAGVIAEIKKASPSKGVIREDFIPADIAQSYAEGDGKVSAACLSVLTDRQFF
FT                   QGQPDYLKQARASCPLPVLRKDFMIDPYQIYESRAMGADCVLLIAACLEDGLMAEMEQF
FT                   ARSLDMAVLVEVHDGAELERALRLQTPLVGINNRNLRTFEVSLQTTLDLKKEVPADRLL
FT                   VAESGILAPVDVHTLRDAGVNAFLVGEAFMRAPDPGRALAQLFA"
FT   gene            371180..373852
FT                   /locus_tag="Dtpsy_0362"
FT   CDS_pept        371180..373852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0362"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: ajs:Ajs_0371 diguanylate cyclase with PAS/PAC
FT                   sensor; TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; PAS fold-3 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; GGDEF domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31846"
FT                   /db_xref="GOA:B9MBS6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBS6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACM31846.1"
FT                   /translation="MRERPDTQAERFRREWWLLAGLWLALGALIAVVLSLERRDTEERE
FT                   RQQVAHQVHIVHENLERQLHAVNQALGDIVANLAQWRARPEGALPFNERLRAFSDAMTG
FT                   VRTLTVLDAEGTVVASSRAELLGENFAYRDYFQSARRLASREQPSLIVSAPMRTVLGIW
FT                   AITLSRPVPAEDGLPGGVVTATLDPDEFKTLLDSVRYAPDVESTLVHGDGVRFLRVPER
FT                   AGLLGATLAQPGTLFQAHLDSGRMESLFVGAMEPDPAERLVALRTIFPAHLHMDKPLVA
FT                   AVARDWSQVFAAWRARAWTLGVAWLLTGVAIGLGLGFMQRRRRQLWRREQALAAQEAAL
FT                   QARWQAVLHATQQGVWDWDMAAGTVYFSPVWKTMLGYAEGDIGDSLQEWESRVHPDDLA
FT                   RVHADVARHLAGETVVYENVHRMRCKDGSYKWVQDRGQVTSRDASGRPTRLIGTHTDVT
FT                   AQRQHQETLDRLAENVPGALYQYQREPDGRSHFPYASPGVQDIYGLPPQALCVDAEQVF
FT                   ARIHPDDLQALRESVLASAQTLELWRTEYRVLVPGERERWVSDQARPARTASGAVLWHG
FT                   YIHDVTLAKQQALQLQETERLLRHLMQEMPIGLCMIDAAGVIYFRNRRFMDLFGYTEAE
FT                   VPTLGQWWPRAYPDPHYREQVIAAWNADLAQAGAQGGEIADREYRVTDRDGRLHTMTIG
FT                   GLAFGDHCMATFVDVTEQRAQHELLRKLAFMDGLTGLANRRQLDRTLKAEWRRCRRSGQ
FT                   PLSVVMVDIDHFKQFNDLYGHQQGDDCLRAVAAALRGGLGRSHDLVARYGGEEFVCLLP
FT                   ECDLDGARAKAQALCRAVHARQMEHRGSPIAPVVTVSAGVACVVPGAEDTPEQLLARAD
FT                   ANLYRAKAAGRNRVHDGMD"
FT   gene            373907..374620
FT                   /locus_tag="Dtpsy_0363"
FT   CDS_pept        373907..374620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0363"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="TIGRFAM: uracil-DNA glycosylase; PFAM: Uracil-DNA
FT                   glycosylase superfamily; KEGG: ajs:Ajs_0372 uracil-DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31847"
FT                   /db_xref="GOA:B9MBS7"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBS7"
FT                   /inference="protein motif:TFAM:TIGR00628"
FT                   /protein_id="ACM31847.1"
FT                   /translation="MLNTPAATQLQSADPADWPVAPGWQPLVDTFFASARGRQLLAFLQ
FT                   ARLEAGAAIFPPQPLRALQLTAPEDTRVVILGQDPYHGRGQAEGLAFSVAPGVRLPPSL
FT                   QNIFKEMQRDMGVPFPPFPNPGGSLVKWAQNGVLLLNTCLTVEEGQAASHAGKGWEQLT
FT                   DAVIREVAEGPRPVVFMLWGSHAQSKRAFIPRDRGHLVLTSNHPSPLSALRPPVPFIGN
FT                   GHFGQARAFRQQHGY"
FT   gene            complement(374621..375508)
FT                   /locus_tag="Dtpsy_0364"
FT   CDS_pept        complement(374621..375508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0364"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ajs:Ajs_0373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31848"
FT                   /db_xref="GOA:B9MBS8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBS8"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACM31848.1"
FT                   /translation="MSAGPAGHSPRTALAGIALTVGACASFALLDTATKLVSATTPLLL
FT                   ALWLRYVFQSLVTSAYVLPRSDWRPPRTDHPRYQLLRAVLFAATSLFGIFSIRAMPLAE
FT                   FTAIVAATPLCVTLVAALWLRQPVSALRWLLVATGLASVLLILRPGGQSFSGVLVLPLG
FT                   MLACGTGYQILSSRMAGQEAPTTTQFYTSWIAAGLMTLAAPFVWTAITSAWVWLGLVVM
FT                   GLSSALGHLLLLRAYACAAPATIAPFLYTQIAFAMLAGWAVYGHMPDRWSLLGICLIAA
FT                   SGAASAWLTVRERR"
FT   sig_peptide     complement(375416..375508)
FT                   /locus_tag="Dtpsy_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.597 at
FT                   residue 31"
FT   gene            complement(375505..376605)
FT                   /locus_tag="Dtpsy_0365"
FT   CDS_pept        complement(375505..376605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0365"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-isomerase"
FT                   /note="TIGRFAM:
FT                   S-adenosylmethionine/tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; KEGG: ajs:Ajs_0374
FT                   S-adenosylmethionine--tRNA-ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31849"
FT                   /db_xref="GOA:B9MBS9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBS9"
FT                   /inference="protein motif:TFAM:TIGR00113"
FT                   /protein_id="ACM31849.1"
FT                   /translation="MSSASTAPRTFTLSDFDFELPELLIAQHPAPQRSGSRLLDGRTAP
FT                   PTDRIFRELPDLLQPGDLLVFNDTRVVKARVFGEKASGGKLELLIERVLTGNEVVAHMK
FT                   VSKKPLPGATLHLAGGAAAGGFDATLLGRYPDADGPLFRLALRGPAGESPWELMERHGH
FT                   LPLPPYIERQQAGGNDPHAGEDSERYQTVFARAPGAVAAPTAALHFDDAVLARLAERGI
FT                   ERASVTLHVGAGTFQPVKTENLAEHRMHSEWYEVPLATLAALERCRQRGGRVVAVGTTT
FT                   VRTLESWAASGQAAGDTSIFITPGFQFQVVDLLLTNFHLPKSTLMMLVSAFAGYEHIMQ
FT                   LYRHAVAQRYRFFSYGDCMLLERPRA"
FT   gene            complement(376709..377968)
FT                   /locus_tag="Dtpsy_0366"
FT   CDS_pept        complement(376709..377968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0366"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: aav:Aave_0592 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   Metal-dependent hydrolase HDOD; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31850"
FT                   /db_xref="GOA:B9MBT0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBT0"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACM31850.1"
FT                   /translation="MLKRIEVKHLTLGMYLHEFCGSWMEHPFWRSRFLLQDPQDLARIR
FT                   ATDIHEVWIDTSKGLDIAPGTASVSRAEADAQLDSDFQHLEDLPAQPAPAPAVTPQPAG
FT                   MDQELRRAAAICSQAKQAVVTMFGQARLGRAIDTAVAQEMVDEITDSVTRNPDALISLA
FT                   RLKTADEYTYMHSVAVSALMVALARQIGMDDGATRMAGLAGLLHDIGKAAVPLEVLNKP
FT                   GKLTDDEFTVVRSHPVAGYDLLQGTDLPEPVLDACLHHHEKMDGTGYPHRLTGEQISTL
FT                   ARMTAICDVYDAITSDRPYKRGWDPSESLRRMAEWTRDHFDSRLFQAFVKTIGIYPVGS
FT                   LVRLASGRLGVVTEQSPGKLIAPRVRVFYSTRSDLRIPPEVVDLSEPDCRDKIIAREDP
FT                   ARWQFPDLAQLWSDLPNPRW"
FT   gene            378027..380198
FT                   /locus_tag="Dtpsy_0367"
FT   CDS_pept        378027..380198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0367"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: ajs:Ajs_0376 ATP-dependent DNA helicase RecG;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG; PFAM: helicase
FT                   domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: helicase domain protein; DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31851"
FT                   /db_xref="GOA:B9MBT1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBT1"
FT                   /inference="protein motif:TFAM:TIGR00643"
FT                   /protein_id="ACM31851.1"
FT                   /translation="MPRPTRSSTSASSSAKPAPSPAQQALVKLGLVRDIDLALHLPLRY
FT                   EDETRITPIRSARDGDTVQIEATVTASEVQMRPRRQLVVTVEDGTGSCELRFFSFYPSH
FT                   QKTMAVGARLRVRGEIKGGFWGRQMLHPAFRKAEGDLPAALTPVYPTVAQLPQAYLRRA
FT                   VASALTRVELPETLPPGLEPPAVPSWVRGNGQNGLLRPWSLREALLFLHHPAPDVALAT
FT                   LQDHSHPAWQRLKAEELLAQQLSQLTAKRERARLRAPALRPQAQAGSTPLHEQLLGVLP
FT                   FSLTAAQRRVGEEIARDLARPVPMHRLLQGDVGSGKTVVAALAATVCMDAGWQCALMAP
FT                   TEILAEQHFAKLIGWLQPLLAARGRQVAWLVGGQKKKERAEMLARIESGEAALVVGTHA
FT                   VIQEQVRFKNLALAVIDEQHRFGVAQRLALRKKLQHAGMEPHLLMMSATPIPRTLAMSY
FT                   YADLDVSTIDELPPGRTPIVTKLIADSRKDEVVERIGAQVAAGRQVYWVCPLIEESEAL
FT                   DLSNATATHAELSEALQGDAAHGRAPVMVGLLHSRMPAAEKKAVMDLFKGGQMGVLVST
FT                   TVIEVGVDVPNASLMVIEHAERFGLSQLHQLRGRVGRGAAASACVLLYSTGDSGRLGET
FT                   ARDRLKAMAETTDGFEIARRDLEIRGPGEFLGARQSGDALLRFADLATDTLLLEWARET
FT                   APQMLDRHPLLAERHIQRWLGGKSDYLKA"
FT   gene            380267..381232
FT                   /locus_tag="Dtpsy_0368"
FT   CDS_pept        380267..381232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0368"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ajs:Ajs_0377 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31852"
FT                   /db_xref="GOA:B9MBT2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBT2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACM31852.1"
FT                   /translation="MTLTELKYIVAVAREKHFGRAAEACYVSQPTLSVAVKKLEDELEV
FT                   KLFERSAGDVSVTPLGEEIVRQAQSVLEQAAAIKEIAKRGKDPLAGALTLGVIYTIGPY
FT                   LLPELVRHAIARTPQMPLMLQENFTVKLLEMLRTGEIDCAIMAEPFPDTGLAIAPLYDE
FT                   PFLAAVPSSHPLAERDAVSASELKNETMLLLGAGHCFRDHVLEVCPEFARYASNAEGIR
FT                   RTFEGSSLETIKHMVSAGMGVTLVPRLSVPRDALHTGARRRKSDDTHIRYLPIKESDGS
FT                   PPPMRRVVLAWRRSFTRYEAIAALRNAVYACELPGVTRLS"
FT   gene            381310..381828
FT                   /locus_tag="Dtpsy_0369"
FT   CDS_pept        381310..381828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0369"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   ajs:Ajs_0378 ferritin, Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31853"
FT                   /db_xref="GOA:B9MBT3"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBT3"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACM31853.1"
FT                   /translation="MAKPSSKSVSTKSGAPRINIGISDKDRAAIAQGLSRLLADTYTLY
FT                   LTTHNFHWNVTGPMFNTLHTMFMAQYTELWNAVDPVAERIRSLGHVAPGSYAQFGQLTS
FT                   LPDVPAQPPKATEMIRILVEGHEAVARTARELFPLADKASDEPTADLLTQRLTVHEQTA
FT                   WMLRSLLED"
FT   gene            381855..383393
FT                   /locus_tag="Dtpsy_0370"
FT   CDS_pept        381855..383393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0370"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; adenylate
FT                   cyclase; KEGG: ajs:Ajs_0379 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31854"
FT                   /db_xref="GOA:B9MBT4"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBT4"
FT                   /inference="protein motif:PFAM:PF05235"
FT                   /protein_id="ACM31854.1"
FT                   /translation="MSATETELKLALPPRDAAALAARLMRVPALARATPVREHLVSLYH
FT                   DTPAQDLLRQRVALRLRREGPEGAGARWLQTLKTAGDTTSALSQRGEWEMPVAGPALEL
FT                   HRLEGTPWPAMDPDGVLAGALQPCFTTDFVRTRWRVRVRGGAVVEVALDVGAVTATVDG
FT                   AAHATPLCELELELLQGPPEALLALARRIARHVPVLPLAASKAARGYALLHPPASPAVE
FT                   AQPPALKRGMTVAQVAERVLQEPFHQFCANLFALQQGSDAPEVVHQARVGWRRLRSLAR
FT                   LFAPACAARPAPAAAALAPLLQSLGHLRDLDVARTQTLPALAAHYAQGGARQAAAWAAA
FT                   QAALDAAADQARAQTRAALHRPAVGAALLAWQDWLHGWALAAQGECGVEACASDALAGA
FT                   PARHWVRKRVQRLVRRLGAALKTAGDDEGLHHARILAKRLRYGSTSLAPLLPGRMGRHR
FT                   GAAEQWQERLGAQRDWAQAAALVAGCGGDAAVVAFLRGAALGRGWDPLRDAARR"
FT   gene            383597..384469
FT                   /locus_tag="Dtpsy_0371"
FT   CDS_pept        383597..384469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0371"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: ajs:Ajs_0380
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31855"
FT                   /db_xref="GOA:B9MBT5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBT5"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ACM31855.1"
FT                   /translation="MSAVAPRSRLSLYLDLIRWNRPAGWLVLVWPTLAALWVAADGFPG
FT                   WHLLAVFVAGTVLMRSAGCTINDIADRDFDRHVKRTTQRPITSGQLGVREAALVGVVLT
FT                   LVAFVLVLTTRWEAVAWSVPAVLFTILYPFTKRFFAMPQAFLGIAFNFGIVIAFAAVQG
FT                   RVPATAWVLWLANLFLVLAYDTEYAMVDRDDDLKIGMKTSAITLGRFDVAAIMGFFVLC
FT                   LGLTAWVLAPYGLGWPLWLGLGVAAAQVAWHFTLIKDRTREGCFTAFSKSHWIGAAIFA
FT                   GVALGYLLR"
FT   gene            complement(384525..385391)
FT                   /locus_tag="Dtpsy_0372"
FT   CDS_pept        complement(384525..385391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0372"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: ajs:Ajs_0381 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31856"
FT                   /db_xref="GOA:B9MBT6"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBT6"
FT                   /inference="protein motif:TFAM:TIGR00112"
FT                   /protein_id="ACM31856.1"
FT                   /translation="MPPDPIASPPNPMTASASPLPPIAFIGGGNMASAIIGGLLQRGLP
FT                   AGQIEVVEPFEPARAALQDKFGITAQPAAGDALARAALVVWAVKPQTFKEAAAATRAHT
FT                   ATALHLSVAAGIPTDSIARWLDTQHIVRAMPNTPALVGKGITGLFARPQVDPQGKALVE
FT                   RVIATTGQFVWVEAEEQLDAVTALSGSGPAYVFLFLEAMTQAGVDMGLPPAQAYQLAVA
FT                   TFQGASELAARSPESAEVLRQRVTSKGGTTHAAITHLQAAQVPAHFIAAMRAAEARAKE
FT                   LAAEFGA"
FT   gene            complement(385521..387017)
FT                   /locus_tag="Dtpsy_0373"
FT   CDS_pept        complement(385521..387017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0373"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: ajs:Ajs_0382 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31857"
FT                   /db_xref="GOA:B9MBT7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBT7"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACM31857.1"
FT                   /translation="MTYLLALDQGTSSSRSIVFDERGRIVAQAQRELPQIYPRPGWVEH
FT                   DPREIWRTQLATAQDALREARITAQDVRALGITNQRETTVLWNRRTGQPVHHAIVWQDR
FT                   RAEPACAQLREQGHAAAIQAKTGLLIDAYFSGTKLQWLLDHVPGARDAAEAGELAFGTV
FT                   DSWLIWQLTGGTRHVTDVSNASRTMLFNVHTNQWDDELLQLLRIPRALMPEVLPSASDF
FT                   GATDAALLGGPIAIGGVAGDQQSALFGQACFTAGMAKNTYGTGCFMLMHTGSRFQKSEN
FT                   GLLTTSAAQASRSPEYAMEGSVFVGGAVVQWLRDGLRAISASSEVQALAESVPDSGGVM
FT                   MVPAFTGLGAPYWKPDARGTITGLTRGTTIAHIARAALESIAYQSAALLAAMSRDAVAA
FT                   GGAPVSELRVDGGACVNDLLMQFQADLLGIPVVRPAVVETTALGAAYLAGLASGVYAST
FT                   DELSALWQAERRFTPTLPRSQAEALMARWEHAVAQAVLPG"
FT   gene            complement(387067..387855)
FT                   /locus_tag="Dtpsy_0374"
FT   CDS_pept        complement(387067..387855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0374"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein DeoR;
FT                   regulatory protein Crp; KEGG: ajs:Ajs_0383 DeoR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31858"
FT                   /db_xref="GOA:B9MBT8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBT8"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACM31858.1"
FT                   /translation="MPAPAPPVNTNPRQLQLLDEVRLRKSLSVEQLADILGVTLQTVRR
FT                   DVQRLAELGLVSRFHGGVRMPSSTVENLAYTQREALNSTGKARIARAVAAQVPDNCSLI
FT                   LNIGTTTEAIAKALLHHKGLRVLTNNLNVAAILCANPDCEVIVAGGVVRKRDRAIVGEA
FT                   AVDFIRQFRVDIALIGISGIEPDGSLRDYDMREVKVAQTIIEHAREVWLAADHTKFNRP
FT                   AMVQLAQLAQIDRLFTDAPPPEPFPALLHEAGVQCTVAAA"
FT   gene            388030..389124
FT                   /locus_tag="Dtpsy_0375"
FT   CDS_pept        388030..389124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0375"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: dac:Daci_1025
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31859"
FT                   /db_xref="GOA:B9MBT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBT9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACM31859.1"
FT                   /translation="MELILDGITKRVGPQVWLHGMGLRLHSDAVTVLLGATQAGKTSLM
FT                   RIMAGLDRPTEGRVRVDGVDVTGVPVRERNVAMVYQQFINYPSLTVADNIASPLKLRGD
FT                   KNVAARVRELAERLHITPFLDRLPSELSGGQQQRVALARALAKGAPLMLLDEPLVNLDY
FT                   KLREELREELSQLFAAGGSTVVYATTEPGEALLLGGYTAVLHEGELLQYGPTAEVFHAP
FT                   RSLRVARAFSDPPMNLLPAQPVPGGVQLAGGSVLALRHPLQAPAGGTLTVGLRASALRL
FT                   AQRAGDVAVQGVVELAEISGSDTFVHAATPWGALVAQVTGVHYLELGSAVTLYLDPAQA
FT                   YVFGADGALALAPVRASERAQGGH"
FT   gene            389126..390196
FT                   /locus_tag="Dtpsy_0376"
FT   CDS_pept        389126..390196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0376"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: ajs:Ajs_0385 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31860"
FT                   /db_xref="GOA:B9MBU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBU0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACM31860.1"
FT                   /translation="MARIELNLAHSYKPRPQQDSDYALLPLDMVFDDGGAYALLGPSGC
FT                   GKTTMLNIMSGLLVPSQGQVRFDGRDVTRASPQERNIAQVFQFPVIYDTMTVAENLAFP
FT                   LKNRKVPEAHIRQRVGKIAEMLEMSGQLDQRAAGLSADAKQKISLGRGLVREDVAAVLF
FT                   DEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTHDQVEALTFADQVVVMTRGRVVQMG
FT                   TPGDLFERPQHAFVGHFIGSPGMNFLPAQVQGGEITVAAQRWALPRALPEGAVQLGVRP
FT                   EYLALADAHAPGALRCTVARVQDVGTHQMLTATVEGQSLKARFAPEQALPAPGEAVWLQ
FT                   VLGEHTCFYKNEELLP"
FT   gene            390193..390345
FT                   /locus_tag="Dtpsy_0377"
FT   CDS_pept        390193..390345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31861"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACM31861.1"
FT                   /translation="MNGYPLSRCAASPWKGDGALCCGAALAGRPAVCAAPVVRVAGYPL
FT                   EHCHE"
FT   sig_peptide     390193..390297
FT                   /locus_tag="Dtpsy_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.625) with cleavage site probability 0.624 at
FT                   residue 35"
FT   gene            390338..391234
FT                   /locus_tag="Dtpsy_0378"
FT   CDS_pept        390338..391234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0378"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ajs:Ajs_0386
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31862"
FT                   /db_xref="GOA:B9MBU2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBU2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACM31862.1"
FT                   /translation="MSSTTKPVNQKAWFLVLPVILCVAFSAILPLMTVVNYSVQDIISP
FT                   ERRVFVGTEWFAAVLRDEELHGALVRQLTFSLAVLLVEIPLGILLALSMPAQGWKSSAV
FT                   LVIVALSLLIPWNVVGTIWQIFGRSDIGLLGAAFEAIGFDYSYTGNATHAWLTVLAMDV
FT                   WHWTPLVALLCFAGLRSIPDAYYQAARIDGASKFAVFRYIQLPKMRGVLMIAVLLRFMD
FT                   SFMIYTEPFVLTGGGPGNATTFLSQYLTQKAVGQFDLGPAAAFSLIYFLIILLLCFILY
FT                   NWMQRVGTTPKEGAGHE"
FT   sig_peptide     390338..390418
FT                   /locus_tag="Dtpsy_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.494 at
FT                   residue 27"
FT   gene            391227..392039
FT                   /locus_tag="Dtpsy_0379"
FT   CDS_pept        391227..392039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0379"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ajs:Ajs_0387
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31863"
FT                   /db_xref="GOA:B9MBU3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBU3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACM31863.1"
FT                   /translation="MNEPRFQKRTLFLIAYLVFAVLPIYWMVNMSFKTNEEILSSFSLW
FT                   PQHFTWANYQTIFTDESWYSGYINSLIYVAINTVISLTVALPAAYAFSRYQFLGDKHVF
FT                   FWLLTNRMTPPAVFLLPFFQLYTTVGLMDTHIAVALAHLLFNVPLAVWILEGFMSGIPR
FT                   EIDETAYIDGYSFPRFFLTIFLPLIKAGVGVAAFFCFMFSWVELLLARTLTSVNAKPIV
FT                   ATMTRTVSASGMDWATLAAAGVLTIVPGAIVIWFVRHYIAKGFAMGRV"
FT   gene            392052..392360
FT                   /locus_tag="Dtpsy_0380"
FT   CDS_pept        392052..392360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0380"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: ajs:Ajs_0388 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31864"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBU4"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0388"
FT                   /protein_id="ACM31864.1"
FT                   /translation="MFDWMAWTTPVAVFFTCIVLMLIGMTVWEIQSPTVERKGFLPMTT
FT                   TRGDRLFIGLLTAAYINLAWVGLGEKMAQWFSLEAEPSVWISFVLSMLVLALVLRKG"
FT   gene            392534..394267
FT                   /locus_tag="Dtpsy_0381"
FT   CDS_pept        392534..394267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0381"
FT                   /product="extracellular solute-binding protein"
FT                   /note="KEGG: ajs:Ajs_0389 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31865"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBU5"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0389"
FT                   /protein_id="ACM31865.1"
FT                   /translation="MKMQFKAIAFAAAALALGQAAWAGEAEAKKWIDSEFQPSTLSKDQ
FT                   QMAEMKWFIDAAKKLQAKGVKEIAVVSETITTHEYESKTLAKAFSEITGIQVKHDLIQE
FT                   GDVVEKLQTSMQSGKSIYDGWISDSDLIGTHYRYGKILNLSDYMAGPGKDYTNPGLDLQ
FT                   DFIGTKFTTAPDGKLYQLPDQQFANLYWFRADLFDRKDLKDKFKAKYGYDLGVPLNWSA
FT                   YEDIAEFFTNDVKQIDGKPIYGHMDYGKKDPSLGWRFTDAWLSMAGSADIGTPNGLPID
FT                   EWGIRVADDKCTPVGASVARGGATNSPAAVYALTKYVDWMKKYAPKEAMGMTFGEAGPV
FT                   PAQGQIAQQIFWYTAFTADMTKPGLPVVNADGTPKWRMAPGPNGPYWKQGMQNGYQDVG
FT                   SWTFFKDHNPDRLAAAWLYAQFVTAKSTSLKKTVVGLTPIRESDIRSKAMTDMAPKLGG
FT                   LVEFYRSPARVAWSPTGTNVPDYPKLAQLWWKNVAQAVTGEKTPQAAMDTLADEMDQVM
FT                   ARLQRAGMERCAPKLNAKGDPAKWLSDQHAPWKKLANEKPKGETINYNTLLQAWKDGKV
FT                   R"
FT   sig_peptide     392534..392605
FT                   /locus_tag="Dtpsy_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            394369..395967
FT                   /locus_tag="Dtpsy_0382"
FT   CDS_pept        394369..395967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0382"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ajs:Ajs_0390 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31866"
FT                   /db_xref="GOA:B9MBU6"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBU6"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACM31866.1"
FT                   /translation="MTSDTSTPLATVRADLLARLAQPVTYDLAVVGGGATGLGVALDAA
FT                   ARGFSVVLLESHDFAKGTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLRNAPHLA
FT                   QPLAFVMPSYKVWETPFYGVGLKMYDALAGKAGLGPTEFLGRMETLRCLPTAMADGLKG
FT                   GVKYWDGQFDDARLALALARTAAQRGALLLNYCPVDDLLYDGGKVAGVVCQDAETGQRY
FT                   EVRARCVVNATGVWVDALRQRDGDVSGQPAKPMVAPSQGVHIVVDREFLPSDHALMVPK
FT                   TADGRVLFAVPWLGKVILGTTDSPRQDLAREPQAMREEVAFILGESARYLRRAPQASDV
FT                   RSIWVGLRPLVKPSDEDAAATKSISREHTVLASRSGLVTVTGGKWTTYRAMAEDVLLKC
FT                   MDEHLLPRRPGGITVALPLVGAGATRERQGMNAPQGLHSYGDEAARVQALPGSQVQLAE
FT                   GLSEAMVRFAARHEYARTVEDVLARRSRVLFLDARLAAALAPRVADILREEIPGQDPQL
FT                   PAFLELAAHYATVPV"
FT   gene            396159..396527
FT                   /locus_tag="Dtpsy_0383"
FT   CDS_pept        396159..396527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0383"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: ajs:Ajs_0391 50S ribosomal protein
FT                   L14P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31867"
FT                   /db_xref="GOA:B9MBU7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBU7"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ACM31867.1"
FT                   /translation="MIQTESRLDVADNTGAKSVLCIKVLGGSKRRYASVGDIIKVSVKE
FT                   AAPRGRVKKGEVYSAVVVRTAKGIRRGDGSLVKFDGNAAVLLNSKLEPIGTRIFGPVTR
FT                   ELRTERFMKIVSLAPEVL"
FT   gene            396538..396858
FT                   /locus_tag="Dtpsy_0384"
FT   CDS_pept        396538..396858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0384"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; SMART: KOW domain
FT                   protein; KEGG: ajs:Ajs_0392 50S ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31868"
FT                   /db_xref="GOA:B9MBU8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBU8"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ACM31868.1"
FT                   /translation="MNKIRKGDEVIVLTGRDKGKRGTVSLRKDDSHLVIEGINLVKKHV
FT                   KPNPMKGTTGGIVEKAMPIHQSNVAIFNAATGKADRVGIKVQADGTRVRVFKSSGAEIK
FT                   AA"
FT   gene            396868..397407
FT                   /locus_tag="Dtpsy_0385"
FT   CDS_pept        396868..397407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0385"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: ajs:Ajs_0393 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31869"
FT                   /db_xref="GOA:B9MBU9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBU9"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ACM31869.1"
FT                   /translation="MARLQEIYRDKIAPELVKQFGYTSPMQVPRLTKITLNMGVSEAVA
FT                   DKKIMDNAVADLTKIAGQKPVVTKAKKAIAGFKIREGQAIGCMVTLRGAQMYEFLDRFV
FT                   TIALPRVRDFRGISGRAFDGRGNYNIGVKEQIIFPEIEYDKVDALRGLNISITTTAKTD
FT                   EEAKALLTAFRFPFKN"
FT   gene            397417..397722
FT                   /locus_tag="Dtpsy_0386"
FT   CDS_pept        397417..397722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0386"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: ajs:Ajs_0394 SSU
FT                   ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31870"
FT                   /db_xref="GOA:B9MBV0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBV0"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ACM31870.1"
FT                   /translation="MAKVALIQRELKREKLAAKYAAKYAELKAIAGDAKRSDEEREAAR
FT                   LGLQKLPRNANPTRQRNRCEITGRPRGTFRQFGLGRAKIRELAFAGDIPGVTKASW"
FT   gene            397743..398138
FT                   /locus_tag="Dtpsy_0387"
FT   CDS_pept        397743..398138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0387"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: ajs:Ajs_0395 SSU
FT                   ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31871"
FT                   /db_xref="GOA:B9MBV1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBV1"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ACM31871.1"
FT                   /translation="MSMSDPIADLLTRIRNAQMVSKATVSVPSSKVKVAIAQVLKDEGY
FT                   IDGFEVKSESGKTELEITLKYYAGRPVIERIERVSRPGLRVYKGCGSIPQVMNGLGVAI
FT                   VTTPKGVMTDRKARATGVGGEVLCYVA"
FT   gene            398163..398696
FT                   /locus_tag="Dtpsy_0388"
FT   CDS_pept        398163..398696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0388"
FT                   /product="ribosomal protein L6 signature 1"
FT                   /note="TIGRFAM: ribosomal protein L6 signature 1; PFAM:
FT                   ribosomal protein L6; KEGG: ajs:Ajs_0396 50S ribosomal
FT                   protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31872"
FT                   /db_xref="GOA:B9MBV2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBV2"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ACM31872.1"
FT                   /translation="MSRVGKSPVSIPAGVDVSIKDDQISVKGAGGVLSLAQNALVKVSN
FT                   NEGKLSFEPVNDSREANAMSGTVRQLVNNMVVGVSKGFEKKLTLIGVGFKAAASGNKLN
FT                   LAIGFSHPVNFEMPTGITVATPTPTEIVIKGADRQVVGQLAAEIRAVRPPEPYKGKGIR
FT                   YADEKVTIKETKKK"
FT   gene            398708..399073
FT                   /locus_tag="Dtpsy_0389"
FT   CDS_pept        398708..399073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0389"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: ajs:Ajs_0397 50S ribosomal protein
FT                   L18P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31873"
FT                   /db_xref="GOA:B9MBV3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBV3"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ACM31873.1"
FT                   /translation="MLTKKEQRLRRARQTRIRIAQQGVARLTVNRTNLHIYASVISGDG
FT                   SKVLASASTAEADVRKSLGGSGKGGNAAAAQIIGKRIAEKAKAAGVEKVAFDRAGFAYH
FT                   GRVKALADAAREAGLQF"
FT   gene            399091..399612
FT                   /locus_tag="Dtpsy_0390"
FT   CDS_pept        399091..399612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0390"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   ajs:Ajs_0398 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31874"
FT                   /db_xref="GOA:B9MBV4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBV4"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ACM31874.1"
FT                   /translation="MAKFQPKVQSEGQDDGLREKMIAVNRVTKVVKGGRILGFAALTVV
FT                   GDGDGRVGMGKGKSKEVPAAVQKAMEEARRNMVKVSLKNGTIHHNVTGHHGAAVVMMAP
FT                   APKGTGIIAGGPMRAVFEVMGITDIVAKSHGSSNPYNMVRATFDALTNSTTPAEVAAKR
FT                   GKTVEDLFAA"
FT   gene            399627..399809
FT                   /locus_tag="Dtpsy_0391"
FT   CDS_pept        399627..399809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0391"
FT                   /product="ribosomal protein L30"
FT                   /note="TIGRFAM: ribosomal protein L30; PFAM: ribosomal
FT                   protein L30; KEGG: ajs:Ajs_0399 50S ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31875"
FT                   /db_xref="GOA:B9MBV5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBV5"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ACM31875.1"
FT                   /translation="MTTQQTIKIQLVRSPIGTKESHRATVRGLGLRKLNSISELKDTPE
FT                   VRGMINKISYLVKVL"
FT   gene            399820..400251
FT                   /locus_tag="Dtpsy_0392"
FT   CDS_pept        399820..400251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0392"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: ajs:Ajs_0400 50S ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31876"
FT                   /db_xref="GOA:B9MBV6"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBV6"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ACM31876.1"
FT                   /translation="MELNSIKPADGAKHAARRVGRGIGSGLGKTAGRGHKGQKSRSGGY
FT                   HKVGFEGGQMPLQRRLPKRGFKSHLLKFNAEISLTALENLGLAEVDVLALKNAGLVGEL
FT                   AKVVKVIKSGEISKAVKLSGITATAGAKAAIEAAGGSLA"
FT   gene            400275..401594
FT                   /locus_tag="Dtpsy_0393"
FT   CDS_pept        400275..401594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0393"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: ajs:Ajs_0401 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31877"
FT                   /db_xref="GOA:B9MBV7"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBV7"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ACM31877.1"
FT                   /translation="MATNAAQLAKTGKFGDLRRRLVFLLLALVVYRIGAHIPVPGIDPA
FT                   QLQQLFSGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIMQLMTYVVPTFEQLK
FT                   KEGEAGRRKITQYTRYGTLGLAIFQSLGIAVALESSAGLVLSPGFGFRLTAVVSLTAGT
FT                   MFLMWLGEQITERGLGNGISILIFAGIAAGLPSSIGGLLELVRTGAMSILAAIFIVIVV
FT                   GLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVIPPIFASSIILL
FT                   PATIVNWFSAGESMRWLRDISAALTPGQPVYVMFYAAAIIFFCFFYTALVFNSRETADN
FT                   LKKSGAFIPGIRPGEHTARYIDKILVRLTLAGAVYITFVCLLPEFLILKYNVPFYFGGT
FT                   SLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFKTTLGT"
FT   gene            401739..401852
FT                   /locus_tag="Dtpsy_0394"
FT   CDS_pept        401739..401852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0394"
FT                   /product="ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36; PFAM: ribosomal
FT                   protein L36; KEGG: ajs:Ajs_0402 50S ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31878"
FT                   /db_xref="GOA:B9MBV8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBV8"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ACM31878.1"
FT                   /translation="MRVSASVKKICRNCKIIRRKGVVRVICTDQRHKQRQG"
FT   gene            401876..402241
FT                   /locus_tag="Dtpsy_0395"
FT   CDS_pept        401876..402241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0395"
FT                   /product="ribosomal protein S13"
FT                   /note="TIGRFAM: ribosomal protein S13; PFAM: ribosomal
FT                   protein S13; KEGG: ajs:Ajs_0403 30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31879"
FT                   /db_xref="GOA:B9MBV9"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBV9"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ACM31879.1"
FT                   /translation="MARIAGINIPPHQHTEIGLTAIYGIGRTRARKICEACGIAYSKKV
FT                   KELTDADLEKIRDQIAQFTIEGDLRRETTMNIKRLMDIGCYRGFRHRRGLPMRGQRTRT
FT                   NARTRKGPRKGAAALKK"
FT   gene            402259..402663
FT                   /locus_tag="Dtpsy_0396"
FT   CDS_pept        402259..402663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0396"
FT                   /product="ribosomal protein S11"
FT                   /note="TIGRFAM: ribosomal protein S11; PFAM: ribosomal
FT                   protein S11; KEGG: ajs:Ajs_0404 30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31880"
FT                   /db_xref="GOA:B9MBW0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBW0"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ACM31880.1"
FT                   /translation="MAKSPANNAAQRVRKKVRKNISDGIAHVHASFNNTIITITDRQGN
FT                   ALSWASSGGQGFKGSRKSTPFAAQVASEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRA
FT                   LGALGIRITSISDVTPVPHNGCRPQKRRRI"
FT   gene            402752..403375
FT                   /locus_tag="Dtpsy_0397"
FT   CDS_pept        402752..403375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0397"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: ajs:Ajs_0405 30S ribosomal protein S4;
FT                   TIGRFAM: ribosomal protein S4; PFAM: ribosomal protein S4;
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31881"
FT                   /db_xref="GOA:B9MBW1"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBW1"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ACM31881.1"
FT                   /translation="MARYLGPKAKLSRREGTDLFLKSARRSIADKAKFDSKPGQHGRTS
FT                   GARTSDYGLQLREKQKVKRMYGVLEKQFRRYFEAAERLKGNTGANLLGLLECRLDNVVY
FT                   RMGFGSTRAEARQLVSHKAITVNGQSVNIASYLVKAGDVVAVREKSKKQARIVEALQLA
FT                   QQVGMPVWVEVNADKVEGTFKKVPDRDEFGADINESLIVELYSR"
FT   gene            403487..404479
FT                   /locus_tag="Dtpsy_0398"
FT   CDS_pept        403487..404479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0398"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: ajs:Ajs_0406 DNA-directed RNA polymerase
FT                   subunit alpha; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase alpha subunit domain protein;
FT                   RNA polymerase dimerisation; RNA polymerase insert; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31882"
FT                   /db_xref="GOA:B9MBW2"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBW2"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ACM31882.1"
FT                   /translation="MQTNLLKPKAINVEQLGPNRAKVALEPFERGYGHTLGNAIRRVLL
FT                   SSMVGYAATEVTIAGVLHEYSSIDGVQEDVVNILLNLKGVVFKLHNRDEVTLSLRKDGE
FT                   GVVTARDIQTPHDVEIVNPEHVIATLSAGGKLDMQIKVEKGRGYVPGNLRRYADEATKS
FT                   IGRIVLDASFSPVKRVSYTVESARVEQRTDLDKLVVEIETNGAITAEDAVRASAKILVE
FT                   QLAVFAQLEGGELAAFDAPASSRGAATFDPILLRPVDELELTVRSANCLKAENIYYIGD
FT                   LIQRTENELLKTPNLGRKSLNEIKEVLASRGLTLGMKLENWPPAGLDKR"
FT   gene            404569..404958
FT                   /locus_tag="Dtpsy_0399"
FT   CDS_pept        404569..404958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0399"
FT                   /product="ribosomal protein L17"
FT                   /note="TIGRFAM: ribosomal protein L17; PFAM: ribosomal
FT                   protein L17; KEGG: ajs:Ajs_0407 50S ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31883"
FT                   /db_xref="GOA:B9MBW3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MBW3"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ACM31883.1"
FT                   /translation="MRHGHGLRKLNRTSSHRLAMLQNMMNSLIEHEAIKTTLPKAKELR
FT                   RVIEPMITLAKEDSVANRRLAFNRLRDRDSVTKLFNDLGPRFKTRPGGYTRILKMGFRV
FT                   GDNAPMAYVELVDRAETPEVSSTEA"
FT   gene            404983..405059
FT                   /locus_tag="Dtpsy_R0002"
FT                   /note="tRNA-Met1"
FT   tRNA            404983..405059
FT                   /locus_tag="Dtpsy_R0002"
FT                   /product="tRNA-Met"
FT   gene            complement(405209..406549)
FT                   /locus_tag="Dtpsy_0400"
FT   CDS_pept        complement(405209..406549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0400"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="KEGG: ajs:Ajs_0408 UDP-glucose 6-dehydrogenase;
FT                   TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31884"
FT                   /db_xref="GOA:B9MBW4"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBW4"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ACM31884.1"
FT                   /translation="MKVTVFGTGYVGLVQGAVLADVGHDVICVDVDAAKVAALQAGRIP
FT                   IHEPGLEPLVQANQAAGRLRFTTDAAQGVAHGELIFLAVGTPPDEDGSADLQHVLAVAR
FT                   TIATHMTAPKTIVNKSTVPVGTADKVADTVRKVLETRGVALAFEVVSNPEFLKEGAAVA
FT                   DCKRPDRIVIGTRAPQAERQLRELYAPFNRNHDRIVMMDVRSAELTKYAANAMLATKIS
FT                   FINEMANLAEQLGADIEDVRRGLGSDPRIGYHFIYPGVGYGGSCFPKDVKALIHTAQSI
FT                   GFTPDLLLAVESRNDAQRQLLARRIIAHYGGNLRGKTIAVWGLAFKPETDDMREAPSRY
FT                   LLQSLWAAGAQVRAHDPAAMDEARRIFGERDDLVLCGSPTEALEGADALAIVTEWKIFR
FT                   VPDFAQMAHALHDRMVFDGRNLYDPETITRFGLGYVSIGRAPVVGMS"
FT   gene            complement(406546..407556)
FT                   /locus_tag="Dtpsy_0401"
FT   CDS_pept        complement(406546..407556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0401"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: ajs:Ajs_0409 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31885"
FT                   /db_xref="GOA:B9MBW5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBW5"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACM31885.1"
FT                   /translation="MSVTLVTGCAGFIGMHCAQRLLERGERVVGIDNLNAYYDVGLKHA
FT                   RLGRLHGQGDFTFEQIDVADRDAMHALFARVRPHRVLHLAAQAGVRYSIDQPDDYTDSN
FT                   LLGFGNILQGCRAQQVEHLVFASSSSVYGGNAKLPFSERDAVDHPVSYYAATKKANEVM
FT                   AHAYAHLYGIPTTGLRFFTVYGPWGRPDMALFKFTRAMLAGETIDVYGEGQLVRDFTYI
FT                   DDIVEGVLRVLDKPATPDAAFDPLSPSPGTGLAPYRIFNIGNSAPTLLMDYIHALEEAL
FT                   GMVALKRMLPLQPGDMHSTAADMAALASWVGFAPHTPVRDGVARFVHWYKDFYPS"
FT   gene            complement(407553..409070)
FT                   /locus_tag="Dtpsy_0402"
FT   CDS_pept        complement(407553..409070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0402"
FT                   /product="glycosyltransferase"
FT                   /note="KEGG: ajs:Ajs_0410 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31886"
FT                   /db_xref="GOA:B9MBW6"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBW6"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0410"
FT                   /protein_id="ACM31886.1"
FT                   /translation="MTASTAPRALSSRLPWTHPLFWFAAISLAHVAMRLLASPALKWDE
FT                   AEQILWTQELALGYGPQPPLYTWLQWAMNQVFGPSVLALSLLKHGLLALTYSLMYLAGR
FT                   ELLDERGAFWASASMVLMPALGWYSVRDQTHTILVTAMACGAWWLLLRIVRRPRPLDFA
FT                   LLGLVCGFGMLGKYSFALVAGAMLLAALSVPEARRALLSRGWWWAPLVGLLVVLPHAAW
FT                   LLSHLTEATSGTISKMNIQPENGLVKGLLRLLEGVVPSTLLLWALFALWAFRSAWWQRP
FT                   LAPVSPPMHRVFVRYLGLVLLALAGMVVFAGVSNFKGRWILPLLCMAPLAAFSARPELQ
FT                   HHPRARRYTIAVATMAVILLVAAGIRPWFSGLRGEVDELNHPSIELADALRAAGYDGTS
FT                   PIVASDHMLAGMLRVRFPDALVDACAPGEDEIPTCVADHLRRSEQRGQGLLLISRTDYV
FT                   PSSWWDQAQARIAPRALQSIHLPFHMVRAGTPQAHYEYIWSPRGTQP"
FT   gene            409183..410214
FT                   /locus_tag="Dtpsy_0403"
FT   CDS_pept        409183..410214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0403"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ajs:Ajs_0411 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31887"
FT                   /db_xref="GOA:B9MBW7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBW7"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACM31887.1"
FT                   /translation="MNTAPTPAPDVSIVVPIYNEVENLPDLVERIAQAMSAQPLSFELL
FT                   AVDDGSRDGSADTLRELAATRPWLRPVFLARNYGQSSALQAGFDRVRGRYVVTLDADLQ
FT                   NEPADIPLLLERLENDSSVDMVSGWRKDRQDAELSRKLPSRIANRLISSATGVHLHDYG
FT                   CALKAYRRPIIDRIRLYGELHRFIPSLAKEAGARITEVPVRHHARTRGVSKYGIDRTFR
FT                   VILDLILIVFFMRYRQRPLHAFGGLGLWLAAPGVLILAWLLLQKVLGEDIGGRPLLLAG
FT                   VMLVLMGVQMVVAGLIGELLMRIYHEAGGAPQFHAQEYVPDSRVNMPAARDQKAQAATN
FT                   NIA"
FT   gene            410232..411140
FT                   /locus_tag="Dtpsy_0404"
FT   CDS_pept        410232..411140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31888"
FT                   /db_xref="GOA:B9MBW8"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBW8"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0412"
FT                   /protein_id="ACM31888.1"
FT                   /translation="MLRGLVGLALLGAVVALADPARVWSQLRQAQPGWLLAGLLAGIAS
FT                   NLVSALRWRALARWLGADASARDACRWYFQAIGLNALLPGAVVGGDVYRAVVLRGTGQD
FT                   TAASSWSVVLDRLSGLWMLCAIGGLGAAACADVLAPWLRLPRGLFIALMLVGTLLWLAL
FT                   PWCLPALLRSRRFAGGWLAPLREAATRPDFPRQLVWQAGASAAVQLLSAAALAGGGLAL
FT                   GVALPASVWAWAIAPVFLMAALPVSVGGWGTREAAAVAALAPFGVAASAAVGVGVVYGV
FT                   YGLAQGALGALAFGLPRSAGR"
FT   sig_peptide     410232..410288
FT                   /locus_tag="Dtpsy_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 19"
FT   gene            complement(411349..412263)
FT                   /locus_tag="Dtpsy_0405"
FT   CDS_pept        complement(411349..412263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0405"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: ajs:Ajs_0413
FT                   uroporphyrin-III C/tetrapyrrole methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31889"
FT                   /db_xref="GOA:B9MBW9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBW9"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACM31889.1"
FT                   /translation="MSAARDAAAAQHYPQGALYVVATPIGNLADITLRALHVLQLADTL
FT                   ACEDTRHTQSLLRAYGIDKPSDRLLALHQHNEAQAAQMVVQQLQAGQRVAYVSDAGTPG
FT                   VSDPGARLVAAVQAAGLRCIPLPGASSVTSALSVAGAVAPTADSGGFLFAGFLPPKGAE
FT                   RAAAVQRLAAEPRCVVLLEAPHRIAALADTLADLGERPVTLARELTKQFEEVSTHPARE
FT                   LAAWLAGAPQRVKGEFVVLLHPLAATQGDGAEAERVLRLLLDELPTKTAVKLAADIAHA
FT                   SRNTLYERALQIKRDAEAAGEHG"
FT   gene            412287..412685
FT                   /locus_tag="Dtpsy_0406"
FT   CDS_pept        412287..412685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0406"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   ajs:Ajs_0414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31890"
FT                   /db_xref="GOA:B9MBX0"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBX0"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ACM31890.1"
FT                   /translation="MGFLGKKVNGSAPARTTRAAGQAAEDRALAHLTAAGLALVERNYR
FT                   TPGRGGGEIDLILRERDGTLVFVEVRSRGASAYGGAGGSIGVAKQRRIVFAAQHYLLRW
FT                   PAPPPCRFDAVLIEGDRLQWLRGAFDAA"
FT   gene            412744..413337
FT                   /locus_tag="Dtpsy_0407"
FT   CDS_pept        412744..413337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0407"
FT                   /product="phosphoheptose isomerase"
FT                   /note="KEGG: ajs:Ajs_0415 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31891"
FT                   /db_xref="GOA:B9MBX1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBX1"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0415"
FT                   /protein_id="ACM31891.1"
FT                   /translation="MLEQRIQQHFIDSADLKYQSAQALSHPISAAVQAIWACVTNGAKV
FT                   LACGSGPSSAQALQFAAFCVAGFERDRPELAALALVPDALATGTSAVADSAVLARQVRA
FT                   LGQAGDLLLVITIGGNEPALLQAVQAAHERDMTVVALCGRDGGALGALLHETDVQICVP
FT                   HDRAARVREVHALVLHCLCDGVDAQLLGEQEIPL"
FT   gene            413334..414008
FT                   /locus_tag="Dtpsy_0408"
FT   CDS_pept        413334..414008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0408"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   ajs:Ajs_0416 transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31892"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBX2"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACM31892.1"
FT                   /translation="MTFPLLRISSAALAAAALAGSLAGCAPLVIGGGAVVGTLMATDRR
FT                   TTGTQVEDEGIEMRTASRIRETLGDRVHVNVTSYNRQVLLTGEVPTAADGQKVEQIAQG
FT                   VDNVRSVVNDLGVMPASSLTQRSRDAFISTKVRASLVDAKDLSANAFKVVTERDVVYLM
FT                   GRVTQREAKRSAEIARGVDGVRKVVRVFEVISEEELIRGGAAQQPAPVSQDPAAAAQPV
FT                   KP"
FT   sig_peptide     413334..413408
FT                   /locus_tag="Dtpsy_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.332 at
FT                   residue 25"
FT   gene            complement(414106..415035)
FT                   /locus_tag="Dtpsy_0409"
FT   CDS_pept        complement(414106..415035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0409"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase NAD-binding; KEGG:
FT                   ajs:Ajs_0417 3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31893"
FT                   /db_xref="GOA:B9MBX3"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBX3"
FT                   /inference="protein motif:PRIAM:1.1.1.31"
FT                   /protein_id="ACM31893.1"
FT                   /translation="MSSSINPRTYDPVPARRVAFLGLGVMGYPMAGHLASAGHTVTVYN
FT                   RTATKSEAWCAEFKGVATVKHAKTPREAAQGADIVFCCVGNDDDLRSVVLGADGAFAGM
FT                   QQGAVFVDHTTASAAVARELYGAARTLGLQFIDAPVSGGQAGAQNGQLTVMCGGDAAAF
FT                   DAVRPTAMAFSRAFTRIGDSGAGQLAKMVNQICIAGLVQGLSEAIAFGQHAGLDMPLVL
FT                   DVIGKGAAQSWQMDNRGKTMVEGRFDFGFAVDWMRKDLGLVLDEAKRNGARLPVTALVD
FT                   QFYADVQRAGGNRWDTSSLITRLAPKKD"
FT   gene            complement(415099..416235)
FT                   /locus_tag="Dtpsy_0410"
FT   CDS_pept        complement(415099..416235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0410"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: ajs:Ajs_0418 twitching
FT                   motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31894"
FT                   /db_xref="GOA:B9MBX4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBX4"
FT                   /inference="protein motif:TFAM:TIGR01420"
FT                   /protein_id="ACM31894.1"
FT                   /translation="MERDQASKFINDLLKLMVSRGGSDLFITAEFPPAIKVDGKVTKVS
FT                   PQPLTPNHTLTLARAIMSDKQVADFERTKECNFAISPAGVGRFRVNAFVQQGRVGMVLR
FT                   TIPLTLPTIDGLGVPQVLKEVTMTKRGLCILVGATGSGKSTTLAAMLDWRNENSFGHII
FT                   TVEDPVEFVHPHKNCVITQREVGLDTDSWEAALKNTLRQAPDVILMGEIRDRETMEHAV
FT                   AFAETGHLCLATLHANSANQALDRIINFFPEERRAQLLMDLSLNLKALISQRLIPKQDG
FT                   KGRAAAVEVMLNTPLIADLIFKGEVAEIKEIMKKSRNLGMQTFDQALFDLFEANVISYE
FT                   DALRNADSVNDLRLQIKLSSQRAKTTDLASGTEHFAIV"
FT   gene            complement(416282..416911)
FT                   /locus_tag="Dtpsy_0411"
FT   CDS_pept        complement(416282..416911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0411"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: cyclic
FT                   nucleotide-binding; KEGG: ajs:Ajs_0419 cyclic
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31895"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBX5"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACM31895.1"
FT                   /translation="MKGILGLLKSKNRKSGEESTDSVFFTTAFAGQGVEQSQLVPWEAR
FT                   AVEVDVKRLPQSRGGRLLQSLWSKDKYMAHLDHDAVERMERFFEFASVAPNRDLIRQDE
FT                   YGNFMVVLLTGTIAVDRVQPWGEQLRLAETRPGDILGEMSLLDSGIRFSACTTLTECEI
FT                   AVLSAEALDEMMAHDPQLAASLVALLARKLSQRLRVVSARLSENQR"
FT   gene            complement(416988..418031)
FT                   /locus_tag="Dtpsy_0412"
FT   CDS_pept        complement(416988..418031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0412"
FT                   /product="twitching motility protein"
FT                   /note="KEGG: ajs:Ajs_0420 twitching motility protein;
FT                   TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31896"
FT                   /db_xref="GOA:B9MBX6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBX6"
FT                   /inference="protein motif:TFAM:TIGR01420"
FT                   /protein_id="ACM31896.1"
FT                   /translation="MDITQLLAFSVKNKASDLHLSAGLPPMIRVHGDVRRINVDALDHK
FT                   TVHAMVYDIMSDAQRKTYEEFLEVDFSFEIDGLARFRVNAFNQNRGAAAVFRTIPSKIL
FT                   TLEQLNAPKIFADLALKPRGLVLVTGPTGSGKSTTLAAMVNYLNESEYGHILTVEDPIE
FT                   FVHESKKCLINQREVGPMTLSFAAALKSALREDPDAILVGEMRDLETIRLAMTAAETGH
FT                   LVFGTLHTSSAAKTIDRIIDVFPAEEKEMVRAMLSESLQAVISQTLCKTKDGSGRVAAH
FT                   EIMLGTSAIRNLIREAKVAQMYSTIQTSNSVGMQTLDQNLSDLVRRNIISPAEARSKAK
FT                   IPENFPG"
FT   gene            418071..418787
FT                   /locus_tag="Dtpsy_0413"
FT   CDS_pept        418071..418787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0413"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   ajs:Ajs_0421 alanine racemase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31897"
FT                   /db_xref="GOA:B9MBX7"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBX7"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACM31897.1"
FT                   /translation="MTTIASNLQNVRERIARACAAAGRPPDAVALLAVSKTFGPEAVRD
FT                   AALAGQRRFGENYIQEAVEKMALVAALGLPQALEWHCIGPVQSNKTRLVAQHFDWVHTV
FT                   DRPKTAQRLSDQRPDNLPALQVCIQVNVDGGATKAGVPAEEALALAQAVAALPRLTLRG
FT                   VMSIPDPAPDEAAQLAVLLRVRQVFDTLRAQGGPGFEAVDTLSLGMTGDLEAAVRAGST
FT                   MVRVGSGIFGARHYPA"
FT   gene            418826..419962
FT                   /locus_tag="Dtpsy_0414"
FT   CDS_pept        418826..419962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0414"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aminotransferase
FT                   class-III; KEGG: ajs:Ajs_0422 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31898"
FT                   /db_xref="GOA:B9MBX8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBX8"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACM31898.1"
FT                   /translation="MPGLLPDVDPDGLLEFSVVYTDRALNHMSRRFVGVMQDILATLKE
FT                   VYRAHTAVLVPGSGTFGMEAVARQFANREKVLIVRNGWFSYRWSQIFDAGGLGGGAVVC
FT                   QARRQGDGPQAPWVPCPASEVAAAIRAERPKVVFAPHVETASGILLPDDYLRTVSDAAH
FT                   EVGALFVLDCVASGAMWVDMEKTGVDVLISAPQKGWSGSPCCAMVMLSARAREAIEQTQ
FT                   SSSFSCDLKKWMQIAEGYEKGQHAYHTTMPTDALVRLRDVMLETRDYGFAKVRDEQIAL
FT                   GAKVRALLQARGFPSVAAAGYEAPGVVVSYTTDPGIQSGKKFAEAGLQTASGVPLQCGE
FT                   GADFQTFRLGLFGLEKWHNVDRTVGHLAAALDQVAPAR"
FT   gene            420030..421388
FT                   /locus_tag="Dtpsy_0415"
FT   CDS_pept        420030..421388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0415"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   ajs:Ajs_0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31899"
FT                   /db_xref="GOA:B9MBX9"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBX9"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ACM31899.1"
FT                   /translation="MLSRMHASPLEPGAQAAASAEPAALAGRASQLSRAKRQATGLLLA
FT                   VVVVFALTYFFPPSLGVACVRAVAEAAMVGALADWFAVSALFRRIPLPLVQRHTDIIAR
FT                   NKDRIGGNLAVFVRDKFLDAPSLVTMIRRHDPANMLAQWLTAPANARLLGRQVARLALT
FT                   ALDTVEDAKIQAFLSQAARTLVGKIDLSRSMASALGALTYQGRHQALLDDLLERLGGMV
FT                   RSEDTRAFVADTLLQWIKREHPLKQKVLPTDWLSGKGASAITHAVDTLLKAVAEDPQHE
FT                   LREALDGAVQRLIARLQTDPDWARRGDEVRGYLQNDEVLGRYVRDLWSDLRQKLRDDLM
FT                   NEDSALSARVADMGQWLGLSLAGDAALRVRLNVRLELWAATFAPDVAQSVAEHIRATVQ
FT                   RWDAQEMARLVELHIGSDLQYIRINGTVVGGCIGLLLFAVSHAGALWAAVVGS"
FT   gene            complement(421448..421903)
FT                   /locus_tag="Dtpsy_0416"
FT   CDS_pept        complement(421448..421903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31900"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBY0"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0424"
FT                   /protein_id="ACM31900.1"
FT                   /translation="MPVLSPFPFRLPRRLAPLGLCALLASGASAVQAQADSAPRPAVLP
FT                   PVQTAGALHYQCGGIGTDESTAMRAAMKDYPLSLLFARADGAYEANVDVRITPQGGGDA
FT                   MQLRAGGPVCLLQLPAGSYRVEVQGAGQNHSRTVQVGRAPQTLDFRF"
FT   sig_peptide     complement(421796..421903)
FT                   /locus_tag="Dtpsy_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.543 at
FT                   residue 36"
FT   gene            complement(421996..423498)
FT                   /locus_tag="Dtpsy_0417"
FT   CDS_pept        complement(421996..423498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0417"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ajs:Ajs_0425 FAD linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31901"
FT                   /db_xref="GOA:B9MBY1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBY1"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACM31901.1"
FT                   /translation="MAYSHAMPSPTSTERAQRQAEVVQALSACVPQHALLWQPEDTTPY
FT                   ECDGLTAYRQRPLVVCLPETEGEVQAVLKTCHRLGVPVVARGAGTGLSGGAMPHAMGVT
FT                   LSLAKFNRILDLDPVARTARVQCGVRNLAISEAAAPYNLYYAPDPSSQIACTIGGNVAE
FT                   NSGGVHCLKYGLTVHNVLRVRGYTMEGEPITFGSEALDAPGYDLLAAVIGSEGMLAVAL
FT                   EVTVKLVPKPQLARCIMASFDDVRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAVEDFVK
FT                   AGYDLTAEAILLCESDGTPEEVEEEIARMSEVLRGSGATAISVSTSEEERMRFWSGRKN
FT                   AFPASGRISPDYMCMDSTIPRKRLADILLAIQEMEKKYQLRCCNVFHAGDGNLHPLILF
FT                   DANDPDQLHRCELFGADILETSVAMGGTVTGEHGVGVEKLNSMCAQFTVEENAQMFALK
FT                   EAFDPQGLLNPGKVIPTLNRCAEYGKMLVRNGKMSHANLPRF"
FT   gene            complement(423656..424576)
FT                   /locus_tag="Dtpsy_0418"
FT   CDS_pept        complement(423656..424576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0418"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: aav:Aave_0647 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31902"
FT                   /db_xref="GOA:B9MBY2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBY2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACM31902.1"
FT                   /translation="MATQSLSIAAKAALDAASLRRIPPIQCLLTFEALARLRSVTQTAD
FT                   ELCVTPSAVSHRVKQLEQILGTRLFGRADFSLTTDGSAYLAHVREGLTALQRFPGTAVA
FT                   PGKRRLKIAVTPTFARALLIPRLRQFTETYPEIDLALQVSIPLLDVVAEDADLVVRYGP
FT                   GHYADMEHVEIARDVLTPLASPGFVREHGPFERPEDLEGLPLLRSPLEPWRSWFAAVGL
FT                   AWAEPNEGSQFNDVGLMCDAAAAGMGVAPVRLKLAAPWLDQGTLVRLFDTDAPSPYAHY
FT                   LCWRTGTMDRWECAAFADWLRRTLG"
FT   gene            complement(424601..425449)
FT                   /locus_tag="Dtpsy_0419"
FT   CDS_pept        complement(424601..425449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0419"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: ajs:Ajs_0428 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31903"
FT                   /db_xref="GOA:B9MBY3"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBY3"
FT                   /inference="protein motif:TFAM:TIGR00655"
FT                   /protein_id="ACM31903.1"
FT                   /translation="MTHSYILTLSCPDRLGLVHAVSGFLLDHGGNIEEAAQYNDQGTGL
FT                   FFMRVQFACESTDEATLKAELATFAEEHSMRWSLHATSAAMKTVLMVSKEGHCLNDLLF
FT                   RYKSGLLPIDIRAIISNHRDFYQLAASYNIPFHHIPVTAATKAQAEAKQYEIIQAEGAE
FT                   LVVLARYMQVLSNDLCAKLSGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVT
FT                   ADLDEGPIIEQDVTRADHTDTVEDLTARGRDTESQVLARAVKWHSEHRVLLNGHKTVVF
FT                   R"
FT   gene            425450..427822
FT                   /locus_tag="Dtpsy_0420"
FT   CDS_pept        425450..427822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0420"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: aav:Aave_0649 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; GGDEF domain
FT                   containing protein; PAC repeat-containing protein; EAL
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31904"
FT                   /db_xref="GOA:B9MBY4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBY4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACM31904.1"
FT                   /translation="MLRLSQHARPLQECGLLSKGAGRRPSWRPLQGRWMLALAVGAMGA
FT                   AWAWAGAAALQYLPLEPQALQTLLQYKSGLDAVLAGALLGWLLLRWRRGGSRRTLARRV
FT                   EQVLRHAPAGMARLSMDGRLVWANERLREWLGVAPHEPLPQVDFRTLVRPHDSDWAQRQ
FT                   LQRLRAGEIDHYQGERWCRNQRDGSQLPVLCTVSHVLALESEPDHLVCVLQSLREVHAA
FT                   RDAQALSEQRWRLAATVVDNTIEGVVVTDADGRILSVNPAVTRLMGYTEEELLGQNPRV
FT                   FKSGRHGPAFYEAMWDTMRQTGHWQGEIWNRRKNGEVFPERMSLSAVRGADGAVTHYVC
FT                   MFTDISEEKAQHQRLEFLAHCDPLTGLPNRAWFGEQLDSAVRQAQDSGEQMALLLLNLD
FT                   RFKDVNDSYGHAVGDEVLRHITRQVEQSLRPGDLLGRLAGDEIAVLARHLRHADGAAAV
FT                   ARHLIAAASTPWCTPDGIQVVVGVSVGICMFPAHARTTEALLQGAHSSVYGAKARGRGA
FT                   YCFFDESLIQAARERLEIEARLRVALAQGHLRLYYQPQVCIVTGRIMGAEALVRWLDPQ
FT                   EGMISPARFIPVAETSGVIGPLGQWVMRAACEQGQRWRADGLPEIRLAINLSPRQFQLT
FT                   DVAACAAEALKASGFPARCLELELTESVLAERPDEIRAVLQRLQQLGVRMAVDDFGTGY
FT                   SSLAHLKRFPIDVLKIDQGFIRDIPRSADDMAISAAIVAMGHSLGLSVLAEGVETPQQL
FT                   AFLRERGCDAYQGYLCSRPLPAEEFARLLQAHNGMAG"
FT   gene            complement(427850..428767)
FT                   /locus_tag="Dtpsy_0421"
FT   CDS_pept        complement(427850..428767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0421"
FT                   /product="protein of unknown function DUF399"
FT                   /note="PFAM: protein of unknown function DUF399; KEGG:
FT                   ajs:Ajs_0430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31905"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBY5"
FT                   /inference="protein motif:PFAM:PF04187"
FT                   /protein_id="ACM31905.1"
FT                   /translation="MIGMQVAFTPGCKATTPYHWPMIFSPLVRLLLTALALVWIAGCTT
FT                   PPEQPQPTSGAETAWDSQLERWPPVDALLLGEQHDAAAHQQWQRHTVQWLAVRQRLAAL
FT                   VLEMAPEGAGTDGLPPDAGAAQVRAALQWDEQAWPWDRYAPVVMAAVAAGVPVRGGNLP
FT                   RSQMPQAMRDTALDTHLPPAALARQRTAIEEGHCGLVPAQRLMPMVRIQLARDARMARA
FT                   VQAAHRPGRTVLLVAGFGHVQRSLGVPTWLPSDFMSKVAIAQAGQARAAIENEADYIHR
FT                   TPALTPHDPCAELRERWPGPPPAP"
FT   gene            428981..431422
FT                   /locus_tag="Dtpsy_0422"
FT   CDS_pept        428981..431422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0422"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein; KEGG: ajs:Ajs_0431
FT                   ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31906"
FT                   /db_xref="GOA:B9MBY6"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBY6"
FT                   /inference="protein motif:TFAM:TIGR02504"
FT                   /protein_id="ACM31906.1"
FT                   /translation="MQREITDLAPALSTQPISMDVLKEKYFKDGESDVEDLFRRVARAL
FT                   ASVEREDMRQALEARFLDNLRAGAIGAGRIMSAAGTDIQATLINCFVQPVGDCIQGVDD
FT                   AGYPGIYEALREAAETMRRGGGVGYDFSRIRPRGALVKGTASMASGPCSYINVFDQSCS
FT                   TVESAGARRGAQMGVLRIDHPDVLDFITAKRTPGRWNNFNVSVGVPDAFMEAVEQDRDW
FT                   ELVHGAAPGAELQAQGAHQRADGQWVYRTVRARELWDTIMKSAYDFAEPGILFLDQINT
FT                   DNNLHYTETIQATNPCGEQPLPPYGCCDLGPIILTRFVRNPFGLHGEASFDFDAFEQAV
FT                   ATQVRALDNVLDVTFWPLPQQQAESAAKRRIGVGFTGMGNTLAMLCKRYDRREGRDMAV
FT                   QIAERMRNAAYRASVELAKEKGAFPKFDADGYLAKGTFASRLPADIQKAIRKHGIRNSH
FT                   LLSIAPTGTVSLAFADNASNGIEPPFSWSYTRRKREADGSKSEYVVEDYAWRLYKTLGG
FT                   DVNHLPAYFVSAMDMAAADHVAMMEAVQPFVDTAISKTVNVPEDYPYADFKGLYMQAWH
FT                   SGLKGLATYRPNSILGAVLEVTPAAAPAPAAAPEAVPAPVVVDPMRTMIESRPTGGLSA
FT                   VAEKLEYWTQEGHKTLYLIVSFLPVPDGRGGTVDRAIEFFMPVGQSGESQQWITSSMRL
FT                   LSLAARGGFLERALSDMRKVAWDRGPVRLGTHQKADGTHVPLWHDSEVAAIAYAVQNIL
FT                   AQRAMPQQQVLPLDEPAAAPATGMPPAMAGKKCNECGAHAVIRKDGCDYCTQCGALGSC
FT                   G"
FT   gene            431593..433509
FT                   /locus_tag="Dtpsy_0423"
FT   CDS_pept        431593..433509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0423"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase dimerisation and phosphoacceptor
FT                   region; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   ajs:Ajs_0432 signal transduction histidine kinase,
FT                   nitrate/nitrite-specific, NarQ"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31907"
FT                   /db_xref="GOA:B9MBY7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBY7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACM31907.1"
FT                   /translation="MRNKSTLSTKLLAMGTVFLLVALASIGFTLWVTWKLEGGAAAVNE
FT                   AGRLRMNMLRMVLAQQNESPQEFARLETRFNEGLELLRTGDPARPLFVPWSDDTRERYE
FT                   HIRRQWLLIENDWKAAAHYESTAAAVARADAFVLDLDSFVEAIEIQIVRLTAVLHLFHL
FT                   FMVALAIGSAVAFMALSYLLVLNPVTRLQQALARLRKGDLGTRLEVEADDEFGQLTAGF
FT                   NLMAHALQTSHEDLERKVREKTATIEVRNQRLAALYAVSALAAEAGSLEELTQGFVQQI
FT                   RRVAGCDAAAVRWSDEANERYVLLASDGLPQSLVEHEHCVVTGACECGQAQGQARMRVI
FT                   PIMPAGGLQLPHCREAGFETVVSIPVQMHQRLLGEVTLLYRSPLELSAEMRELLSTMAH
FT                   HLATSMESLRASALEREAAVAQERSLIARELHDSIAQSLAFLKIQTQLLRDAVAKGNTE
FT                   ARDRSMAELDTGVRECYADVRELLVHFRTRTQDEDIEAALRATLSKFEHQTGAATALSM
FT                   AGHGLPLAQDVQIQVLHILQEALSNVRKHADARRVELRVQRHPRWRFEVQDDGRGFDPD
FT                   SVPPDSLHVGLGIMRERAQRIGAHLELVSRPGGGGTCVILELPPTTREEPALPLSLVSS
FT                   AAA"
FT   sig_peptide     431593..431676
FT                   /locus_tag="Dtpsy_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.446 at
FT                   residue 28"
FT   gene            433506..434177
FT                   /locus_tag="Dtpsy_0424"
FT   CDS_pept        433506..434177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0424"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; SMART: regulatory
FT                   protein LuxR; response regulator receiver; KEGG:
FT                   ajs:Ajs_0433 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31908"
FT                   /db_xref="GOA:B9MBY8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBY8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACM31908.1"
FT                   /translation="MNAPTTLFLIDDHTLLRRGLVALLSQQPDLRVVGEAGDAAEALRL
FT                   LPALRPDVILLDNHLPGVRGVDAIAGLREASQGSRVLMLTVSEDGQDLAAALRNGAQGY
FT                   LLKTIDGDLLAQAIRRAARGEPVVSPEMMGKLVAAFQSQGAPTPEPLPEEEEPASVLSP
FT                   REEDVLREIARGLSNKEIARALDIAETTVKIHVQHILRKLGLSSRVQAAVYASDRHRLT
FT                   E"
FT   gene            434323..435630
FT                   /locus_tag="Dtpsy_0425"
FT   CDS_pept        434323..435630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0425"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ajs:Ajs_0434 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31909"
FT                   /db_xref="GOA:B9MBY9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBY9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACM31909.1"
FT                   /translation="MAQLPQRAAPSASTIGEDPRHTRKAWSVLIVSTLAFTVCFMVWMM
FT                   FGVIGIPIKKMLNLSSTQFGLLTAMPVLTGSLVRVPLGIWTDRYGGRIVMALLMAATVP
FT                   AIWMMGYATEYWHFLVIGLFVGLAGGSFSVGTPYVARWFPKHRQGTAMGVYGAGNSGAA
FT                   VNKFVAPVILVAFGWAAVPHVYAAIMLGTLVLFWLFSHSDPAHLVPSNVSFGEQLKALK
FT                   DPKVLKYCQYYSIVFGGYVALSLWMVQYYVGEYGLDIRVAALLAACFSLPGGVLRAIGG
FT                   VLSDKFGAHSVTWWVMWVSWICLFLLSYPQTDFTIQTVNGPTTLHVGLNVYMFTALMFV
FT                   LGIAWAFGKASVFKYISDDYPKNIGAISGIVGLAGGMGGFILPILFGMLMDWTGIRSSA
FT                   FMLMYGVVWVSLIWMYFTEVRRTDVMKSHNAAPAAH"
FT   gene            435650..437095
FT                   /locus_tag="Dtpsy_0426"
FT   CDS_pept        435650..437095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0426"
FT                   /product="nitrite transporter"
FT                   /note="TIGRFAM: nitrite transporter; PFAM: major
FT                   facilitator superfamily MFS_1; KEGG: ajs:Ajs_0435 nitrite
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31910"
FT                   /db_xref="GOA:B9MBZ0"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBZ0"
FT                   /inference="protein motif:TFAM:TIGR00886"
FT                   /protein_id="ACM31910.1"
FT                   /translation="MSTNTVSQGSGRKGRVLTLWTPEDKSFWAREGEAVAKINLWISVP
FT                   ALFLAFAIWQVWSVVAVNLPALGFKYSTNQLFWLAAAPALSGATLRIFYSFMVPIFGGR
FT                   RWTALSTASLLVPAIGIGYAVQDNTTSYPTMLLLALLCGLGGGNFSSSMANISFFFPKE
FT                   RKGSALGVNAGLGNLGVSVVQFLSPLVITAGIFGIFGGEPQTIVKNGQEQMVWAQNAAF
FT                   IWVPWIALAAVAAWFGMNDIADARASFAAQAAIFKRKHNWIMCVLYLGTFGSFIGFAAG
FT                   FPLLIKALFPEVNPLAYAWLGPLVGAVVRPFGGWLADKVGGARVTVWNFLVMALAVVGV
FT                   LFFLPKGSGGFALPFGPAEGSFTGFFLMFLVLFFTTGIGNGSTFRMIPVIFLAQKLREL
FT                   RTDDEASRAQAIKDGNTEGAAAVGFAGALGAYGGFFIPKSYGSSIAATGGPEFALWMFA
FT                   VFYVLCIIITWWYYSRKHAEMPC"
FT   gene            437132..440920
FT                   /locus_tag="Dtpsy_0427"
FT   CDS_pept        437132..440920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0427"
FT                   /product="nitrate reductase, alpha subunit"
FT                   /note="TIGRFAM: nitrate reductase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: ajs:Ajs_0436 respiratory
FT                   nitrate reductase alpha subunit apoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31911"
FT                   /db_xref="GOA:B9MBZ1"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBZ1"
FT                   /inference="protein motif:TFAM:TIGR01580"
FT                   /protein_id="ACM31911.1"
FT                   /translation="MSHFLDRLSYFAQPRETFSQGHGQTNGEDRTWEDAYRDRWAHDKI
FT                   VRSTHGVNCTGSCSWKIYVKGGIVTWETQQTDYPRTRPDLPNHEPRGCARGASYSWYLY
FT                   SANRVKYPMVRGRLLKHWRAALAIAKSPVDAWAAIVENDSARREWQKQRGLGGFVRSTW
FT                   DEVNQMIAAANVYTIKKHGPDRIIGFSPIPAMSMISYAAGSRYLNLIGGVPMSFYDWYC
FT                   DLPPSSPQVWGEQTDVPESADWYNSNFIIAWGSNVPQTRTPDAHFFTEVRYKGAKVVAV
FT                   TPDYSEVAKLADLWLHPKQGTDAAVAMAMGHVILKEFYFDKRSAYFDDYARRYTDLPLL
FT                   VVLKEKTLPDGRTVMVPDRYVRASDFGDKLGQTNHPDWKTVAYGTDGKVALPNGSIGFR
FT                   WGKDGRDDQGLWNLESKEARTGNDVQLKLSVLEDGAQEHQVTDVAFPYFGGIETPNFEA
FT                   NDQGGDVIVRRVPITHLDLQGEGVQGRVAVATVFDLQVANYGILRGLQGEEKDGGYDAN
FT                   APYTPAWQESITGVPRDQVIAIARQFADNADKTHGKSMVIIGAAMNHWYHCDMNYRGII
FT                   NMLMMCGCIGQSGGGWSHYVGQEKLRPQTGWTALAFALDWIRPPRQQNSTSFFYAHTDQ
FT                   WRYEKLGVEEVLSPLADAKAYQGSMIDFNVRSERMGWLPSAPQLQTNPLQVVRDAAAKG
FT                   MDAKDYVVQSLKNGSLTLSCEDPDNPMNWPRNMFVWRSNILGSSGKGHEYFLKHLLGTT
FT                   NGVQGKDLGKDEAKPTEVKWHAQAPEGKLDLLVTLDFRMSTTCLYSDIVLPTATWYEKN
FT                   DLNTSDMHPFIHPLSAAVDPAWQSRSDWEIYKGFAKAFSEVCVGHLGVEKEVVLTPIMH
FT                   DTPAELAQPYGVKDWKRGECDLIPGVTAPQVTVVERDYPNTYKRFTALGPLMDKVGNGG
FT                   KGIAWNTETEVAQLGDLNGRVREEGVTQGRPRIVSDIDATEVVMMLAPETNGHVACKAW
FT                   EALGKQTGREHVHLALHREDEKIRFRDIQAQPRKIISSPTWSGLESEKVSYNAGYTNVH
FT                   ELIPWRTLTGRQQFYQDHPWMRDFGEGFVSYRPPVHLKALHEVEGKMPNGNPEIALNFI
FT                   TPHQKWGIHSTYSDNLHMLTLNRGGPVIWLSEDDAKRGGIVDNDWVELFNANGAIAARA
FT                   VVSQRVNPGMVLMYHAQEKIINTPGSEITGTRGGIHNSVTRVVLKPTHMIGGYAQYSYG
FT                   FNYYGTIGTNRDEFVLVRKMRRVDWMDDEASTSAAHA"
FT   gene            440939..442462
FT                   /locus_tag="Dtpsy_0428"
FT   CDS_pept        440939..442462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0428"
FT                   /product="nitrate reductase, beta subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="TIGRFAM: nitrate reductase, beta subunit; KEGG:
FT                   ajs:Ajs_0437 respiratory nitrate reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31912"
FT                   /db_xref="GOA:B9MBZ2"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBZ2"
FT                   /inference="protein motif:TFAM:TIGR01660"
FT                   /protein_id="ACM31912.1"
FT                   /translation="MKIRAQIGMVLNLDKCIGCHTCSVTCKNVWTSRPGVEYAWFNNVE
FT                   TKPGIGYPKEWENQDKWNGGWVRNPDGSIAPRQGGKWKLLMRIFANPNLPQIDDYYEPF
FT                   TFDYDHLQSAPEMKAAPTARPRSLITGQRMEKIEWGPNWEEILGGEFSKRSADVNFEQV
FT                   QKDMYGQFENTFMMYLPRLCEHCLNPACVASCPSGSIYKREEDGIVLIDQDKCRGWRMC
FT                   VSGCPYKKIYYNWQTGKAEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADRIQE
FT                   AASVERDRDLYEAQLDIFLDPNDPDVIRQAKADGISDAWLEAAKNSPVYKMAVDWKIAL
FT                   PLHPEYRTLPMVWYVPPLSPITSAANAGHLGVNGEIPDVSQLRIPVQYLANLLTAGDTG
FT                   PVVRALERMLAMRAYQRGMHVDRQQNLAVLQQVGLTVHEVEDMYQVMAIANYEDRFVIP
FT                   SAHREYAENAFDLRGGCGFSFGNGCSDGSTDVSMFGGKKRRTIPIKATV"
FT   gene            442482..443180
FT                   /locus_tag="Dtpsy_0429"
FT   CDS_pept        442482..443180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0429"
FT                   /product="nitrate reductase molybdenum cofactor assembly
FT                   chaperone"
FT                   /note="TIGRFAM: nitrate reductase molybdenum cofactor
FT                   assembly chaperone; PFAM: Nitrate reductase delta subunit;
FT                   KEGG: ajs:Ajs_0438 respiratory nitrate reductase chaperone
FT                   NarJ"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31913"
FT                   /db_xref="GOA:B9MBZ3"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBZ3"
FT                   /inference="protein motif:TFAM:TIGR00684"
FT                   /protein_id="ACM31913.1"
FT                   /translation="MFQKTPESLRLTLRALAHLLGYPDAALRANAPALLDALRLERALP
FT                   EARMQEIEALCRQLCAMEPYEAEARYVDTFDRGRQTSLHLFEHVHGDSRERGPALIDLM
FT                   QTYEKAGLQFDAQELPDHLAVVLEFASTQPPAVAREFLGEMAHILNALFTALTSKGNPY
FT                   ACVIAAVLEVAGQRVQAVAIAPEPGLDDAWAEPEAFDGCATRGQNRPDQPQPLHFVRNA
FT                   RTNSSQGASV"
FT   gene            443177..443911
FT                   /locus_tag="Dtpsy_0430"
FT   CDS_pept        443177..443911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0430"
FT                   /product="respiratory nitrate reductase, gamma subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="KEGG: ajs:Ajs_0439 respiratory nitrate reductase
FT                   gamma subunit; TIGRFAM: respiratory nitrate reductase,
FT                   gamma subunit; PFAM: Nitrate reductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31914"
FT                   /db_xref="GOA:B9MBZ4"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBZ4"
FT                   /inference="protein motif:TFAM:TIGR00351"
FT                   /protein_id="ACM31914.1"
FT                   /translation="MTAWIDNLLFGLYPYICLAVFFIGSWARFDRDQYTWKSDSSQLLR
FT                   RGSLRWGSNLFHVGVLVLFFGHFVGMLTPHALYEPFMSAGAKQIMAMVVGGVAGTLGFI
FT                   GVTLLLHRRLTDARIRATSKTSDILLLWVLWVQLALGLATIPLSAQHLDGSMMMLLAEW
FT                   AQRIVTFRGGAVELLANAGWVFKAHMFLGMTVFLIFPFTRLVHVWSGFGTLAYITRPYQ
FT                   LVRARRMNLPAGHNQPGNRNAL"
FT   gene            444003..444839
FT                   /locus_tag="Dtpsy_0431"
FT   CDS_pept        444003..444839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0431"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: ajs:Ajs_0440 PpiC-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31915"
FT                   /db_xref="GOA:B9MBZ5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBZ5"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACM31915.1"
FT                   /translation="MSNTTCGSGGCGCAGSTDNLPQEDAAPVARINGVPLHAEGEILPP
FT                   DALRQRACTELLRQQAQREGLLSQDDAPGLDGATSAEASQAIERLLDQALQVPEPSEEA
FT                   CRRYHAAHPTLGGQGERVRMRHVLFAVTPGVDVKLLRQRAEGVLLDLRCADDDGARFAA
FT                   AAGQWSNCPSGQEGGDLGWLSAEDCAPEFAREVFGTQEVGVLSRLVHSRFGLHVVEVCE
FT                   RQPGQELPFEQVRASVALMLRQQAWVNALRQYLQLLAGEAEVEGVHLDAADTPLVQ"
FT   gene            444861..445538
FT                   /locus_tag="Dtpsy_0432"
FT   CDS_pept        444861..445538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0432"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: ajs:Ajs_0441
FT                   carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31916"
FT                   /db_xref="GOA:B9MBZ6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBZ6"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ACM31916.1"
FT                   /translation="MPDDELLQRLRRFHLDAFPQYREQFQTLVDEGQHPTTLFIGCSDS
FT                   RLLPYLLTGAGPGELFLVRNVGAFVPPYDGSYGHHGTAAAIEFAVLELHVSRIVVCGHS
FT                   HCGAIKALYGEVSPEARNLQRWLDLGREAALPVQPGPEALRRTEQRAVVLQLERLMEYP
FT                   MVRRRVEDGSIALHGWHYVIEEGEVHVFDVATGGFVAASKAKSSGTGPYAPYVEHDGQV
FT                   LVD"
FT   gene            445575..446909
FT                   /locus_tag="Dtpsy_0433"
FT   CDS_pept        445575..446909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0433"
FT                   /product="NnrS family protein"
FT                   /note="PFAM: NnrS family protein; KEGG: ajs:Ajs_0442 NnrS
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31917"
FT                   /db_xref="GOA:B9MBZ7"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBZ7"
FT                   /inference="protein motif:PFAM:PF05940"
FT                   /protein_id="ACM31917.1"
FT                   /translation="MTEVRRRTVPLRSEPAAPGRPSAEALARLDRRWRPRYLMLAPHRL
FT                   GFFLAMLLLMASGLWWALVQIDRVSGALALPYGVAPSLVHAAVMTFGFMPLFFAGFLFT
FT                   AGPKWLHVEPWPVSRVMPPLLLQAGGWLVWLAGGSWGLLVALAGCAAAFLGLAWMTVLF
FT                   IRLVQCSTLQDRLHARAIAAACLVGCVCIAALGLSLAGGRGDLARAWVLTGLWGFVAAV
FT                   FVVVAHRMIPFFTSAVLPMVQAWRPFWVLWLMLAAVVAEALAVWLPWLGWAPALDTGGL
FT                   LVRGALELSVGAVLLWLAYRWGLLQSLAQRLLAMLHIGFIWLGLAFVGHGLAHGVQGLY
FT                   GSAAGELGALHALTMGCLGSLMLAMVTRVSCGHGGRALVADRLVWTLFWVLQLATVVRL
FT                   AASAPLPWSPVLLAVAALLWAGIMAVWGLRLIGWYGRLRADGRPG"
FT   gene            446933..447577
FT                   /locus_tag="Dtpsy_0434"
FT   CDS_pept        446933..447577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0434"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: ajs:Ajs_0443
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31918"
FT                   /db_xref="GOA:B9MBZ8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBZ8"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACM31918.1"
FT                   /translation="MPPQALNNAAATAELAAALLQARQTILPKRLGAPGPDAAQLQAIL
FT                   AAAAHAPDHGCLLPWRFVLVPDAARAALGQAFADALRERDAQATPEQQEQAREKALRAP
FT                   VLLLVVVDECGGDPEIAPSERLVSAGCAVQNLLLMATALGFGSALTSGKALQSQALRGL
FT                   FALGEGERALCFVSVGTVVSRKPVRARPVPAQYVGTLVPGRGVQPWPQQGE"
FT   gene            447578..448003
FT                   /locus_tag="Dtpsy_0435"
FT   CDS_pept        447578..448003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31919"
FT                   /db_xref="UniProtKB/TrEMBL:B9MBZ9"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0444"
FT                   /protein_id="ACM31919.1"
FT                   /translation="MQVKTEINSFDDLLRAARSHRERQRLLFVFAGTELPDEATPEQRE
FT                   RFAQGEGGVLVPLMCVDKLPEELESFDALVRESQQFEQPGQPWRLVFTAALSGTAAQAP
FT                   SDDDADKVLRRMVEAVKTGAFSAYLPFNRDGQPVRLG"
FT   gene            448008..448553
FT                   /locus_tag="Dtpsy_0436"
FT   CDS_pept        448008..448553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0436"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: ajs:Ajs_0445 hemerythrin HHE cation binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31920"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC00"
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /protein_id="ACM31920.1"
FT                   /translation="MASRVSLPGLHTPGAGFDEPFEMLGACHDRVRRSLDLLQRLRDYL
FT                   KAHACDDSARQAARDVLRYFDIAAPLHHEDEELHVFPPLLAGGDAALTDLVRQLQRDHV
FT                   LMAERWAAARVGLQALADGAVQAFTPQHETALDRFAQCYDDHLRHEDDRIYPAARALLD
FT                   DPAQQSMGQEMARRRGVR"
FT   gene            complement(448774..449064)
FT                   /locus_tag="Dtpsy_0437"
FT   CDS_pept        complement(448774..449064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31921"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC01"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0446"
FT                   /protein_id="ACM31921.1"
FT                   /translation="MNMLYDSDSFVVVHMLADATPDSASEAATPAVPQLVRHGFEIVDK
FT                   RSGKEVYLDGSWAEMFQQQILAWQRNTPTQEEVEDTLDGYVGLAQNPVIVH"
FT   gene            complement(449240..450454)
FT                   /locus_tag="Dtpsy_0438"
FT   CDS_pept        complement(449240..450454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31922"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC02"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0447"
FT                   /protein_id="ACM31922.1"
FT                   /translation="MPRRALLLLTAVVLALHWLVLVGLPRGGTDQGAPQRLAFHTRMVE
FT                   PPPPPPPPPESQAAPVPPPAPKPRPRPVRKPPPPPVEAPLPTQHPEPAPAMEAPAQTAP
FT                   SPAEPPAEVPADSSAPTPEVPADAAAPSAPLSPASDPAMPAMAEASSASAPAAASQPAQ
FT                   EAPALTAGVEILPPGAAGAVAGTEPPPVRLPPSARLAFDVTGEVKKFHYNASAELLWRQ
FT                   DGTQYEARQQIKAFLLGARSQSSVGQITPQGLRPTRFGDKSRSERAAHFDFERGEVIFS
FT                   ANAPRAAIGSGAQDRLSVFIQLGALLAAAPERYPPGTRITLTTVGARSAERWTFTVEGP
FT                   QTLELPAGSTPALKLQRLPRPDQRYDQKAELWLGTDMGYLPVRIRLTQANGDFADLSLS
FT                   HHDTP"
FT   sig_peptide     complement(450383..450454)
FT                   /locus_tag="Dtpsy_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.452 at
FT                   residue 24"
FT   gene            complement(450459..451247)
FT                   /locus_tag="Dtpsy_0439"
FT   CDS_pept        complement(450459..451247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0439"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   ajs:Ajs_0448 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31923"
FT                   /db_xref="GOA:B9MC03"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC03"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACM31923.1"
FT                   /translation="MDKERVGIQSVEVGFALLDALSRARGPLMLKDLAQEAGMSAAKAH
FT                   RYLVSFQRLGLVVQDARNARYDLGPAALKLGLASLARLDAMRLARERMAPLMDALGHTL
FT                   ALAVWGNHGPTIVHWEEAPRALTANLRLGDVMPLLSSATGRCFAAYLPREKTAALLAEE
FT                   LALATRQGRADLPHDEAGVQALLREVRERRCARVLDTLLPGIHAFCAPVFDAGGHLALA
FT                   ITTLGPAATFDAAWGGAIEAPLRAAAEQLSRDLGHAATPG"
FT   gene            451363..452346
FT                   /locus_tag="Dtpsy_0440"
FT   CDS_pept        451363..452346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0440"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   ajs:Ajs_0449 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31924"
FT                   /db_xref="GOA:B9MC04"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC04"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACM31924.1"
FT                   /translation="MKLATYKDGSRDGQLVVVSRDLGTAHYATGIASRLQQVLDDWNFM
FT                   APQLQDLYDQLNAGRARHPFPFDPQQCMAPLPRAYQWADGSAYINHVELVRKARNAEVP
FT                   ASFYTDPLMYQGGSDDFIGPCDDVVVPSEAMGIDFEAEIAVVTGDVKMGASPEQALDGI
FT                   RLVMLANDVSLRNLIPAELAKGFGFFQSKPATAFSPVAVTLDELGDAWQGGRVHLTLQS
FT                   TWNGRKVGMCDAGPEMTFHFGQLIAHIAKTRNVRAGSIVGSGTVSNKDWAKGYNCIAEK
FT                   RCIETIQDGQPSTEFMRYGDTIRIEMKNKAGQSLFGAIDQTIAAPQ"
FT   gene            452423..453391
FT                   /locus_tag="Dtpsy_0441"
FT   CDS_pept        452423..453391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31925"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC05"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31925.1"
FT                   /translation="MERRTFLAACAATAAAPWARADTGYPSQPIRWVVPYPAGGGTDVL
FT                   ARTVAEAMRGGLGQQIVVDNRPGASTNIGSQIVATAKPDGYTVMSADNALLAYNEHLYR
FT                   RLPFHPDKDFTYIGGLSRFPLVLVVNPAFAAQTFQDFLAYVKAHPGQVNYASPGNGSPH
FT                   HLAMELFKHRTQTFLTHIPYRGAAPAVQDVMGGQVPCMFLDLAAGLPVIQSGKVRALAI
FT                   GAARRAAALPHVPTLAEVGVADAEVYAFQGLLGPAGLPPAITARLNAALNQALAAPEVV
FT                   ERMRAFGMEPLAGTPEQFHALARAEARRWGPVIAATGVKLD"
FT   sig_peptide     452423..452488
FT                   /locus_tag="Dtpsy_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.827 at
FT                   residue 22"
FT   gene            complement(453456..455522)
FT                   /locus_tag="Dtpsy_0442"
FT   CDS_pept        complement(453456..455522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0442"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: ajs:Ajs_0451 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31926"
FT                   /db_xref="GOA:B9MC06"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037920"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC06"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACM31926.1"
FT                   /translation="MLPTPVPDASATHQVRGACPHDCPDTCALLTTVENGRAVRVQGNP
FT                   AHAQTGGVLCAKVSKYAERTHHAERILTPLKRTGPKGSGQFTPVSWDEALGDIAARLAH
FT                   IAARDPQAIQPYSYAGTMGLVQGESMDRRFFHRLGASLLARTICATAGGEGLVHTLGAK
FT                   VGMKVEFFAEAQLILIWGSNSIGSNLHFWRIAQQAKRDGARLVCIDPRKSETAEKCHEH
FT                   LQLRPGTDAALALALMHELIVHDWLDHDYLARHTLGWEPLRERALQWPPERAAEVCGLP
FT                   VEQIRRLAHDYGTTRPAAIRLNYGVQRTHGGANAVRAIASLPALTGAWRHRAGGVLLSS
FT                   SGSFPVDRAALQRPDLLAGRSPRTINMVTIGDDLLRDASPSFGPKIEALVVYNSNPVAV
FT                   APDSRQVVRGFAREDLFTVVLEHFQTDTADYADYILPATTQLEHWDVHLAYGHTDVLLN
FT                   RPAIAPQGQARSNAQIFRDLAARMGFTEPCFADSDEALCRQAYGDRVDFDLLLEQGFAP
FT                   LSVPDAPFADGGFPTPSGQCEFYSQRLADQGLDPLPGYVPNHEGAGTSADYPLAMISPP
FT                   ARNFLNSTFVNLQSLRDIEGRPLLEIHPEDAAARGIADGALVRVFNDRGSYACHAALNG
FT                   RARPGVVNGLGVWWRKLGHNGTNVNELTSQALTDLGAGPTFYDCRVQVEPLAS"
FT   gene            455644..456792
FT                   /locus_tag="Dtpsy_0443"
FT   CDS_pept        455644..456792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0443"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   ajs:Ajs_0452 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31927"
FT                   /db_xref="GOA:B9MC07"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC07"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACM31927.1"
FT                   /translation="MHSTRLSRRQFSAGMGAALLTGASLTRAQSDTRIVLGQSAALTGP
FT                   ASQLGLQFQAGAKLAFDQVNAQGGIGRRTIELRSLDDGYEPDRCAENTRRLINEDVLAL
FT                   FGYVGTPTSLAAQPLFTQTKVPFFAPVTGAESLRQPFNRLAFHVRASYADEAELIVRQL
FT                   TNLGLDRIGVFYQDDAYGKAGLDAVTRALATRKLAPVATGTVARNSTNVTAAVAPLVAA
FT                   QPVAIVQIGAYAASAAFVLAARKAGYGGKFYNVSFVGTQALADALGANGAGVVVSQVVP
FT                   SPYQQSRQITREFQEAIKKGGNVQANYSSMEGYLAARVFIEGLRNAQAHASGKLTRESL
FT                   VAGLESLRGSVGGFTVNFSPSDHEGSRFVEMSMLTGDGRVRT"
FT   sig_peptide     455644..455730
FT                   /locus_tag="Dtpsy_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 29"
FT   gene            456908..458113
FT                   /locus_tag="Dtpsy_0444"
FT   CDS_pept        456908..458113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0444"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: ajs:Ajs_0453 amidohydrolase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31928"
FT                   /db_xref="GOA:B9MC08"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC08"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACM31928.1"
FT                   /translation="MNIIDSIAREAAAIAEVRRDIHAHPELCFQEVRTADVIAAKLTEW
FT                   GIPIHRGLGTTGVVGIVHGRDGGACGRAVGLRADIDALPMQEFNTFAHASKHQGRMHAC
FT                   GHDGHTAMLLAAAQYFSKHRDFDGTVYLIFQPAEEGGGGAREMIKDGLFERFPMQAVFG
FT                   MHNWPGMPAGSFAVSPGPVMASSNEFKITIRGKGSHGAMPHMGIDPVPVACQMVQAFQN
FT                   IISRNKKPIEAGVISVTMIHAGEATNVVPDSCELQGTVRTFSTELLDMIERRMRQVAEH
FT                   TCAAFEARCEFEFVRNYPPTINSPAEAEFARQVMVGIVGEDKVLAQEPTGGAEDFSFML
FT                   QAKPGAYVFIANGDGDHRAMGHGGGPCTLHNPSYDFNDALIPLGGTYWVELARQWLAQP
FT                   TA"
FT   gene            458214..459314
FT                   /locus_tag="Dtpsy_0445"
FT   CDS_pept        458214..459314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31929"
FT                   /db_xref="InterPro:IPR021259"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC09"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0454"
FT                   /protein_id="ACM31929.1"
FT                   /translation="MIGIPQAFAARYAQARAQFVGAAAVAGLALQPQVHPLCGPNGETL
FT                   ALDVVREGPLDAPRLLIVSSGCHGVEGLCGSGVQVFALQDGEWRAKARAQRVAVLYLHA
FT                   LNPYGFAHLRRVTHENVDLNRNFVDFSQPLPANPAYSALHPVLLPPEWPPSEANTQALL
FT                   GLLNTHGLQALQAAITRGQYQHPDGLYFGGTAPTWSNRTLRSVLRREGARAERIAWVDL
FT                   HTGLGPSGHGERIHAGRDEAQALARARRWWDGGGATPVTSTEDGSSTSAPLTGLMCNSA
FT                   YDECPQAEVTALTLEFGTQPASAVLQALRADHWLHRHPEASPALAARVHAQMREAFYTD
FT                   TDAWKGQVISQARQVLFQAVDGLCMA"
FT   gene            459399..459656
FT                   /locus_tag="Dtpsy_0446"
FT   CDS_pept        459399..459656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0446"
FT                   /product="acyl-coA-binding protein ACBP"
FT                   /note="PFAM: acyl-coA-binding protein ACBP; KEGG:
FT                   ajs:Ajs_0455 acyl-CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31930"
FT                   /db_xref="GOA:B9MC10"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC10"
FT                   /inference="protein motif:PFAM:PF00887"
FT                   /protein_id="ACM31930.1"
FT                   /translation="MSDLNATFEAAVANSKNLSERPDNPTLLKIYALYKQATAGDNAEK
FT                   KPSFSDIVGRAKWDAWEKLKGTSGDAAKQQYIDLIESLRG"
FT   gene            complement(459735..460880)
FT                   /locus_tag="Dtpsy_0447"
FT   CDS_pept        complement(459735..460880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0447"
FT                   /product="putative zinc protease protein"
FT                   /note="KEGG: ajs:Ajs_0456 putative zinc protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31931"
FT                   /db_xref="GOA:B9MC11"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC11"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0456"
FT                   /protein_id="ACM31931.1"
FT                   /translation="MSTSTPSPRRPWPLLAAALLLGGCAQSGGTLGYYWQSLRGHLEIM
FT                   NAARPVQEWITHPDTSAPLRERLQLAQRARAFAVDELALPDNASYRRYARLDRTAAVWN
FT                   VVAAGPYSLTLHRWCFPITGCIGYRGYFDEPGARAEAARLAATGLEVSVYGVPAYSTLG
FT                   YSNWMGGDPLLSTFIGWPEGDFVRLLLHELAHQVAYAEGDTAFNESYATAVERLGVQRW
FT                   LQQHATPATRAQFAASEERRAQWRALTQATRRRLAEIYASNGAVTPDHQALSAMKKEAM
FT                   QDFRAAYATLRARWLAAHVPEAQLAALDRWVRDANNASFAAQAAYDEGVPAFMALFERE
FT                   GRDWPRFHAAVRALAQAPQAERTAALQALAPQPPRVAHGGG"
FT   sig_peptide     complement(460797..460880)
FT                   /locus_tag="Dtpsy_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.859 at
FT                   residue 28"
FT   gene            460928..461626
FT                   /locus_tag="Dtpsy_0448"
FT   CDS_pept        460928..461626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0448"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: methyladenine glycosylase; KEGG: ajs:Ajs_0457
FT                   DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31932"
FT                   /db_xref="GOA:B9MC12"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC12"
FT                   /inference="protein motif:PRIAM:3.2.2.20"
FT                   /protein_id="ACM31932.1"
FT                   /translation="MRPNPHNAPMLETTEPSSPDEASGLFTDEGGHARCFWCGASPLYQ
FT                   HYHDHEWGFPVTDERRLFEKLCLEGFQAGLSWITILNKREAFRAALAQFEAEPLADFGA
FT                   AEVDQLMGNAGIVRHRGKIESAINNARRVLELRREFGSLAHYVWRYAPLAAQQRPERMT
FT                   LPAVRAMTTSAASVALSKDLKKRGFSFVGPTTMYAFMQAMGLVNDHLEGCGARAAAEAA
FT                   RAAFTPPAAG"
FT   gene            complement(461696..462313)
FT                   /locus_tag="Dtpsy_0449"
FT   CDS_pept        complement(461696..462313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31933"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC13"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0458"
FT                   /protein_id="ACM31933.1"
FT                   /translation="MGGAARSPCRTIAAFPLPEGPMPQTPAPLSPEDAAALYQALRAEG
FT                   MADALTTLHIGGAHTRLLSGAADAPALLRTLDIGARVTAATCFAHQPPTEADLEHAIML
FT                   VEDAVMPVRALLAPGSTLYTADGGIRQIALAAGLPAQPELHLSLEAVEDTFNRLAALSL
FT                   GRPATQDTLAQDNAFAATLLILRECLHHLGFDHIVVRSDAVV"
FT   gene            complement(462365..462535)
FT                   /locus_tag="Dtpsy_0450"
FT   CDS_pept        complement(462365..462535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31934"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC14"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0459"
FT                   /protein_id="ACM31934.1"
FT                   /translation="MGNKIVTEADRKRTPRPTPMPGMAVTTHGRGQRVSLERGVATRSK
FT                   KNPGKRSNKGG"
FT   gene            462825..464108
FT                   /locus_tag="Dtpsy_0451"
FT   CDS_pept        462825..464108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0451"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ajs:Ajs_0460 cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31935"
FT                   /db_xref="GOA:B9MC15"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC15"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ACM31935.1"
FT                   /translation="MKLLLHSLEASLALSPVGVAVELPDGARLGDANADLRLRFRDRMA
FT                   VVALAMGEIGNVGAAIVEGRVALEGSMRQLMTAAAALLKLNPTHEGAATGWQRVLLRAR
FT                   SMAAHTLSHDARNIQFHYDLSDDFYALWLDPRRVYSCAYYRTPDMSLAQAQEAKLDHIC
FT                   RKLLLRPGDRFLDIGAGWGGLLLWAAQEYGVDATGITLSRNQHAHVQRLIEERGLQGRV
FT                   RMQLLDYRELQVEQPFDKIASVGMFEHVGRSQMERYFATVHRLLRPGGLLLNHGITSGG
FT                   LDNPRLGAGLGDFIERYIFPGGELLHVSTVLHDMARAGLEMVDTENLRPHYARTLWAWS
FT                   DALEARQDEARSVLVAQHGKERGEKALRAYRLYLAGCALAFERGWTALHQMLAVRPTGH
FT                   AEDGVLKGAQSDYPFSRAYMYEGPAAIH"
FT   gene            464129..464452
FT                   /locus_tag="Dtpsy_0452"
FT   CDS_pept        464129..464452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0452"
FT                   /product="Domain of unknown function DUF1840"
FT                   /note="PFAM: Domain of unknown function DUF1840; KEGG:
FT                   ajs:Ajs_0461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31936"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC16"
FT                   /inference="protein motif:PFAM:PF08895"
FT                   /protein_id="ACM31936.1"
FT                   /translation="MLFKFKSRATADVIMLEPNGKQLLEIIGKSPNEPHGIITAAQIPA
FT                   AIRALEEAVAVEEAAAAATAPDEDDQTEEEAPRGDGVRLRQRAAPFIDMLRRSAAEDCD
FT                   VVW"
FT   gene            complement(464490..465527)
FT                   /locus_tag="Dtpsy_0453"
FT   CDS_pept        complement(464490..465527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31937"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC17"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31937.1"
FT                   /translation="MPHTSTPRRTPPRRQALHAIGALLALGLGATGAAYAQASPWPAKP
FT                   VRIVVPFAAGGTTDILARAIAPELGKAFGQQFIVDNRGGAGGNIGAELVARSAPDGYTL
FT                   LMGTVGTHGINRALYKQLPYDPIKDFAPVTLVASVPNVMVMNTEKARSLGINTVQDFIR
FT                   YAQANPGKLNMASSGNGTSIHLAGELFKSMTGTYMLHMPYRGSAPALLDMVGGNMDVMF
FT                   DNLPSSMAHIKGGKLKALAVTSAKRSTALPDVPTVEEAGGPALKGFEASSWFGLLAPAG
FT                   TPADIVQRVQQEVAKALATPAVKERLLSQGAIPGGNTSAEFASLIDREHRKWAQVVKAS
FT                   GAKVD"
FT   sig_peptide     complement(465417..465527)
FT                   /locus_tag="Dtpsy_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.798 at
FT                   residue 37"
FT   gene            complement(465693..466682)
FT                   /locus_tag="Dtpsy_0454"
FT   CDS_pept        complement(465693..466682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31938"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC18"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31938.1"
FT                   /translation="MRTTFKIAVGAAAILAAFGASAQAYPVKDKNITIVVPFSAGGPTD
FT                   RVARDLAEALRKPLGGATVVVENAAGAGSTIGAAKVARAQPDGYTLLLNHIGMATIPTL
FT                   YRKLSFNVLNDFEFLGIVNDVPMTIISRPTLDAKNYKELATWIAQNKEKVNLGHSGLGS
FT                   AGHLCGLMFQHALQSHMTPVAYKGAAPAITDLIGGQIDLMCDQTTNTTTQIEGKKVKAF
FT                   AVTTNQRLTMPSLKDLPTLQESGLKDFNVSVWHGLYAPKGTPAAVLTRINEALQVAVKD
FT                   PDFIKKQEGLGAVVVADKRVLPAEHKKFVQSEIEKWGMVIKAAGTYAD"
FT   sig_peptide     complement(466608..466682)
FT                   /locus_tag="Dtpsy_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.603 at
FT                   residue 25"
FT   gene            complement(466874..468121)
FT                   /locus_tag="Dtpsy_0455"
FT   CDS_pept        complement(466874..468121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0455"
FT                   /product="putative phenylacetate-CoA ligase"
FT                   /note="KEGG: ajs:Ajs_0464 putative phenylacetate-CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31939"
FT                   /db_xref="GOA:B9MC19"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC19"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0464"
FT                   /protein_id="ACM31939.1"
FT                   /translation="MSMFYDALETRAPAEREAALMAALPRQIAHAQQASPAFAGILAGV
FT                   DATTITDRAALARLPVTRKYELLERQQAQRGQNAFGGFSALGFGRHMPRVFASPGTIYE
FT                   PEGARPDYWRMARAMYAAGFRPGELIHNSFSYHFVPAGSMMETGAHALGCTVFPGGTGQ
FT                   TEQQVQAMAELRPAGYIGTPSFLKIILDKAHEHGVALPSVTKALVSGEAFPPSLRDWLA
FT                   ARGVTGYQCYATADLGLIAYETSAREGLVLDEGVIVEIVRPGTGDPVPEGEVGELVITT
FT                   LNPDYPLIRFGTGDLSAVLPGQCPTGRTNTRIKGWMGRADQTTKVRGMFVHPGQIASVV
FT                   KRFPQVQRARLVVSGEMANDQMVLQVETTETAAGMAQQLAEALREVTKLRGDVQMVPPG
FT                   SLPNDGKVIEDARSYR"
FT   gene            complement(468214..469023)
FT                   /locus_tag="Dtpsy_0456"
FT   CDS_pept        complement(468214..469023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0456"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ajs:Ajs_0465 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31940"
FT                   /db_xref="GOA:B9MC20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC20"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACM31940.1"
FT                   /translation="MESRNIVLSVNGIEVIYNHVILVLKGVSLQLPEKGIVALLGGNGA
FT                   GKTTTLRAISNLLKGERGEVTKGSIELRGEQIQNLSPADLVKRGVVQVMEGRHCFAHLT
FT                   IEENLLTGSYTRTDKGEIAANLEKVYNYFPRLKTRRTSQAAYTSGGEQQMCAIGRAIMS
FT                   NPNIVLLDEPSMGLAPQIVEEVFNIVKDLNAKEGTTFLLAEQNTNMALKYADYGYIMES
FT                   GRIVMDGAAQDLASNEDVKEFYLGVGGGERKSFKDVKSYKRRKRWLA"
FT   gene            complement(469220..470545)
FT                   /locus_tag="Dtpsy_0457"
FT   CDS_pept        complement(469220..470545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31941"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC21"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0466"
FT                   /protein_id="ACM31941.1"
FT                   /translation="MKFTRLAAAATVACTLAGFAGGAAAQAKEQFFPLLSYRTGPYAPN
FT                   GVPWANGKQDYIKMINARDGGVNGVKLTWEECETGYATDRGVECYERLKSRPGVTLFDP
FT                   QATGITFALTEKAPVDKIPLMTLGYGLSVAQDGMAFKWNFPYMGSYWTGADILIQHIGK
FT                   NAGGLDKLKGKKIALVYHDSPFGKEPIPLLQERSKMHGFELQMLPVTAPGVEQKATWLQ
FT                   VRQSRPDYVLLWGWGVMNSTALKEAQATGYPRDKMYGVWWAGAEPDVRDVGDGAKGYHA
FT                   LALNGHGTQSKVMQDILKHVHGANQGTGPKDEVGSVLYTRGVIIQMLGVEAVRRAQERF
FT                   GKGKVMTGEQVRWGMENLALDQKKLDALGFTDLMRPLSTSCADHMGSTWARVHTWDGKQ
FT                   WKFSSDWYQADEQVIKPMVKAGADKYLADKKMSRREAGDCQS"
FT   sig_peptide     complement(470462..470545)
FT                   /locus_tag="Dtpsy_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.573 at
FT                   residue 28"
FT   gene            complement(470622..471698)
FT                   /locus_tag="Dtpsy_0458"
FT   CDS_pept        complement(470622..471698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0458"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ajs:Ajs_0467 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31942"
FT                   /db_xref="GOA:B9MC22"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC22"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACM31942.1"
FT                   /translation="MFYRENGQFKTTYKADQQIFPITQDRIAILLLLAVAFVAVPAMAS
FT                   DYFYRAILIPLVIMSMAALGVNILVGYCGQISLGSGAFMAVGAYGAFNFFVRFPGMPLV
FT                   PALILGGLCATFFGILFGLPSLRVKGLYLAVATLAAQFFSDWMFLRIKWFTNNSDSGSV
FT                   SVSNLQVFGMPLDSAMAKYLFCLTLLVVVALLAKNLVRGAIGREWMAIRDMDVAAAVIG
FT                   IRPMYAKLSAFAVSSFIVGMAGALWAFVHLGSWEPAAFSVEVSFRLLFMVIIGGMGSIM
FT                   GAFFGAAFIVVLPIFLNQFLPAVAGLFGVDISTAAVSHAELMIFGALIVWFLIVEPHGL
FT                   AKLWSIGKQKMRVWPFPH"
FT   sig_peptide     complement(471564..471698)
FT                   /locus_tag="Dtpsy_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.991 at
FT                   residue 45"
FT   gene            complement(471817..472746)
FT                   /locus_tag="Dtpsy_0459"
FT   CDS_pept        complement(471817..472746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0459"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ajs:Ajs_0468 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31943"
FT                   /db_xref="GOA:B9MC23"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC23"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACM31943.1"
FT                   /translation="MAFFLETLIGGLMAGMLYALVALGFVLIFKASGVFNFAQGAMVLF
FT                   AALAMARFAEWIPEWTGISNPIVANLAAFLIAGLCMFAVAWFIERLVLRHLVNQEGATL
FT                   LMATLGITYFLEGLGQTFFGSDIYKIDIGMPKDPVFLLDTVFEGGVLVNKEDVIAAGIA
FT                   AALVVVLSIFFQKTKTGRALRAVADDHQAAQSIGIPLNHIWVIVWCVAGVVALVAGMIW
FT                   GSKLGVQFSLTTVALRALPVVILGGLTSVPGAIIGGLIIGVGEKLSEVYLGPFVGGGIE
FT                   IWFAYVLALVFLLFRPQGLFGEKIIDRV"
FT   sig_peptide     complement(472672..472746)
FT                   /locus_tag="Dtpsy_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.724) with cleavage site probability 0.577 at
FT                   residue 25"
FT   gene            complement(472757..473542)
FT                   /locus_tag="Dtpsy_0460"
FT   CDS_pept        complement(472757..473542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0460"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ajs:Ajs_0469 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31944"
FT                   /db_xref="GOA:B9MC24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC24"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACM31944.1"
FT                   /translation="MTSKKIGDVILDVKNISLRFGGVKALTDISFNVREHEIRSIIGPN
FT                   GAGKSSMLNCINGVYTPSEGSITFRGQTFGHMNSRQVAEMGIARTFQNLALFKGMSVID
FT                   NIMTGRNLKIKSNLLLQALRIGPAEREEIAHRETVEHIIDFLEIQAHRKTPVGQLPYGL
FT                   QKRVDLGRALAMEPQVLLLDEPMAGMNVEEKQDMCRFILDVNDEFGTTIVLIEHDMGVV
FT                   MDISDRVVVLDYGKKIGDGAPDEVRNNEDVIRAYLGTSH"
FT   gene            complement(473565..475499)
FT                   /locus_tag="Dtpsy_0461"
FT   CDS_pept        complement(473565..475499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0461"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0470 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31945"
FT                   /db_xref="GOA:B9MC25"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC25"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACM31945.1"
FT                   /translation="MKTTFPHLLLQHAAQRPDAAALREKEYGIWQTWSWKDAAAEVRHM
FT                   ACGLLSLGFAKGQNLALISDNRPHLYMGFVAVQSVGGVPIPLYQDAVAAEMTFVIQDAE
FT                   IAFAFAENQEQVDKLLEVRESVSGIQHIIYDDPRGLRHYDQPGLISTAQLVARGAEWDK
FT                   AHPGAWDALVEQIDPQDVSVILYTSGTTGKPKGVCQTHASFIASAQGAVEVDRLGPQDN
FT                   VISYLPPAWVGDHLFSLAQWMVAGFTINCPESASTVSIDLREIGPTYYFAPPRVFEGML
FT                   TSVSIRMEDAAAPKRWLFEKCMQLARRVGSDLLDGKPVGAIDRLKYRLADLAIYGPLRN
FT                   VMGLSRIRVAYTAGAAIGPDLFRFFRSIGINLKQLYGQTETCAYVCLQRDGQVDLNTVG
FT                   QAAPGIELKIADNGEVLVKGVSVLKEYYKRPDATAEVIDAEGYFHTGDAGVIDANGQLR
FT                   IIDRAKDVGKTASGAMFAPNYIENKLKFFPHIKEAVCFGNQRDQVCAFINIDYEAVGNW
FT                   AERQGIPYGGYVDLASKPRVIELIADCISQVNADLAAEAGMADTQVARFLVLHKELDPD
FT                   DDELTRTRKVRRNFIAEKYGVLVDALYTGKAEQFIETQVKFEDGRKGSVSATLKITDAK
FT                   TFPATRAAA"
FT   gene            475712..477445
FT                   /locus_tag="Dtpsy_0462"
FT   CDS_pept        475712..477445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0462"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; SMART:
FT                   AAA ATPase; KEGG: ajs:Ajs_0471 peptidoglycan binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31946"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC26"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACM31946.1"
FT                   /translation="MLAAMYAPFFGLEHPPFSIAPDPRYLFMSERHREALAHLLYGLDA
FT                   GGGFVLLTGEIGTGKTTVCRCFLEQIPPQCNVAYIFNPKLTVPELLRSICDEFGVAHRP
FT                   AIPGAETVKDCLDPLNDFLLQQHAAGRNNVLIIDEAQNLAPDVLEQLRLLTNLETSERK
FT                   LLQIILIGQPELRAMVAAPELEQLAQRVIARYHLDALSADETRQYIAHRMAVAGLQGPL
FT                   PFQQRALARVHALTGGVPRRINLLCDRALLGAYGAGVREVTDAMVRRAAREVFDAPATA
FT                   RPRPGSAGRWLAAGTGGLVGAAALGGLAWALGWWPLADGGAGSTQAQTQTQRPAIAASA
FT                   AAVPASSPASAASAPDAPAPPAPPPTLAQFLAIQPVAQAPAAWQALARQWQASVSDGAA
FT                   DPCAALASEGLRCYRSRRASLNLLRQLDRPVLLMLRPAEGDAQGEALAPEVAVLLRRLD
FT                   DGTATLEGVQGQTLQVRVTELAPLWRGEVATLWKAPAELADSGDVTATAAGAAWLDQQL
FT                   AAAGAGAAAARTATPAARRARIHQFQLGQGLTPDGRAGPLTLMLLNRAAGVPEPRLLSG
FT                   A"
FT   gene            477450..478260
FT                   /pseudo
FT                   /locus_tag="Dtpsy_0463"
FT   gene            478407..479225
FT                   /locus_tag="Dtpsy_0464"
FT   CDS_pept        478407..479225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0464"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: cyclic
FT                   nucleotide-binding; regulatory protein Crp; KEGG:
FT                   ajs:Ajs_0473 Crp/FNR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31947"
FT                   /db_xref="GOA:B9MC27"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC27"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACM31947.1"
FT                   /translation="MLARMSQDASLHQRRRPPTAQELSGIPWMALLQPAERERAVAALA
FT                   VGDAQPGDYVCRVGRPVTYWFGVVEGLLKMSADNADGLTMTFTGVPPGGWFGEGTAVKR
FT                   EPYRYNIQALRKSVVAGLPIDTFHWLLDHSIGFNRFVMNQLNERLAQFIAAREIDRLTN
FT                   PDLRVARSLAALFNPVLYPGVGEVLRITQQELAYLVGLSRQRVNEALATLEAQGAIRVE
FT                   YGGLRVLDLQALRTSLFRRMEPADADRPGPRRRASPRRAPADENEPAAMI"
FT   gene            479561..480307
FT                   /locus_tag="Dtpsy_0465"
FT   CDS_pept        479561..480307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0465"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; SMART: RNA-binding S4 domain protein; KEGG:
FT                   ajs:Ajs_0474 RNA-binding S4 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31948"
FT                   /db_xref="GOA:B9MC28"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC28"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACM31948.1"
FT                   /translation="MRLNKRMADLRLCSRREADDWIAQGWVRVNGQVAAMGLQVGPHDR
FT                   IDVDRAAQGHQRQQVTILLHKPMGYVSGQAEDGHTPAVALINPRTHWKDDESRTRFAPA
FT                   QLKGLAPCGRLDIDSVGLLVLTQDGRVARQLIGEDSTVDKEYLVRVQYGDRAQDVRAVF
FT                   PADKLALLNHGLALDGQQLKPALVEWQNPEQLRFVLREGKKRQIRRMCELVGLKVVGLK
FT                   RIRIGQVLLGKLPPGQWRYLAPGERF"
FT   gene            480654..482606
FT                   /locus_tag="Dtpsy_0466"
FT   CDS_pept        480654..482606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0466"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; KEGG: ajs:Ajs_0475 heat shock protein 90"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31949"
FT                   /db_xref="GOA:B9MC29"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC29"
FT                   /inference="protein motif:PFAM:PF00183"
FT                   /protein_id="ACM31949.1"
FT                   /translation="MSKHTHSFQAEVAQLLHLVTHSLYSNKEIFLRELVSNASDACDKL
FT                   RFEALNNAALYEDAPNLEVRVSFDKEARTLTITDNGIGMSEQEAIDHLGTIAKSGTRDF
FT                   MNRLSGDQKADAQLIGQFGVGFYSGFIVADRITVESRRAGLPASEGVRWASGGAGDFEV
FT                   EAIERAARGTSVILHLREDAEEFLNAWKIKQVIGKYSDHISLPILMEKEEWKESEKEGE
FT                   PGQMVKTGEWETVNKASALWTRPKKDITDEQYQDFYKSISHDFENPLTWSHNRVEGNTE
FT                   YTQLLYIPAKAPFDLWNRDKKAGVKLYVKRVFIMDDAESLMPSYLRFVKGVIDSADLPL
FT                   NVSRELLQESRDVRLIRDGSVKRVLSMLEDLAKHDKHEAAAEGADGVQDVVSAEDKAKE
FT                   GKYTQFYAEFGAVLKEGLGEDFANRERLAKLLRFASTTSDTPSVSFADYKARMKEGQEA
FT                   IYYITADTLAAAKNSPQLEVFKKKGIEVLLMTDRVDEWALNYLQDFDGTPLQSVAKGAV
FT                   DLGKLQDEAEKKAAEEAAEAFKPVLAKLKEALKDKAEDVRVTTRLVDSPACLVVQDGGM
FT                   STQLARLLKQAGQSAPDAKPVLEVNPEHALVKKLDGSVHFHDLAHILFDQALLAEGGLP
FT                   EDPAAYVKRVNALLA"
FT   gene            482765..483802
FT                   /locus_tag="Dtpsy_0467"
FT   CDS_pept        482765..483802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31950"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC30"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM31950.1"
FT                   /translation="MVNIETCVPIRKGCDMGIKTSLVFSALVWGCSGLALAQNAAAPQD
FT                   YPRRPITMVIPAAAGGGTDVVGRVLADELGKRLGQPVVVDNKSGASGMLGANAVARAAP
FT                   DGYTVLVSYSTPVFYAHHMFSKVPYDIRKDFEFITQIAATSLVLMVNANVPVKNMKEFM
FT                   AWAQQNKGKINYGSYGTGSPGHLMSAYLSDSRKLEMTHVAYKSEAPHIQDLSAGVVSWG
FT                   MGTLAAAQPQIKAERLRPLAILGPRRLADLPDVPTMAEAGFPDPEFKTIAWFTMLAPAG
FT                   TPKPILARLEKEAVQIIHSTAMKARLQVFGLEGVEGGAAQFRKDFEASNPIIDKLVKIS
FT                   GAKQD"
FT   sig_peptide     482765..482878
FT                   /locus_tag="Dtpsy_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.739) with cleavage site probability 0.709 at
FT                   residue 38"
FT   gene            483950..484462
FT                   /locus_tag="Dtpsy_0468"
FT   CDS_pept        483950..484462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31951"
FT                   /db_xref="GOA:B9MC31"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="InterPro:IPR026441"
FT                   /db_xref="UniProtKB/TrEMBL:B9MC31"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0477"
FT                   /protein_id="ACM31951.1"
FT                   /translation="MPWTALLARICAGLVTWFDTTAAAQGKVLWNTLTGFGVSIEPGCN
FT                   GIEACIVLFAAVIAFPSSLRHKLFGLVAGFAAVQALNVVRVISLFYLGQWNTAVFNFAH
FT                   EFLWQGLIMLDVLIVWLLWVRAGAKAQPPQDTPPPDEPPAPPMPLVMPRLDKGQGQVST
FT                   SLDLSPR"
FT   sig_peptide     483950..484030
FT                   /locus_tag="Dtpsy_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.643) with cleavage site probability 0.273 at
FT                   residue 27"
FT   gene            484488..485159
FT                   /locus_tag="Dtpsy_0469"
FT   CDS_pept        484488..485159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31952"
FT                   /db_xref="GOA:B9MCF2"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACM31952.1"
FT                   /translation="MTKPVQSEAPARRPSVLTRFVLYAFGAMIVLTLLWTKASPWLSYP
FT                   VAWLSHVALEQAAPMWVRGVHQQLGRMEVDTAVEIAVPNSGGRRAEVTLEADPGRYAYG
FT                   LPIFAALLVAAWGAARAPGRASRAALGYVLLLPAQAFSLVMYLLMQLAGAAQFDVRVLR
FT                   VDQWQLEAIVYGYQVGVLVLPTLVPVLVWLWLDRQFFTNVIVRGWKQSLAASPAPQRSA
FT                   G"
FT   gene            complement(485166..486206)
FT                   /locus_tag="Dtpsy_0470"
FT   CDS_pept        complement(485166..486206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0470"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   ajs:Ajs_0479 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31953"
FT                   /db_xref="GOA:B9MCF3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCF3"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACM31953.1"
FT                   /translation="MTAPHTDDTLHPYASLTPDLVLDALASVGLYGDGRLMALGSYENR
FT                   VYQATLEDGSRVVAKFYRPGRWSEAQILEEHAFSQELADAEVPVVAPLLLHGRSLHRHA
FT                   GFDFAVSPWRGGRTPELDDFEVLEWLGRYLARIHNVGAARPFAQRPALDLQTLGQEPRD
FT                   WLLGAQIIPLDQQTEWRDACEQALELIAAGACLSGATGQFGLKDASNIRLHGDCHPGNV
FT                   LWTPVDDAGHGGPHFVDLDDARMGPAVQDLWMLLSGERRQRTVQLSALLDGYEQLRPFD
FT                   RRELALIEPLRTLRLIHYSAWLARRWSDPIFPINFPWFGSSDYWRGQVDMLHEQIEAMQ
FT                   EPPLVA"
FT   gene            complement(486242..487681)
FT                   /locus_tag="Dtpsy_0471"
FT   CDS_pept        complement(486242..487681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0471"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; aminoglycoside
FT                   phosphotransferase; UspA domain protein; Serine/threonine
FT                   protein kinase-related; SMART: tyrosine protein kinase;
FT                   serine/threonine protein kinase; KEGG: ajs:Ajs_0480
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31954"
FT                   /db_xref="GOA:B9MCF4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCF4"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACM31954.1"
FT                   /translation="MKLLTPGTEIDGFVVHECIHAGGMAHIYRVGYANASRDPGFPMAM
FT                   KIPRMTAGDGAENIVGFEVELTILPTLSGHHAPRFVAAGDLMRLPYLVMEYVQGDTLQH
FT                   WLDDRPPGDTAARSAETIARIGGAMALAAHSIHQQNVCHLDLKPANVLLRPDGSVVLLD
FT                   FGLSCHAHYPDLLAEEMRQAVGSPTWIAPEQVVGVRGDLRSDIFAIGVMLYEMATGELP
FT                   FGSPTTQGGMRQRLWMTPAPPRQYRPDLPEWLQEVILRCLEPEAAQRYPSAAHLAFDLA
FT                   NPDQVPITERGRRLRGPGVGAHFKRWIKAAGMHYQPSPLPARQIAEVPILMVAVPHDDV
FT                   TDATLYSLREAVARSLGIRPGARLACVTVISPSASSTSDSTRSETMLHRTHLARLKQWA
FT                   AGLDLSRHSASYHVLEASDVAQALVRYAEGNRVSMMILGAATHGLQLQRFIDTVPIRVA
FT                   RDAPCTVILVKQQLPFDALGQ"
FT   gene            complement(487724..488482)
FT                   /locus_tag="Dtpsy_0472"
FT   CDS_pept        complement(487724..488482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0472"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ajs:Ajs_0481
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31955"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCF5"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACM31955.1"
FT                   /translation="MKIALLSDIHANLPAFDACLEHARAHGAQQFALLGDLVGYGADPG
FT                   PVLDRAMQLAAAGALCVRGNHDAAALAPPAVAQNLGDQSAQWTHPHLDERQRAFLAGLP
FT                   LTERLGPDALLVHASADGPERWHYITDSNAAERCMTAATRIDPAIRYVFCGHVHEQALY
FT                   FLTPTAKLMRFSPQPGVPVPVPPHRQWLAIAGSCGQPRDGDTRAMYALFDPDAATITFQ
FT                   RVAYNHAAAAAAVRASGLPTFFADRLERGR"
FT   gene            complement(488613..489029)
FT                   /locus_tag="Dtpsy_0473"
FT   CDS_pept        complement(488613..489029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0473"
FT                   /product="OsmC family protein"
FT                   /note="TIGRFAM: OsmC family protein; PFAM: OsmC family
FT                   protein; KEGG: ajs:Ajs_0482 OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31956"
FT                   /db_xref="GOA:B9MCF6"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCF6"
FT                   /inference="protein motif:TFAM:TIGR03561"
FT                   /protein_id="ACM31956.1"
FT                   /translation="MTTLDKVLYTARAHTTGGRDGASRSDDGRLQVQLSSPGGSGTGTN
FT                   PEQLFAAGYSACFIGAIKAVAAKQKLTLPQDLAIDAEVDLGTIPNAYGIAARLKVHLPG
FT                   MDRAQAQQLVNDAHQVCPYSNATRGNIDVTLTLA"
FT   gene            complement(489091..489558)
FT                   /locus_tag="Dtpsy_0474"
FT   CDS_pept        complement(489091..489558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0474"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: ajs:Ajs_0483 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31957"
FT                   /db_xref="GOA:B9MCF7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCF7"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACM31957.1"
FT                   /translation="MPSPNTVTPPSPPELLLDNQLCFALYSASLAMTKLYKPLLDTLGL
FT                   TYPQYLVMLALWERDGLTVSELGERLFLDSGTLTPLLKRLESAGLLARLRDVQDERRVR
FT                   ITLTGQGRALRDGAQPIPHCVLARAQCTPADIGALTAQLHGLRDRLAQPQA"
FT   gene            complement(489867..490667)
FT                   /locus_tag="Dtpsy_0475"
FT   CDS_pept        complement(489867..490667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0475"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: ajs:Ajs_3719
FT                   2-dehydro-3-deoxyglucarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31958"
FT                   /db_xref="GOA:B9MCF8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCF8"
FT                   /inference="protein motif:PRIAM:4.1.2.20"
FT                   /protein_id="ACM31958.1"
FT                   /translation="MPVRNPFKHALAGGQAQIGIWSTLPSPLVTELIAGSGFDWVLLDT
FT                   EHTPSDVPLMVQQLQAVAAGCRDHTHGVVRPAWNDPVLIKRYLDIGAQTLLLPFVQNAD
FT                   EARAAVAAMRYAPRGIRGMGGSMRASDFGRDAAYVRDAENELCLLVQVETAEALEQIEA
FT                   IAAVEGVDGIFIGPADLSASMGFPGDANHPTVRAAIDDAIRRIRAAGKAPGILVVDEAR
FT                   ARECLALGAQFVAVGMDMLLLRQAADGLAARFRPGARGPVTTAY"
FT   gene            complement(490688..491536)
FT                   /locus_tag="Dtpsy_0476"
FT   CDS_pept        complement(490688..491536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0476"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   ajs:Ajs_3718 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31959"
FT                   /db_xref="GOA:B9MCF9"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCF9"
FT                   /inference="protein motif:PRIAM:1.1.1.157"
FT                   /protein_id="ACM31959.1"
FT                   /translation="MTISTVGIIGAGTMGNGIAQACAVSGINVVMVDISDAAVQKGVAT
FT                   VAGSLDRLIKKEKITEADKSAALARIKTSTSYDDLKAAQIVIEAATENYELKLKILKQA
FT                   DALVAPEVIIASNTSSISITKLAAATSRADRFIGMHFFNPVPMMALVEIIRGLQTSDAT
FT                   HDAVKQLSERLGKSPITVKNAPGFVVNRILVPMINEAFFVLAEGLATPEDIDAGMKLGC
FT                   NQPIGPLALADMIGLDVCLAVMDVYLTEFGDSKYRPCPLLKEMVAAGRLGRKTGRGVYQ
FT                   Y"
FT   sig_peptide     complement(491471..491536)
FT                   /locus_tag="Dtpsy_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.914 at
FT                   residue 22"
FT   gene            491649..493244
FT                   /locus_tag="Dtpsy_0477"
FT   CDS_pept        491649..493244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0477"
FT                   /product="Choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: ajs:Ajs_3717 glucose-methanol-choline
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31960"
FT                   /db_xref="GOA:B9MCG0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCG0"
FT                   /inference="protein motif:PRIAM:1.1.99.1"
FT                   /protein_id="ACM31960.1"
FT                   /translation="MREFDYVVIGGGSAGCVLAGRLSEDPTVRVCLLEAGGSDASVLIH
FT                   CPAGLAAMARSGAFNWGLHTTPQAGLGGRRGYQPRGKVLGGSSSVNAMIYARGHASDYD
FT                   HWAAAGNAGWGWNDVLPYFLRAEHNERGASAWHGADGPLNVADLQSPQRASRAFVEAGV
FT                   QAGHPRNDDFNGAQLEGVGLYQVTHRAGERFSVAKAYLTPHLGRTNLQVVTGAQATRIL
FT                   FAGRRATGVEYRRGGQTQQVRATREVLLSAGALLSPQLLMLSGVGPGAQLQSHGIGVVH
FT                   DLPGVGAHLHDHPDVVQVMDAPRLTDLFGLSLPGALNVLRGVREWRAHRSGMLTTNFAE
FT                   AGGFIKSRPEEPLPDLQLHFVVGKLLDHGRRATWGHGYSCHVCLLQPRSRGRVTLASAD
FT                   PAAAPLVDPAFFSDPDDMQRMVRGVRRMREILAQPALASLGARELPHSSRAQSDAQIEQ
FT                   FIRDWADTIYHPVGTCRMGCGPLDVVDAQLRVHGLQALRVVDASIMPRIVSGNTNAPTV
FT                   MIAERAVDLLRQAA"
FT   gene            493419..494138
FT                   /locus_tag="Dtpsy_0478"
FT   CDS_pept        493419..494138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3716 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31961"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCG1"
FT                   /inference="similar to AA sequence:KEGG:Ajs_3716"
FT                   /protein_id="ACM31961.1"
FT                   /translation="MQFNPQEITALAQADAAAPRMDIYAFIHKALRAYMFDTLLGLGRV
FT                   DAEDDLELSQAGARVLQLLSFCRSHLHHENTFVHPAMERHAPGSTAAVEQEHDGHGQAI
FT                   AALADAAQQLMQCPRERRARVAHALYQQLALFVAHNFEHMQLEETAHNAVLWAHYSDAE
FT                   LAAIEGALIASIPADEMLVTLRWMLPSMTPSERAMVLGDMRRNAPPGIFDTALSVMRPH
FT                   LSNGEWGKLARALELAR"
FT   gene            494135..494569
FT                   /locus_tag="Dtpsy_0479"
FT   CDS_pept        494135..494569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31962"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCG2"
FT                   /inference="similar to AA sequence:KEGG:Ajs_3715"
FT                   /protein_id="ACM31962.1"
FT                   /translation="MSHGLLRRHTLAAFWLCMASASTLAAGPPPPERFRLTPQLLERME
FT                   ALQAASPEAARPGDDDEPDAQSVQELARQLDADPRIRALLARHRVSSIEYATAVYAALH
FT                   AGMFLAMESLTDKASRTSALASFTPEQRANIELLRRRPIK"
FT   sig_peptide     494135..494212
FT                   /locus_tag="Dtpsy_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.891 at
FT                   residue 26"
FT   gene            complement(494589..495935)
FT                   /locus_tag="Dtpsy_0480"
FT   CDS_pept        complement(494589..495935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0480"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="PFAM: GAF domain protein; pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding; SMART: GAF domain protein;
FT                   KEGG: ajs:Ajs_3714 putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31963"
FT                   /db_xref="GOA:B9MCG3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCG3"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACM31963.1"
FT                   /translation="MNVPPTLRSIRACLEGAIPAIMATCAPDGTPNVAYISQVVYVDEQ
FT                   HVALSFQFFNKTRANILANPYASVLVLDPVTARCFRLHLRFLRTEAEGALFERMRAQLA
FT                   GIASHNGMAGVFELKGSDVYAVERIEPVPGEGLAPSPAQLPRADLLGAVRLCSQRLARC
FT                   TTLDELLQTLLAGLHQHLHVQHAMVLMLDAQAGHLYTVASHGYTHSGVGSEIKLGQGVI
FT                   GVAAREATPVRISHMTHAALYSHAMRSSLGQSAPAHEIPYPGLPTPHSQLAVPLLSCGR
FT                   TLGVLFVESPLDLQFRYPEEDALVALAGQLATAIDLLQSADEATEASQEAAPAPAPRGA
FT                   PVRVRHFAVNDSVFVDDTYLIKGVAGAILWKLLRDHERTGRQDFSNRELRLDPSLRLPG
FT                   VADNLEARLLLLQRRLQESDTGIHIDKTGRGRLRLRLDAPVQLEEMAGS"
FT   gene            complement(495932..496423)
FT                   /locus_tag="Dtpsy_0481"
FT   CDS_pept        complement(495932..496423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31964"
FT                   /db_xref="GOA:B9MCG4"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCG4"
FT                   /inference="similar to AA sequence:KEGG:Bpro_0631"
FT                   /protein_id="ACM31964.1"
FT                   /translation="MPTLLSAEYIALVDRGVSSIVASRDTQLRPSVMRAVGARISTNGQ
FT                   RITVFLRRSQSRQLLADIATTGHIAVVFSDPPSHRTVQVKATAAVQRAVLPADEPALQS
FT                   YLSAMQHAVAQVGYGPQYTAAMLNAPRDDLVAVEFSPEAAFDQTPGPHAGEPLRKERQP
FT                   "
FT   gene            complement(496435..497244)
FT                   /locus_tag="Dtpsy_0482"
FT   CDS_pept        complement(496435..497244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0482"
FT                   /product="ABC-2 type transporter, NodJ family"
FT                   /note="TIGRFAM: ABC-2 type transporter, NodJ family; PFAM:
FT                   ABC-2 type transporter; KEGG: ajs:Ajs_3712 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31965"
FT                   /db_xref="GOA:B9MCG5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR005981"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCG5"
FT                   /inference="protein motif:TFAM:TIGR01291"
FT                   /protein_id="ACM31965.1"
FT                   /translation="MPTPTTPSPWRAPDLSTRWWPVFLRNLLVWRKLAVPSLLGNIAEP
FT                   LMWLVAFGYGMGALVGQVQVGGQNVPYILFLASGSICMSAMNAASFEALYSAFSRMHVQ
FT                   KTWDGIMNAPISLDSVLLAEMLWAAFKALFTTTAILGVMLALGISYSPKLIVAWPVLLC
FT                   VGIMFSSIALIFNALAKGYDFFTYYFTLVLTPMMFLSGVFFPREQLPTAIRLASDWLPL
FT                   TNAVELVRPLFMDQWPQHPLRHGLVIAVTTVAAYWVALALTRKRFRA"
FT   gene            complement(497246..498117)
FT                   /pseudo
FT                   /locus_tag="Dtpsy_0483"
FT   gene            498287..499546
FT                   /locus_tag="Dtpsy_0484"
FT   CDS_pept        498287..499546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31966"
FT                   /db_xref="GOA:B9MCG6"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCG6"
FT                   /inference="similar to AA sequence:KEGG:Ajs_3710"
FT                   /protein_id="ACM31966.1"
FT                   /translation="MDTMDTTGFQDTLAVLAGALGSGLLMGIERERRKGQGPLRALAGV
FT                   RSFTLAAVSGATAALLGSEALVAVGAVFIALLGVVAYARDRSEDPGVTTEIALLLAYLI
FT                   GVLCTQSLPVAAGLAVAVTSLLAAREALHEFSREWLRQGEVRGGLILAALALLVLPLAP
FT                   NQPLWGEALNPQVLVRLVVVLLVIQALAHLARRLMDARRANALSALASGFISSTATIAS
FT                   LGVAVREGREPVRAQGGAAVLSCVATMAQILVVAATVQPQWLVRLWAPALAGGVVALVW
FT                   GVALLRSMPAGEAPAPADVDGTALFKLRDALLIAALLTAVQVLVQALRGWWGDAGLLAG
FT                   ALVAALADVHAAAAAIMSQGRPLDPVGPSLVSALAAGLSVHAVSKCVTALVSGGWRYAV
FT                   AAGGGVVLHTLAFVAVLLLL"
FT   gene            complement(499619..501100)
FT                   /locus_tag="Dtpsy_0485"
FT   CDS_pept        complement(499619..501100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0485"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="KEGG: ajs:Ajs_3709 AMP nucleosidase; TIGRFAM: AMP
FT                   nucleosidase; PFAM: purine or other phosphorylase family 1;
FT                   AMP nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31967"
FT                   /db_xref="GOA:B9MCG7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCG7"
FT                   /inference="protein motif:TFAM:TIGR01717"
FT                   /protein_id="ACM31967.1"
FT                   /translation="MAQIPALPDPTFHATETEALAQVQRIYQQQIDHLRSAMQRFVAGE
FT                   TPAAPVRAFYPFVRVQTSTVARAPTHLAYGFVEGPGRYETTLTRPDLFADYYTEQLRLL
FT                   RASHNVELEVGVSNQPIPIHFSFAEHDHIEGTLSPERRMLMRDVFDLPDLEAMDDGIAN
FT                   GTWSPRAGEAQPLSLFTAPRVDYSLHRLRHYTGTQPEWFQNFVLFTNYQFYIDEFVRLG
FT                   HAEMAKPDSEYIAFIEPGNVVTRRTGLPAQVGDDLGVAPARLPQMPAYHLVRADRSGIT
FT                   MVNIGVGPSNAKTITDHIAVLRPHAWMMLGHCAGLRNSQQLGDYVLAHAYVREDHVLDE
FT                   ELPLWVPIPALAEIQMALQQAVADVTQMPQDQLKRIMRTGTVASTDNRNWELLPDNMPQ
FT                   RRFSQSRAVALDMESATIAANGFRFRVPYGTLLCVSDKPLHGEIKLPGMANHFYRERVD
FT                   QHLRIGMRAIDILRAGGVHRLHSRKLRSFAEVAFQ"
FT   gene            complement(501178..503268)
FT                   /locus_tag="Dtpsy_0486"
FT   CDS_pept        complement(501178..503268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0486"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: ajs:Ajs_3708 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; GGDEF domain
FT                   containing protein; EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31968"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCG8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACM31968.1"
FT                   /translation="MPSPRPPASPPLPDLGPRASDALLRLIADSVPVMLAYYESTSLRC
FT                   VFANQRYAAFSGQTVQSIIGKTVREAIGEKAWQEILPYVQRALAGESVQYTREYAGPQG
FT                   RAHMLEISLQPHFGVREGRNAMVGAFVLINDITHHWEAERAVRQSEERMRKFAIATEEG
FT                   LAFHRDGRILDANEALQRMVGYSLAELVGQSIFDFALPEYRALAVEYTRRGSEKPYELA
FT                   MRHKDGRVIPIEVVGKTMPQQEGDYRVVVVRDITARKQAQEQARFLVLHDTLTQLPNRR
FT                   HLMMQLARMASAAQERQTRAAVLFIDLDHFKTVNESLGNQAGDQLLIEIARRLQDGVKA
FT                   TDFVARVGGDQFIVLLPDLANRAAAAEVADALLARVRAEFAIGGTPLSLSPSIGISVFP
FT                   DDGYSPDELLRRADAAMHHTKESGRGTRMFYEPGMEGQPTELLQQEHLLREAVFQGAFA
FT                   LHYQPQVRVADGRLVGFEALVRWRHPVRGLVGPDEFIPLAESRGLITPIGRWVLHEACR
FT                   QLKAWHDEGLPRVPVAVNLSAIEFRQRDVVGEIAQVLQSAGLAPQYLEVEITESALMQQ
FT                   ADHTRTTLQALQALGVAVTVDDFGTGYSSLAYLKRYPLDKIKVDRSFVTDTPADSEDVA
FT                   IVTAIIQLAHSLQLQPVAEGVETAEQLALLRRLGCELAQGFGIAPPMDAQRAREWLRAQ
FT                   AE"
FT   gene            503400..504359
FT                   /locus_tag="Dtpsy_0487"
FT   CDS_pept        503400..504359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0487"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   ajs:Ajs_3707 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31969"
FT                   /db_xref="GOA:B9MCG9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCG9"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACM31969.1"
FT                   /translation="MPSAPSGPLSVPAWMTPHNLLRASVGVALLTIVLKTLAWWVSGSV
FT                   GLLSDALESFVNLAGAMFALAMVTIARRPADEDHPYGHHKAEYFSSGFEGILIVGASIA
FT                   ILWAAVLRLMHPQPLEQLGWGMGLSLLSTACNGLLAWGMLRAAQVHRSLALEGDARHLM
FT                   TDVWTSIGVVGGLLAAGATGWLWLDPLVAIAVALNILREGGALIWRASQGLMDEAMEPG
FT                   LLARVFTVLGEHNHASAGVVYFDSLTSRRAGARNYVDLHMHVPAHWTLGHAAEQRTAVE
FT                   QALMQAVPGLRATIELLPEGQATVFETAEAAAPGGAGT"
FT   gene            504356..504817
FT                   /locus_tag="Dtpsy_0488"
FT   CDS_pept        504356..504817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0488"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; KEGG: ajs:Ajs_3706
FT                   D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31970"
FT                   /db_xref="GOA:B9MCH0"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MCH0"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ACM31970.1"
FT                   /translation="MIGLLQRVREARVEVAGEIVGRIGPGLLALVCAEQGDSEAQADKL
FT                   LAKMLKLRIFSDEAGKMNRSVQDLDGQGTCGGLLIVSQFTLAADTRGGNRPSFTQAAPP
FT                   AQGERLYDYFVAQARAVHPMVATGRFAADMQVHLVNDGPVTLPLRIAPG"
FT   gene            504827..506236
FT                   /locus_tag="Dtpsy_0489"
FT   CDS_pept        504827..506236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0489"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: helicase domain protein; DEAD-like helicases; KEGG:
FT                   ajs:Ajs_3705 DEAD/DEAH box helicase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31971"
FT                   /db_xref="GOA:B9MCH1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCH1"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACM31971.1"
FT                   /translation="MTISSGASPAPSATAFSSLPLSPEMLANLQQLGYAQMTPIQAASL
FT                   PFSLQGRDLIAQASTGSGKTAAFGLAMVDRLNPRWFAVQGLVLCPTRELADQVATEIRR
FT                   LARAQDNIKVVTVYGGVPSRGQIASLENGAHIVVGTPGRVMDLMERGKLDIAKLKTLVL
FT                   DEADRMLDMGFLADIETVVRQCPAERQTLLFSATYPDGIAGLAQRFMRAPQMVKVAAQH
FT                   GAGKIAQRWYEVDAREKVDVVARMLAHFRPASSIAFCNTKQQCRNVVTALQSQGFSALA
FT                   LFGELEQRERDEVLVQFANKSCSVLVATDVAARGIDIADLSAVINVDVTPDPEVHIHRI
FT                   GRTGRGDAEGLALNLVSMDEMGSVGKIELLQGRACEFFPVDELTPTAGGELQPPMCTIQ
FT                   IIGGRRDKIRAGDVMGAMCADFGYAREQIGKISVNDFSTYVAVDRAIAAQACAKLNAGR
FT                   VKGKMVKARLL"
FT   gene            complement(506264..507040)
FT                   /locus_tag="Dtpsy_0490"
FT   CDS_pept        complement(506264..507040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0490"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   ajs:Ajs_3704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31972"
FT                   /db_xref="GOA:B9MCH2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCH2"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACM31972.1"
FT                   /translation="MDILGWTTSIGHLALLLTAAFIAGALNAVAGGGSFLTLPALVFTG
FT                   VPPVVANATGTVALLPGYMAGAWGFREDMQPPPGLSMRAVVVLSLIGGSAGAALLLFTP
FT                   DATFRKVVPWLLLAATALFAFGPQLRQWAGKAGHGTPSALKAGAGMLAVAAYGGYFNGG
FT                   LGILLLALFGLLGQTQLNAMNGMKNLVSALLTAIAVAIYAAGGIVLWPQALVMMVAATL
FT                   GGYGGARVARQLPAPVLRWGIVATGLVMAGLFFLKG"
FT   sig_peptide     complement(506948..507040)
FT                   /locus_tag="Dtpsy_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.819 at
FT                   residue 31"
FT   gene            complement(507216..507674)
FT                   /locus_tag="Dtpsy_0491"
FT   CDS_pept        complement(507216..507674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0491"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   ajs:Ajs_3702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31973"
FT                   /db_xref="GOA:B9MCH3"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MCH3"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ACM31973.1"
FT                   /translation="MALNQLSLSLQFARDAEATAHRATLPRHAVARWIRHALAVDAEIT
FT                   VRIVGAEEGQRLNREFRHKDYATNVLTFDYQQEPVAVADLVLCAPVVEREAREQNKTLE
FT                   EHYAHLLVHGTLHAQGWDHETSEQDAQEMEVYETAILQELGFADPYAA"
FT   gene            complement(507740..508747)
FT                   /locus_tag="Dtpsy_0492"
FT   CDS_pept        complement(507740..508747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0492"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: ajs:Ajs_3701 PhoH
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31974"
FT                   /db_xref="GOA:B9MCH4"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCH4"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ACM31974.1"
FT                   /translation="MSFAAPDTRRGTSTGIISVILRHTFTPHNNTRLTHLCGPADVHLR
FT                   TIEAALQVSIAHRHEQFKVDGPKAKATQAMELLQALYEMADRPIKEEHLQLMLAGDASM
FT                   QGDDEASAIQLTTRRADLRARTPTQATYLENIATHDITFGIGPAGTGKTYLAVACAVDA
FT                   LERSSVQRIVLTRPAVEAGERLGFLPGDLTQKVDPYLRPLYDALYDLMGFDRVQKAFER
FT                   NALEIAPLAFMRGRTLNNAFVILDEAQNTTPEQMKMFLTRIGFGARAVVTGDVSQIDLP
FT                   KGAMSGLIDAERVLKRVKGIAVTRFTSADVVRHPLVARIVDAYDAQRSRRGAGE"
FT   gene            508750..509322
FT                   /locus_tag="Dtpsy_0493"
FT   CDS_pept        508750..509322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0493"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="KEGG: ajs:Ajs_3700 Holliday junction DNA helicase
FT                   RuvA; TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   RuvA domain protein; DNA recombination protein RuvA domain
FT                   I; SMART: Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31975"
FT                   /db_xref="GOA:B9MCH5"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MCH5"
FT                   /inference="protein motif:TFAM:TIGR00084"
FT                   /protein_id="ACM31975.1"
FT                   /translation="MIGKLTGTLLEKNPPEVLVDCHGVGYEVLVSMSTFYNLPAVGERV
FT                   SLLTQFIVREDAQLLYGFGTAQERQAFRELIKISGVGPRTALSILSGMGVADLAQAVSL
FT                   QEAGRLVKVPGIGKKTAERLLLELKGKLGADVGVRAHAANDNQADILQALLALGYNDKE
FT                   AAAALKALPADVGVSEGIKLALKSLSK"
FT   gene            509345..510811
FT                   /locus_tag="Dtpsy_0494"
FT   CDS_pept        509345..510811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0494"
FT                   /product="endoproteinase Arg-C"
FT                   /note="KEGG: ajs:Ajs_3699 endoproteinase Arg-C"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31976"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCH6"
FT                   /inference="similar to AA sequence:KEGG:Ajs_3699"
FT                   /protein_id="ACM31976.1"
FT                   /translation="MQLLTTTAAQWAAIPLVLALSACGGGGGGNDTPSPTPPVAGDRIE
FT                   PYDPSGTAKVATSQQAVSPVASAQATRTIALGALTAVKGVVSATPGTPLQIGEARSVAD
FT                   TATVAATAALLRWQPTARGTQAAALRFTADGAHGVRLGVLVQSLPEGAVLRFYGEQGAG
FT                   AMEVRASELQDIAARNARGGADDTTARTYWSPDFSGPQTTLEVEIPAAASPAAVRLSVP
FT                   RLSHFTLAPAQAEQALAQKVGESGSCNVDATCRPEFNDQSRSVARMIFVRDDGKSYLCT
FT                   GTLLNDAASSGTPYFLSANHCISTQAVASTLTTDWFYRSSTCGTATVNPAAVRVTGGAA
FT                   LLYASATTDTAFMQLNSQAPAGIVYAGSYFGGVGVGTALAGVHHPQGDLQKVSLGSMQR
FT                   YSTCVDNSCRSSNADDGTFLTLGWQEGTTEGGSSGSAAFVTFGERRYVVGQLLGGTASC
FT                   AARDGVDYYGRFDTSYRTALRRWLNPTAAN"
FT   sig_peptide     509345..509419
FT                   /locus_tag="Dtpsy_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.322 at
FT                   residue 25"
FT   gene            complement(510808..513663)
FT                   /locus_tag="Dtpsy_0495"
FT   CDS_pept        complement(510808..513663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0495"
FT                   /product="DnaK-related protein"
FT                   /note="KEGG: ajs:Ajs_3698 DnaK-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31977"
FT                   /db_xref="GOA:B9MCH7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR021030"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCH7"
FT                   /inference="similar to AA sequence:KEGG:Ajs_3698"
FT                   /protein_id="ACM31977.1"
FT                   /translation="MKRYTVGIDLGTSHTACAYAPLEARAADIALLPIPQRLSAGELQA
FT                   QPLLPSVRYQAASGELGEAWRQPWPPLEATDDTPATLGRWARDLGAAVPGRLVESAKSW
FT                   LSHPGVDRTAPILPWGAPQDVARVSPVQASASYLAHVRAAWDAAHPDAPLHAQDLVLTV
FT                   PASFDEGARALTLEAARLAGLPALQLLEEPKAAFHDWLALQGEQLAAQLAGCRLVLVVD
FT                   VGGGTTDLTLIRVDTQAGGTPRLTRIAVGEHLMLGGDNMDLALAHLLEPQFAGDGGHLP
FT                   AARLPAARLPAARFAQLVQRCRQAKELLLADGAPDSAAVTLLGTGSRMLAQTHTATLTR
FT                   AQVLQCVVEGFLPQVPIGDRPARRQGALRGLGLPYPADAAITRHLAQFLAQHAGGDLPE
FT                   TLLLNGGVFHAPALVQRLTEVLAHWRGAPPRVLHNPHPDWAVARGAAAYGLAQHSSSNT
FT                   HTAQSGQAPAAPKTIVPRIGGGSARSYWLVLPGKAGTAPQGICLLPRGTEEGVRLVLTS
FT                   RRFALRLGQAVRFALVARSQGQAQAGQIAPLEGDGWAELPPLATVLPAPEGRATAQVEV
FT                   QLQACMTEVGTLEVRCVATQEADQSWLLPFAVRGAAGTDGASKSIAASAEPESGSGQKG
FT                   SKGRASRLPEALALIDRIFGTQAQDVAPKEVRQLRQSLEKLLGPRAGWDVALLRALFDA
FT                   LLARARRRRRTTEHERTWLNLAGWCLRPGVGAELDAWRIAQVWQLYPQGLGHGQDAANW
FT                   TEWWVFWRRVAAGLDEAQQMQVLEAVAGCMQKTVQRSQGKAAWGSYDDMLRLFAAMEAV
FT                   PWQYRQEMGQWMLQRLLRPDESAQTWWAIGRLAARQPLAANAHRVMPPEAAAEFLHATL
FT                   REDWRHNEHALFAAVQIARMTGDRARDLPDALRTEVLEKMRATHAPARWIALVEQPTAM
FT                   EAEDQQRSLGDSLPPGLVLVG"
FT   gene            complement(513668..514259)
FT                   /pseudo
FT                   /locus_tag="Dtpsy_0496"
FT   gene            complement(514270..516180)
FT                   /locus_tag="Dtpsy_0497"
FT   CDS_pept        complement(514270..516180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0497"
FT                   /product="putative heat-shock chaperone protein"
FT                   /note="KEGG: ajs:Ajs_3696 putative heat-shock chaperone
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31978"
FT                   /db_xref="GOA:B9MCH8"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCH8"
FT                   /inference="similar to AA sequence:KEGG:Ajs_3696"
FT                   /protein_id="ACM31978.1"
FT                   /translation="MPNTPETIAASAYPASATGKNNAQYSIGIDLGTTHCALSYVDRHA
FT                   SDGDAVVQQVLDIPQLTGPASVEARPLLPSFLYLPHESELSAADTALPGGGAGQDGVVG
FT                   ELARTRGAATPIRLVSSAKSWLCHPGVDRRAPILPPDAPPEVPRVSPLAASARYLSHLR
FT                   WAWNQAHPEAPLEHQDITVTIPASFDPAARELTAEACRAAGLERLTLLEEPQAALYSWI
FT                   QASGGGWRKQVASGDIILVVDVGGGTTDLSLIAVLEKDGALELQRVAVGEHILLGGDNM
FT                   DLALAYGVARKLAQEGKPLDAWQTRALAHGCRAAKEQLLADEALPSVPVVVPARGSKLI
FT                   GGSIRTEVTRAEVQALLVDGFFPQVAVGDKPLTRARGALTQLGLPYAQDAAVTRHLAAF
FT                   LSRQLDATAQIPGLAGRQAGGASFLHPTALLFNGGVLKAPQIAERIVGVINGWLAAEGA
FT                   APARLLEGAQLDLAVARGAAYFGHVTAAGRGVRIRGGAAQSYYVGVESNMPAIPGMEPP
FT                   LSALCLAPFGMEEGTEVALHAQEFGLVVGEPVRLRFFGSSVRRGDTVGTLLDFWGPEEL
FT                   VELQEIEAHLPPDGRTPGEVVPVTLHARVTDIGTLELSAVPVGGHERWKVEFDVRAQTQ
FT                   A"
FT   gene            complement(516189..516827)
FT                   /locus_tag="Dtpsy_0498"
FT   CDS_pept        complement(516189..516827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31979"
FT                   /db_xref="InterPro:IPR021212"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCH9"
FT                   /inference="similar to AA sequence:KEGG:Ajs_3695"
FT                   /protein_id="ACM31979.1"
FT                   /translation="MNTPAHPSFLSRMAIAIGSFFAILGNGRLAADIQRLRAGEALAAD
FT                   VAPPAPQAVRVEVPVETIVEKIVEVRVEVPVEKVVEKRVDVATDTAALQLLGLLQREAR
FT                   LVDFLQEDVAPYSDAEIGAAARVVHEGCRKVLREHFTIEAVRPEGEGSHVTLPVGFDAT
FT                   AVRLTGNVLGQAPFTGQLTHRGWKATAVRLPQLTDPRAAAVLAQAEVEL"
FT   sig_peptide     complement(516735..516827)
FT                   /locus_tag="Dtpsy_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.793 at
FT                   residue 31"
FT   gene            517051..518121
FT                   /locus_tag="Dtpsy_0499"
FT   CDS_pept        517051..518121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0499"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: ajs:Ajs_3694 Holliday junction DNA helicase B;
FT                   TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   magnesium chelatase ChlI subunit; AAA ATPase central domain
FT                   protein; Holliday junction DNA helicase RuvB domain; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31980"
FT                   /db_xref="GOA:B9MCI0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCI0"
FT                   /inference="protein motif:TFAM:TIGR00635"
FT                   /protein_id="ACM31980.1"
FT                   /translation="MTIHTDDFAPSPPPARERVVSAAPASSQEEALERALRPKLLQEYV
FT                   GQAKAREQLEIFIGAAKKRGEALDHVLLFGPPGLGKTTLSHIIATELGVNLRQTSGPVL
FT                   EKPKDLAALLTNLERNDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSIKL
FT                   DLQPFTLVGATTRAGMLTNPLRDRFGIVARLEFYTPEELARIVMRSAGLLGAPIDAEGG
FT                   MEIARRSRGTPRIANRLLRRVRDYAEVKGSGHITLDIANRALTMLDVDPQGFDVMDRKL
FT                   LEAVVHRFDGGPVGLDNIAASIGEESGTIEDVIEPYLIQQGYLQRTPRGRVATLAAYRH
FT                   LGVAPPRAAGGLFESA"
FT   gene            complement(518126..519919)
FT                   /locus_tag="Dtpsy_0500"
FT   CDS_pept        complement(518126..519919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0500"
FT                   /product="YhhN family protein"
FT                   /note="PFAM: fatty acid hydroxylase; YhhN family protein;
FT                   KEGG: ajs:Ajs_3693 YhhN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31981"
FT                   /db_xref="GOA:B9MCI1"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCI1"
FT                   /inference="protein motif:PFAM:PF07947"
FT                   /protein_id="ACM31981.1"
FT                   /translation="MSGSQIIVLVTPVFLALMALEWAIGRWRGRPALRLADAVSSVSLG
FT                   MLSQTSAVFTVLLRVGLYTLAYEHLALWRSEAFWTTWYGWLIALVFYDFCYYWLHRMGH
FT                   EVAVLWAAHAVHHQSQDYNLSTALRQTSSGAVLGWVFYLPMALAGVPPLVFVVVGLVDL
FT                   LYQFWVHTEQVGRLGWFDRWFCSPSNHRVHHAVNDSYLDKNYGGILIVWDRLFGTFKDE
FT                   DPREKCVYGTRGLLNSWDPLWANAQVYAGLLHDSWHARRWADKLRVWLKAPGWRPADVA
FT                   QHFPKPAFNFHDMPLFDPPLSAPLRWFAGVQFVLLLAGVAAFLWQADSAPLATNAVWFA
FT                   TLLACQWALGAAMQGRIGMGLALMIEAGALATATSALGFTAWHLLFKPLTMAIAIVYVA
FT                   NHAYPMSVTGRFGLHRSFWLLLSALLGSLAGDVFLMLSEHLFIPGLVSFLLAHLCYIAL
FT                   FKQGAGWFGHRGALVGTLALGIGMYAFLWHGGLPAALRVPVAVYVVVIALMAAQAWGRH
FT                   AALRERSSLAVALGACCFMLSDSLLATNRFVQPLPLSQLWVLATYYAAQVLIVSGMVTA
FT                   LTRGAAHQADARTQPLTPHAA"
FT   gene            complement(520100..521281)
FT                   /locus_tag="Dtpsy_0501"
FT   CDS_pept        complement(520100..521281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0501"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   ajs:Ajs_0490 alanine racemase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31982"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCI2"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACM31982.1"
FT                   /translation="MRSTPEHLPEHLRATIGLRVDLIDTPALVVDLDAMERNIQRMAEF
FT                   AHKHQVRWRPHAKMHKSAEIALQLEKAGARGHCVQKVSEAEALAAGGVADLYISNEVLG
FT                   GAKLLRAARLAAQLAARGGRLGIAVDSEEGITRLSEAMRVAGSDAGIDVFVEIDVGQGR
FT                   CGVPPGPAALALAQAVAAQPRLHFAGLQAYHGSAQHLRSAAERRAAIAHAVQAAADTRA
FT                   LIEAAGLPVPLVTGSGTGTLVHEAASGVYGELQAGSFLFMDADYAANERESAQPAFEHA
FT                   LFVKTQVISARPTHVVCDAGHKSHAVDSGMPLVWGLPPERALRYANGGDEHGVLHATGP
FT                   KARLPALGRMLWLVPGHCDPTVNLHDYLIGVRGGLAHGVVERVIRVDARGAVT"
FT   gene            complement(521265..521909)
FT                   /locus_tag="Dtpsy_0502"
FT   CDS_pept        complement(521265..521909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0502"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: ajs:Ajs_0491
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31983"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCI3"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACM31983.1"
FT                   /translation="MHATRIIAIRHGETAWNVDTRIQGHLDIPLNDTGLWQARQVGQAL
FT                   ADEAVAAIYSSDLQRAYATAEAVARTTGAPLTPVPGLRERSFGSFQGRTFQQIETESPE
FT                   QALRWRKRDPHFVPDGGGESLDMLRERIAVTVDGIAARHAGEQIVLVAHGGVMDVLYRL
FT                   ATRLDLQAPRTWQLTNAAINRLLWTEGNGLTLVGWADTQHLENASRDEIHS"
FT   gene            complement(521932..522396)
FT                   /locus_tag="Dtpsy_0503"
FT   CDS_pept        complement(521932..522396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31984"
FT                   /db_xref="InterPro:IPR019637"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCI4"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0492"
FT                   /protein_id="ACM31984.1"
FT                   /translation="MRSSIRHLVLCACLGPVSLVAQASGLGDTLRGATSGGASPSTLGG
FT                   MLGGGAAPSALSAMGLSGSATPSNAAGVITYCMKNNYLNADKAALVKQQLLGKMGLGAA
FT                   QPEPRDEGYLSGLSGMVSGSNGKQFNLNRLKGDLKEKACDFVLDNASSLL"
FT   sig_peptide     complement(522325..522396)
FT                   /locus_tag="Dtpsy_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 24"
FT   gene            complement(522424..523038)
FT                   /locus_tag="Dtpsy_0504"
FT   CDS_pept        complement(522424..523038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31985"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCI5"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0493"
FT                   /protein_id="ACM31985.1"
FT                   /translation="MAFLRHIPALALCAAAALLAGCAGPRLVESDVSSFSTLSALPSPP
FT                   TYRFERLPSQQAQAAAFAPIEAQAEQALARVGLRRDDTQPRLVAQIGAEGGYATPRYWP
FT                   YAPDPFYGRFGWGLGYGGGWGFGGMGWMMDGPPTLYHRKVSLMLRDAASQQVVYETSAV
FT                   YEDVWTDDPAIYGVLFDQALTGFPRPPAGQRKVRTEITPQR"
FT   sig_peptide     complement(522952..523038)
FT                   /locus_tag="Dtpsy_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.594 at
FT                   residue 29"
FT   gene            complement(523104..524057)
FT                   /locus_tag="Dtpsy_0505"
FT   CDS_pept        complement(523104..524057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0505"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: ajs:Ajs_0494
FT                   PP-loop domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31986"
FT                   /db_xref="GOA:B9MCI6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MCI6"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ACM31986.1"
FT                   /translation="MNTANNTLPTAADWAGEDGAPDAADTRKIERESHKLEKRLCREVG
FT                   RAITDFNMIEEGDKIMVCMSGGKDSYTLLDILRKLQKRAPVKFDIVAVNLDQKQPGFPE
FT                   HVLPDYFKSIGVQYHIENQDTYSVVKRVVPEGKTTCSLCSRLRRAILYKVADDLGCTKL
FT                   ALGHHRDDIVATLMLNMFYGGRMKGMPPKLVSDDGKHVVIRPLCYVPEKDTARWAQYQQ
FT                   FPIIPCNLCGSQDGLQRVAVNEMLREWDKKFPGRIESMLRAMGHVVTTHLMDPHLHDFK
FT                   NAKATGIADPNGDMAFDHEEFPVAPALPGLQVVQLG"
FT   gene            complement(524062..524454)
FT                   /locus_tag="Dtpsy_0506"
FT   CDS_pept        complement(524062..524454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0506"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: ajs:Ajs_0495
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31987"
FT                   /db_xref="GOA:B9MCI7"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCI7"
FT                   /inference="protein motif:PFAM:PF02152"
FT                   /protein_id="ACM31987.1"
FT                   /translation="MTIFSHPARPGEGLQALTLTGLRFDANLGILAHEKNAPQPIQVDA
FT                   ELNLGTQPLAPRDDDIQHVLDYRKVRQIIIDECTAEHVNLLESLIGKLANRLMQLPGVL
FT                   GVRVKIAKLEIFDDCEVAIRVETGQW"
FT   gene            complement(524459..524872)
FT                   /locus_tag="Dtpsy_0507"
FT   CDS_pept        complement(524459..524872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0507"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG:
FT                   eugene3.214320002."
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31988"
FT                   /db_xref="GOA:B9MCI8"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCI8"
FT                   /inference="protein motif:PFAM:PF02152"
FT                   /protein_id="ACM31988.1"
FT                   /translation="MNSILLAFGALDARLATHCRALSLRRHEVAVRIGVHAHERQAAQR
FT                   MWFDVDLCVKLDHAPAARDDISQTVDYDFIRDIVAREVGSHHHELQESLCDAIAQAILQ
FT                   RPEVHAVRVATRKPDVYPDSASVGVERVCIKPW"
FT   gene            complement(524869..525664)
FT                   /pseudo
FT                   /locus_tag="Dtpsy_0508"
FT   gene            complement(525661..526443)
FT                   /locus_tag="Dtpsy_0509"
FT   CDS_pept        complement(525661..526443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31989"
FT                   /db_xref="GOA:B9MCI9"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACM31989.1"
FT                   /translation="MSDSSASSSLQPSSELVRWLQSLALPLWARGTLVIVFLAVMSGGL
FT                   ALVVWGAWNRDREAMTAAIGLLTVALPVSLVVIGLVFGQRSERRLAQLTHAVLDVQIPA
FT                   QVQQLAGTPRGLLLTPLARTGCRATYRLSAPAGQRGLHHPLQFSVELNVRKVNVMFSLP
FT                   EPIAPQGPLAEHPALASYQHVIAGARAEGYRLNHELADYGGDDGGRALLFYRTLPEDFL
FT                   LRPIERLYFTQDLGFFVRGIVEAQEAAQAGAAVREARA"
FT   gene            526479..527567
FT                   /locus_tag="Dtpsy_0510"
FT   CDS_pept        526479..527567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0510"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   ajs:Ajs_0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31990"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCJ0"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="ACM31990.1"
FT                   /translation="MTALTPSLFEHIRQRITAQGGWIGFDRFMALALYTPGLGYYAGDL
FT                   PKFGAMPASGSDFVTAPELSPVFGSVLARQVREALDATATDEVWEFGAGSGALAAQLLG
FT                   ALGDRVRRYTIVDLSGSLRARQQATLAAWGDRVHWVDRLPDQIQGVVVGNEVLDAMPVQ
FT                   LLQRRAGLWHERGVALDESGNGFVWQDRPTPLRPPVEIDGPHDYLTEIHPQGEAFMRTL
FT                   AQHLVRGAAFLIDYGFGEDEYYHPQRHMGTLVCHRGHQVDSDPLADVGLKDITAHVNFT
FT                   AMALAAQDAGLQVLGYTTQAHFLINCGLLSELERLTQAQRAQAAKLMMEHEMGELFKVL
FT                   AVGAGEPWRPMGFAQGDRSHRL"
FT   gene            527683..528582
FT                   /locus_tag="Dtpsy_0511"
FT   CDS_pept        527683..528582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0511"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: xcv:XCV0883 taurine dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31991"
FT                   /db_xref="GOA:B9MCJ1"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCJ1"
FT                   /inference="protein motif:PRIAM:1.14.11.17"
FT                   /protein_id="ACM31991.1"
FT                   /translation="MSALPHDPGLASQASQEFEIRRLPAPLGAEVLGLDLAQPLSDADF
FT                   DRILRAHWEHVVLVFRNQRITPAQQVAFSRRFGPLQIHVQRKFALQGHPEVLVVSNIRD
FT                   ENGEPTGLGDAGSLWHSDLSYKDKPSLGSLLHAQELPNVGGDTLFADQYAAYDALPEAT
FT                   QQRIAHLRAEHSYLARYEELRQRNPWRPRLTPAQIAEVAPAVHPVVRTHPATGRKALFV
FT                   SEHFTTRILDLPEEESRALLQELFAASVRPEFVYRHQWQPHDLVFWDNRAVLHLAAGTP
FT                   DTERRKLYRTTVEGDAPR"
FT   gene            528678..529778
FT                   /locus_tag="Dtpsy_0512"
FT   CDS_pept        528678..529778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0512"
FT                   /product="nitrate/sulfonate/bicarbonate ABC transporter
FT                   periplasmic ligand-binding protein"
FT                   /note="KEGG: bph:Bphy_3603 nitrate/sulfonate/bicarbonate
FT                   ABC transporter periplasmic ligand-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31992"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCJ2"
FT                   /inference="similar to AA sequence:KEGG:Bphy_3603"
FT                   /protein_id="ACM31992.1"
FT                   /translation="MTTLPSATPTPQSHSPVHGPLRHFFLRFLRRATRRGAVLCSVAGL
FT                   LLGAHGVAQAAEGQLRIAQQFGIVYLLLNVAQDQKLIEKHGKVAGVDIRVEFVKLSGGA
FT                   VINDALLAGSIDIAGAGVGPLFTLWDRTRGRQNVKGVASLGNFPYYLVSNNPAVKTIAD
FT                   FTDKDRIALPAVGVSVQSRILQLASAQRWGDPAFNRLDKLQVALPHPDAAAAIIKGGTE
FT                   ITAHFGNPPFQEQELAANPAAHIVLKSYDVLGGPASATVLYATEKFRNDSPKTYRALLD
FT                   ALDEAARFIAAQPEQAADIYLRTHGGNTDRQLLLQVLKNPEVQFQIRPQNTLGLGQFLH
FT                   RVGALKHQPVALQDYFFDDPRIAGGN"
FT   sig_peptide     528678..528845
FT                   /locus_tag="Dtpsy_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.994 at
FT                   residue 56"
FT   gene            529778..530719
FT                   /locus_tag="Dtpsy_0513"
FT   CDS_pept        529778..530719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0513"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cti:RALTA_B1991 putative taurine transporter, ABC
FT                   superfamily, atp_binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31993"
FT                   /db_xref="GOA:B9MCJ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCJ3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACM31993.1"
FT                   /translation="MRTAFQGEASGATAWGGPPGASPGHQPAVHPASHPVSAASAVPAP
FT                   LLQVQGVSLDYRTHERVVRATHQVSFDVHAGERYVLLGASGCGKSTLLKSIAGFIAPAE
FT                   GTVRLQGRAVAAPGPDRVVVFQEFDQLPPWKTVRENVMFPLLASRRATRAEAAERAALY
FT                   LDKVGLARFADVHPHQLSGGMKQRVAIARALAMQPQVLLMDEPFAALDALTRRRMQEEL
FT                   LALWDELRFTLVFVTHSIEEALVVGSRIAILSPHPGRLRAEINCHQYGLHSAGSADFQA
FT                   TAQRVHALLFDEPVHGAAPSDAPHAPVPPTFA"
FT   gene            530729..531631
FT                   /locus_tag="Dtpsy_0514"
FT   CDS_pept        530729..531631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0514"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mms:mma_2483 ABC-type
FT                   sulfonate/nitrate transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31994"
FT                   /db_xref="GOA:B9MCJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCJ4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACM31994.1"
FT                   /translation="MSLPTSSVSAAPFALHPPVRPEVLHTLPPLGRVAPAQPLPLGRRL
FT                   WQQGALRKALILAVLALLWEGVARWQDNDLLLPTFLQTAQAFAQGVASGELLHKTALSL
FT                   AVLLKGYLAGIACAFVLTTLAVSTQLGRDLLSTLTAMFNPLPAIALLPLALLWFGLGQG
FT                   SLVFVLVHSVLWPLALNTYAGFQGVPETLRMAGRNYGLKGLRYVLQLLVPAALPSILSG
FT                   LKIGWAFAWRTLIAAELVFGASSGQGGLGWYIFQNRNELYTDKVFAGLAMVIAIGLAVE
FT                   NLGFHTLERLTVRRWGVQR"
FT   gene            531928..532122
FT                   /locus_tag="Dtpsy_0515"
FT   CDS_pept        531928..532122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31995"
FT                   /db_xref="GOA:B9MCJ5"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCJ5"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0499"
FT                   /protein_id="ACM31995.1"
FT                   /translation="MLRWLLVVFLALVLINGLTPWLRRLGLGRLPGDFQFRLFGRDWFI
FT                   PLASTVLLSFLLSLAVKWL"
FT   gene            532219..533229
FT                   /locus_tag="Dtpsy_0516"
FT   CDS_pept        532219..533229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0516"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: ajs:Ajs_0500
FT                   glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31996"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCJ6"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACM31996.1"
FT                   /translation="MMGPMPQQLPTSQSPGLHAGVDIGGTKVAVCLADPANGSGPPVLL
FT                   TRMAEPTAKAGAPDALAQQVLRLLDAACTQQGITRSDLAGVGVASCGPFVRHAGMVEVV
FT                   NPNICGGLAGAPRGLGNDWTRVPLQAPLAQALRADRVHVANDAVAALQAERLWGALRGE
FT                   DDCAYVTWSTGIGVGLCVDGCVLRGKNGNAGHAGHSYVGDPDAGSDVALCGCGNQGDVE
FT                   SLVAGSALPRRLGREAPALMAAADAGDAAALAEVQALCVLMGRLLYNLVATLDLRRISL
FT                   GGAVFLHHQALLLPLLRAQLARYFPALTAGVELVPAGLGGQVGDYAALALLQQPG"
FT   gene            complement(533306..534724)
FT                   /locus_tag="Dtpsy_0517"
FT   CDS_pept        complement(533306..534724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0517"
FT                   /product="alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: ajs:Ajs_0501 alpha,alpha-trehalose-phosphate
FT                   synthase (UDP-forming); TIGRFAM:
FT                   alpha,alpha-trehalose-phosphate synthase [UDP-forming];
FT                   PFAM: glycosyl transferase family 20"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31997"
FT                   /db_xref="GOA:B9MCJ7"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCJ7"
FT                   /inference="protein motif:TFAM:TIGR02400"
FT                   /protein_id="ACM31997.1"
FT                   /translation="MSRLVVISNRLADPRKSAAGGLAVALGDALARTGGLWFGWSGTVT
FT                   PDGTPGEGALQTHQAGNVTLATVDLCQADHAAYYQGYANSVLWPVLHYRLDLADFSANY
FT                   SEGYRRVNQMFARKLLPLLREDDVIWVHDYHLIPLAAELRALGCRQRIGFFLHVPVPPP
FT                   LILAALPQHEWLMRSFFAYDLVGLQSEADVVHFTRYMVNEAQAQELGGQRLRAFNATLR
FT                   VAAFPIGIDVQEFQRLGRAPDAVQTCEALRAEYSRRQLLLGIDRLDYSKGIPHRVRAFR
FT                   QLLERYPENEHSATLVMIASPSRDDVHAYADLRQELEGLCGAINGDYGDLDWMPLRYIH
FT                   RTVARKRVPGLCRAARVGLVTPLRDGMNLVAKEYVVAQEPEDPGVLVLSRFAGAAEQLK
FT                   EALLVNPYDTQGMADAIQTALRMPLSERQWRHERLMERIQRQDVHWWRNSFLQALRDEA
FT                   APPVTAPAGAVAAT"
FT   gene            complement(534741..536561)
FT                   /locus_tag="Dtpsy_0518"
FT   CDS_pept        complement(534741..536561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0518"
FT                   /product="glycoside hydrolase 15-related"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   ajs:Ajs_0502 glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31998"
FT                   /db_xref="GOA:B9MCJ8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCJ8"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ACM31998.1"
FT                   /translation="MTSKASHVGATAMAAPSLALGMIGNCTISALVDARACIVWSCMPR
FT                   FDGDPVFNALVQPGPDGSRFAIELEDFARSEQWYEPNTAVLRTHLTDAHGNCLEVTDFC
FT                   PRFFARSRAFRPVMLVRRVRPVRGAPRIRVLVQPRYDWGMAQPALTRGSNHIRYVGGDF
FT                   TLRLNTDAPVAYVLSGEPFVAGREYNFLLGADETLSGGIGDTARHYEQETVSYWKHWTQ
FT                   RLHLPLQWQEAVIRSAITLKMSLFEDTGAIVAAMTTSIPESAHSGRNWDYRYCWLRDAF
FT                   FVVRALNSLSEVGTMEDYLRWLGNIVAKTGSGHIQPLYGIGLEHELPESVLPHLAGYRG
FT                   MGPVRVGNQAAEHFQHDVYGNIVLGAAQSFHDRRLLHPAGAAEFERLERVGELAVQVYG
FT                   KPDAGMWELRTRARIHTSSALMSWAACDRLAKIARALQLPERAHYWQQHAQRMHGEILE
FT                   RSWHAKRQVFAESFGGSELDASVLLMAEVGLIHPTDPRFVSTLDAMEHTLCDGPFMRRY
FT                   EAADDFGKPETAFNICTFWRIDALARTGRREQAQEIFEAMLAVRNPLGLLSEDTHAATG
FT                   EMWGNFPQTYSMVGIINAAMRLSAPWDSVI"
FT   sig_peptide     complement(536496..536561)
FT                   /locus_tag="Dtpsy_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.410 at
FT                   residue 22"
FT   gene            complement(536558..537289)
FT                   /locus_tag="Dtpsy_0519"
FT   CDS_pept        complement(536558..537289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0519"
FT                   /product="trehalose-phosphatase"
FT                   /EC_number="3.1.3.12"
FT                   /note="KEGG: ajs:Ajs_0503 HAD family hydrolase; TIGRFAM:
FT                   trehalose-phosphatase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACM31999"
FT                   /db_xref="GOA:B9MCJ9"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCJ9"
FT                   /inference="protein motif:TFAM:TIGR00685"
FT                   /protein_id="ACM31999.1"
FT                   /translation="MPTPPLPTSRHALFLDFDGTLADIAAQPHAVQLPPGVVDCLQALH
FT                   VRLEGALAIVTGRTMADIDHFLDPLRLPVACEHGAQYRLGNGRSGGLPALPLQPLLAAL
FT                   RPLMAQHPELLLEAKSAGLALHYRQAPQLQALCLQAITQALREVPGAELLHGKFVYEVK
FT                   PVGPDKGRAITDFMRLAPFAGRAPLFVGDDVTDEAGFAAAQSLGGLGIKVGEGATRAHA
FT                   RLATPAAVRQWLQHAVGEEIT"
FT   gene            537416..537853
FT                   /locus_tag="Dtpsy_0520"
FT   CDS_pept        537416..537853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0520"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; MJ0042 family finger-like
FT                   protein; PFAM: Thioredoxin domain; KEGG: ajs:Ajs_0504
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32000"
FT                   /db_xref="GOA:B9MCK0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCK0"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ACM32000.1"
FT                   /translation="MSSPEALHVVCPHCHTTNRVQAAQLGSAPDCGSCHRPLFTGEPLA
FT                   LDAASFDRHVARSHLPVVVDFWAPWCGPCRQMAPAFAQAARELEPRVRLAKLDTEAHPA
FT                   IAARYGIRSIPTMILFRGGQEAARISGALGAADIARWVQSV"
FT   gene            complement(537985..539262)
FT                   /locus_tag="Dtpsy_0521"
FT   CDS_pept        complement(537985..539262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0521"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   ajs:Ajs_0505 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32001"
FT                   /db_xref="GOA:B9MCK1"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MCK1"
FT                   /inference="protein motif:PFAM:PF01743"
FT                   /protein_id="ACM32001.1"
FT                   /translation="MQIYMVGGAVRDRLLGRPVNDHDWVVVGATPDDMVARGYLPVGRD
FT                   FPVFLHPETREEYALARTERKSGRGYRGFVVQTSPDVTLEEDLSRRDLTINAIAASADW
FT                   TGAEDLFDPYGGARDLQARVLRHVTDSFREDPVRILRVARFAARFTDFTVAPETMQLMR
FT                   EMVHDGEADHLVPERVWQELARGLMEPQPSRMFDVLRDCGALAVVLPEVERLWGVPQRP
FT                   EYHPEVDTGVHLMMVLDMAAHLQAPLTVRFACLTHDLGKGTTPHDVLPRHIGHEQRSAR
FT                   LLKAVCERLRVPVECRELADVVAREHGNIHRSGDLGAAALVRLLERCDAIRKPARLDEI
FT                   LLACECDARGRLGFADRPYPQRARINAALAAVQSVTTSSVAAHAAQLGLSGPKVGEMIH
FT                   AARVQAVADWLHATAQPAPEPRGNAG"
FT   gene            complement(539568..540335)
FT                   /locus_tag="Dtpsy_0522"
FT   CDS_pept        complement(539568..540335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0522"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ajs:Ajs_0506
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32002"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCK2"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACM32002.1"
FT                   /translation="MKLHILSDLHLGVQGMEHPRTDADVVILAGDIARPAAAVAWAQGF
FT                   AKPVLYVPGNHEFYGSSLQDTAQELRRLCEGSPVHLLDNRSLVLQGVRFIGSTLWSDFR
FT                   VAGDGAARTEAMAQAQQFMRDFSRIRAGGADGGALFTPQHAADLFDANARWLARELAQP
FT                   FAGPTVVITHHAPSPHSIHPRFAGSPINAAFVSDAQTLVEGSGARLWVHGHTHDSFDYR
FT                   LHGTRVLCNPRGYAKDGQVENTRFNPHLVVEVA"
FT   gene            complement(540353..541039)
FT                   /locus_tag="Dtpsy_0523"
FT   CDS_pept        complement(540353..541039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0523"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ajs:Ajs_0507 glutathione S-transferase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32003"
FT                   /db_xref="GOA:B9MCK3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCK3"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACM32003.1"
FT                   /translation="MLQLYIGNKNYSSWSMRPWVLLRQAGIAFEEVPVRFDSFDANSQF
FT                   KRQLKAVTPVAKVPVLVDGDITVWDSLAIAEYLAEQYPDKHLWPQDKAARARARSVVAE
FT                   MHSGFSALRSHCGMNIEARLPEVGEIVWRDQPAVRADVQRLVEMWSELLDQHGGPMLFG
FT                   QFSIADAFYAPVCMRLATFALPVPEHITAYVQRVQQLPGVKAWIDGALAEQDFVPFDEP
FT                   YRARRG"
FT   gene            complement(541169..541741)
FT                   /locus_tag="Dtpsy_0524"
FT   CDS_pept        complement(541169..541741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0524"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   ajs:Ajs_0508 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32004"
FT                   /db_xref="GOA:B9MCK4"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCK4"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ACM32004.1"
FT                   /translation="MDKAALRRALVEQRLNLPDRLQRADQLQRVMRIWLVDRPDTIIGA
FT                   YWPIKGEFDPLPALHRWKEDGELLDEPQLRRIGLPVVDKVHKTLTFHAWYPGCPMEEDA
FT                   YGIPKPKDTELIHPTLLFVPCVGYGPGGYRLGYGGGFYDRTLATLQPRPATVGLGFTHG
FT                   YLDDFEPEAHDLPLDAILNDNGVVWPV"
FT   gene            541765..543738
FT                   /locus_tag="Dtpsy_0525"
FT   CDS_pept        541765..543738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0525"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   ajs:Ajs_0509 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32005"
FT                   /db_xref="GOA:B9MCK5"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCK5"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACM32005.1"
FT                   /translation="MKILTPLIAGAALATAAPWAGAQNRGDDTVLEMQKAFRKGDKQRL
FT                   AALLPGARGHALEPWAAYWELRARLEEAQPSEVTAFLQRWAGTYQEDRLRNDWLLLLGQ
FT                   RRDWDQFAEFHPQFRMGDDREVHCYALAIEQIKGTAAESAGAEMLRHWYALRELDDGCS
FT                   SAAAEMLAAKKIKPLDVWRKARLGAEANRLRVVRKAVEIVAPDALPQLREALDSPTKYL
FT                   TGRATARGKERQELVVLALTRMAMSDVANAASLLDSKWGPHLSAEERNWLWGLIGKQAA
FT                   TALSPDALSYYANVGRDADLTDDMLAWRTRAALRAGQWKLVGRSIDAMSPAARQESVWT
FT                   YWKARALMANRPGDEDRAAARQLYARIAGTTGFYEQLALEELGERVTQPPAPAPLTEEE
FT                   KATARANPGLNRALYAILMGLRSEGVREWNYTTNLHTPGGMGERELLAAADFACQREVW
FT                   DRCINTSERTKGVIDAAQRFPMPFRSAVVERARGIGLDPAYVYGLIRQESRFIMDARSG
FT                   VGASGLMQVMPATARWTARKIGLEGFSPQQLYDRDTNITIGTAYLKLALDDFDGSMPLA
FT                   AAAYNAGPGRPRNWRNGPVLDAAIWAENVPFSETRDYVKKVLANTVNYAAILTGQPQSL
FT                   KSRLGTVGPRDARAPEPNKDLP"
FT   sig_peptide     541765..541827
FT                   /locus_tag="Dtpsy_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.818 at
FT                   residue 21"
FT   gene            complement(543814..544386)
FT                   /locus_tag="Dtpsy_0526"
FT   CDS_pept        complement(543814..544386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0526"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: ajs:Ajs_0510 cytochrome
FT                   b561"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32006"
FT                   /db_xref="GOA:B9MCK6"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCK6"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ACM32006.1"
FT                   /translation="MSAFKTDGARATGATLRVWDRPVRLLHWGLAACVAMAWWSSDDTG
FT                   PLHERVGYVALALLAARVAWGFGGSRYARFAQFVRTPAATLAYARLALAGHAPRYLGHN
FT                   PLGAWMVLALLAIMALLGFTGWLYTTDRFWGYGWLAHLHQYLGWALLACVALHVGGVLW
FT                   TCLQHRENLVRAMVTGRKAPPRGDDVA"
FT   gene            complement(544367..544636)
FT                   /locus_tag="Dtpsy_0527"
FT   CDS_pept        complement(544367..544636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0527"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: ajs:Ajs_0511 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32007"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCK7"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0511"
FT                   /protein_id="ACM32007.1"
FT                   /translation="MTSWIPHIAALALAVSASSAFAHGKVTCPEHPPAEWRPHTELEQK
FT                   LVKEGWTVRRMEKTETCYEVYGKDPQGKRVEAFFDPKTLERVQD"
FT   sig_peptide     complement(544568..544636)
FT                   /locus_tag="Dtpsy_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 23"
FT   gene            complement(544695..545378)
FT                   /locus_tag="Dtpsy_0528"
FT   CDS_pept        complement(544695..545378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0528"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: ajs:Ajs_0512 putative
FT                   hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32008"
FT                   /db_xref="GOA:B9MCK8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MCK8"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ACM32008.1"
FT                   /translation="MLISIDQVLSKTEVRDLRAQLDAAAWEDGAATAGTLAKSVKRNQQ
FT                   INDGSELCQRLGQHILRRLSSTPLFISAALPRTIYPPKFNRYADGGTYGAHVDSALMFL
FT                   PGSHQQMRTDLSATLFLAEPEEYDGGELEVEGPFGVQAVKLAAGDMVLYPSSSLHRVTP
FT                   VTRGARVASFFWIESLVQDEGERTLLFDLDQSIQQLTPLVAPDDPRLVQLTGVYHNLLR
FT                   RWARP"
FT   gene            complement(545372..546499)
FT                   /locus_tag="Dtpsy_0529"
FT   CDS_pept        complement(545372..546499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0529"
FT                   /product="(S)-2-hydroxy-acid oxidase"
FT                   /EC_number="1.1.3.15"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: ajs:Ajs_0513 (S)-2-hydroxy-acid
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32009"
FT                   /db_xref="GOA:B9MCK9"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCK9"
FT                   /inference="protein motif:PRIAM:1.1.3.15"
FT                   /protein_id="ACM32009.1"
FT                   /translation="MGKRWQLSNLMTPHIPAGVWNAIDYERLAPQHMDAGRLAYVAGGC
FT                   GWDRTVAANCAAFAAWAIVPRLLRDVRGGHTRLTLGGLDLPHPLLLAPVAHQRLAHSEA
FT                   EVATARAAQATGTCLVASTLSSCTLEAIAGAAGPARWFQLYLQPEREHTLALLRRAEAA
FT                   GYRAIVLTLDASIQLASRSALQAGFVMPADCTPANLAAYPPPAPPVLGADDSRIFQGAM
FT                   RHAPTWDDLRWLLGETRLPVWIKGVMHSDDARALQAAGAAGLIVSNHGGRSLDGAPASL
FT                   HRLPAVRAAVGEGYPVLLDGGVRSGADAFKALALGADAVLIGRLQMYALAVAGALGVAH
FT                   MLQLLTEELHACMAQAGCAQLCDITPNCLTPQPPC"
FT   gene            complement(546522..548825)
FT                   /locus_tag="Dtpsy_0530"
FT   CDS_pept        complement(546522..548825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0530"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: ajs:Ajs_0514 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32010"
FT                   /db_xref="GOA:B9MCL0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCL0"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACM32010.1"
FT                   /translation="MPSSPLKKPKSLRMAAALLPLSAIAQVQPTPAPVTTLPTVTVQEQ
FT                   AIDPNPNAEVGAPYKAKTSADTRHTRPLAETPQTIQVVTGEAIRDSGATDLKQILAAQP
FT                   GITLGTGENGNAFGDRYIIRGQEARSDVFVDGLRDPGMTTRESFAIEQVEVTKGPNSSF
FT                   AGRGSAGGAVNAVTKQATLDYDFTRVSAGVGTDSHHRVTLDMNKGFTDKFALRANALTS
FT                   GEDVPGRSPSQRRRDGLALSGLWELNQDLSVTLDYYGLRAKDKHPDLGGYLVGTVPNRR
FT                   PATGVPVYAQNSDFLNSDVDTVTARIAYRFAPDLKLTSLTRYGQSDNRYATTGASNGTV
FT                   LDAANNPIGTAGVLDGGHTGWQDVKYFAHQSNLRWDKQIGSLKHEFIFGFEYTDHKVKS
FT                   GNYGVTNTGATNCRVSGRNGPQAGWCITDLNGNPVSNLGDLAGRSYERRSWTRDWRVKT
FT                   FALSAMDTVDLTDQWTVFGGLRADHYDLSLDTRNNQTGAITGNYGFNDTLLNGHLGVSY
FT                   KINPMGMVYASYGTAQDINGGEPDTGTSSGYGGLVIHNGSAAGAKPETSQNIELGTKWN
FT                   LLDDKLLATAAVFQTTKDDVMEGANYDTEGTFNTGKNRVRGIELGLAGNLTKNFQLQAG
FT                   AAIMKSKVLRSAVASNVGNPLSNFADRSFTVQGKYQLTRDFSFGAVARYESSRCGGQPD
FT                   TGAGYTNGMCSQPVPSFSVYDLFASYRINKHADLRLNVLNVTDKDYYTAVYRSGAFLYK
FT                   GDGRAVRLTLNLDL"
FT   sig_peptide     complement(548748..548825)
FT                   /locus_tag="Dtpsy_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.850 at
FT                   residue 26"
FT   gene            complement(549066..549992)
FT                   /locus_tag="Dtpsy_0531"
FT   CDS_pept        complement(549066..549992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0531"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ajs:Ajs_0515 beta-lactamase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32011"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCL1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACM32011.1"
FT                   /translation="MPLVPPALPPEIIVIERGWLSASNVLLLGRDCTALVDSGYCAHAP
FT                   QTVALVESALDGRVLDQLLNTHLHSDHCGGNAALQARWPQLATRIPPGQWAQVQDWDPV
FT                   ALSYVPTGQECPRFRADGVLPPGTEVQLGDRAWQVHAAPGHDTHAVVLFEPHARVLISG
FT                   DALWENGFGVVFPELDGEQAFAEVGATLGLIERLDPLTVIPGHGSVFGDVPAALARARR
FT                   RLAGFEADPVKHARHAAKVLLKYKLLEWQQAPLAQVHAWLAATPYFGMLHQRHFAQQTA
FT                   SVWAEQLMQELVDAGAARREGRALLNA"
FT   gene            complement(550027..551712)
FT                   /locus_tag="Dtpsy_0532"
FT   CDS_pept        complement(550027..551712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0532"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0516 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32012"
FT                   /db_xref="GOA:B9MCL2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCL2"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACM32012.1"
FT                   /translation="MERIWLKNYPAGVPHDVDADAYPSVAQMLEESFHRHADSPFSVCM
FT                   DRWMSYRELDRLSARLGAWLQGQGLAPGARVAIMLPNVPQFAVTMAAVLRAGYTCVNVN
FT                   PLYTARELEHQLKDSGATAIVILENFAHTLAEVIDHTAVQHVAIASMGDLLGAWYGRWI
FT                   TFAVRHLAKMVPAYELPLTGGRQVISFKRALALGERRTLTPARVAPDTPAFLQYTGGTT
FT                   GLSKGAVLTQRNIVAATLQAEAWFTPALGKIGDLSRANSIAALPLYHIFALTLCLLAIR
FT                   QGSRLTLIPNPRDIPKFVEVLKKRPFHMLPAVNTLFNALLQNPQFRHLDFSQLCVAQAG
FT                   GMAATEATAQQWKAVTGATMIEGWGMSETCAIGTNNPVNSTAFSGSIGLPLPGIDIAIK
FT                   DDAGASLPIGSAGEICIKGPNVMPGYYNQPEENAKAFTPDGFMRTGDIGVMDEEGYTRI
FT                   IDRKKDMILVSGFNVFPNELEQVVALCPGVLECAAVGVADDKQGEAIKVFVVRSDPSLT
FT                   EDDVVRYCHEHLTGYKRPKYIEFRDELPKTNVGKILRRELRDGK"
FT   gene            551853..552764
FT                   /locus_tag="Dtpsy_0533"
FT   CDS_pept        551853..552764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0533"
FT                   /product="PGAP1 family protein"
FT                   /note="PFAM: PGAP1 family protein; KEGG: ajs:Ajs_0517 PGAP1
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32013"
FT                   /db_xref="GOA:B9MCL3"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCL3"
FT                   /inference="protein motif:PFAM:PF07819"
FT                   /protein_id="ACM32013.1"
FT                   /translation="MTNARWQRWAVAVHLLLIAGWMAWFWGRSPALALAGVAAVPLMFR
FT                   LGMAPQFFLMAWVCRGDATPRPRAGQLLRAWWAESRWASLVFGWWQPFRHQAVADWLPP
FT                   RASDVPGPRGVVLVHGFLCNRGFWTPWLALLRARGHAFVAVTLEPAFGSIDDYCRTIDD
FT                   AVRRVAEATGRAPLIVGHSMGGLAARAWLRAVPGSEQRVHRIVTLGSPHHGTWPARGAR
FT                   STNGRQMRLHGPWVRQLGQDEPPARAAVFVCWYSNCDNVVYPPAAAMLQGADNRFIEGV
FT                   AHVEMAFHPRVLQDCLALLEQP"
FT   sig_peptide     551853..551954
FT                   /locus_tag="Dtpsy_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.698 at
FT                   residue 34"
FT   gene            complement(552783..553622)
FT                   /locus_tag="Dtpsy_0534"
FT   CDS_pept        complement(552783..553622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0534"
FT                   /product="phenylalanine-4-hydroxylase"
FT                   /EC_number="1.14.16.1"
FT                   /note="KEGG: ajs:Ajs_0518 phenylalanine 4-monooxygenase;
FT                   TIGRFAM: phenylalanine-4-hydroxylase; PFAM: aromatic amino
FT                   acid hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32014"
FT                   /db_xref="GOA:B9MCL4"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCL4"
FT                   /inference="protein motif:TFAM:TIGR01267"
FT                   /protein_id="ACM32014.1"
FT                   /translation="MGQAPVVYGQSSRPPRGDYSRAQEDYTCAQNFAAYTAADHDTYHR
FT                   LYQRQSAQLQGLASEAFIQALPLLGAKERIPRFDDVNERLYRATRWELVAVPGLIPEVP
FT                   FFSLLANRKFPVTDWIRTPQEFDYIVEPDVFHDLFGHVPLLFNPVFADYVQRYGEGGLK
FT                   AAGLGACEMLSRLYWYTIEFGLIREQGGLRAYGAGILSSRGELPYAVHSPEPQRLPLEL
FT                   ERTMRTRYKIDTYQQTYFVIDSFEQLFELTAQDFAPIYERLRGQPEFAADAREPLPA"
FT   gene            complement(553708..554637)
FT                   /locus_tag="Dtpsy_0535"
FT   CDS_pept        complement(553708..554637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32015"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCL5"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACM32015.1"
FT                   /translation="MHGLRRTGTERIRPMTIVVPYAAGGPLDKSARILAEGAQAQLRPI
FT                   QVQNKPGAGGNLGADTVAKAPKSGNLLVMGAVATHAVNPWLYKNFPYNPVKDFTPIVLV
FT                   ARTPNVLVMSAERAKALDISTTTDLVKYMKAHPDQLKYGSGGNGSIGHIAGEMFKSLTN
FT                   TRMPHAPFQGAGPALKALQDGGVDIVFDNLASSLPLIQGGKLKALGVTSLGSDDALPHV
FT                   PSINSEVPGFNVSTWFGLFAPATLPAADAQKYATAFSKAMHSPAGKAQFQKMGLTPEEL
FT                   TLGGFGSFVRSELGKYEFLIKAAKIHID"
FT   gene            complement(554766..555884)
FT                   /locus_tag="Dtpsy_0536"
FT   CDS_pept        complement(554766..555884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0536"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="KEGG: ajs:Ajs_0520 4-hydroxyphenylpyruvate
FT                   dioxygenase; TIGRFAM: 4-hydroxyphenylpyruvate dioxygenase;
FT                   PFAM: Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32016"
FT                   /db_xref="GOA:B9MCL6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCL6"
FT                   /inference="protein motif:TFAM:TIGR01263"
FT                   /protein_id="ACM32016.1"
FT                   /translation="MTAALPLRATHDADAWENPMGLMGFEFVEFTSPTPGLLEAVFEKL
FT                   GFTLVARHRSKDVLLYRQNQINFILNREPASQAAYFGAEHGPSACGLAFRVKDSHQAYR
FT                   RALELGAQPIEIPTGPMELRLPAIKCIGGAPLYLIDRFEDGKSIYDIDFDFLPGVDRRP
FT                   VGHGLNEIDHLTHNVYRGRMGFWANFYEKLFNFREIRYFDIQGEYTGLTSKAMTAPDGK
FT                   IRIPLNEEAKQGGGQIEEFLMQFNGEGIQHIALICDSLVEVVDKLGLASVPLAPAPNDI
FT                   YYDMLDTRLPGHGQNVAELQARGILLDGTTADGTPRLLLQIFSTPMLGPVFFEFIERQG
FT                   NYREGFGEGNFKALFESLERDQIRRGVLQTQA"
FT   gene            556070..556555
FT                   /locus_tag="Dtpsy_0537"
FT   CDS_pept        556070..556555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0537"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: ajs:Ajs_0521 AsnC
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32017"
FT                   /db_xref="GOA:B9MCL7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCL7"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACM32017.1"
FT                   /translation="MSERTPALDKLDRAILRRLQDNGRETYDVIGEQVGLSPSAVLRRA
FT                   KRLEEEGVIDRYVALVRPERVGLGLTAYLNVRLEKHTESHKRNPMDLFRASVQTWPEVV
FT                   ECASLTGEMDYLLRVVVADMAHYSRFIMDTLLKHPSVQDCKTSFVLDRVKATTALPV"
FT   gene            556832..557464
FT                   /locus_tag="Dtpsy_0538"
FT   CDS_pept        556832..557464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0538"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ajs:Ajs_0522 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32018"
FT                   /db_xref="GOA:B9MCL8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCL8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACM32018.1"
FT                   /translation="MNTVMVPIRSLGPQHRERIAAHLLRLEPRDRYLRFGYAANDDQVR
FT                   RYAELLDFSRDEVFGIFNRRLELIAMAHVAFAPSGEYESCAEFGVSVSATARGRGYGAR
FT                   LFERAVMLARNRGVSMMFIHALTENTAMLKIARNAGATVRRDGSESEAYLQLPPARFDT
FT                   RVSEIMAEHFGEVDYQLKKQARQFWRFLADLQEIRQGVRDGRHQAAE"
FT   gene            557547..558425
FT                   /locus_tag="Dtpsy_0539"
FT   CDS_pept        557547..558425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0539"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: ajs:Ajs_0523 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32019"
FT                   /db_xref="GOA:B9MCL9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCL9"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACM32019.1"
FT                   /translation="MSDPHPARASDKEDKRTFLQRLVEFINPGPDSTAELIATLAEAED
FT                   NDVINADARVMLERVLRMAEMTAGDVLVPAPRMDMLDIDAPVDELMHQVLHTAHSRFPV
FT                   YQGERDNIIGILLAKDLLKLWRSPGLNVRTLVRPALFVPESKGLHDLGREFRNTRNHMA
FT                   IAIDEFGRIAGLVTFEDVIEQIVGEIEDEFDIPEDEGDIFGLADRTFRVSGDTPVERVA
FT                   EAFGVALQGSDPDESFDTIGGLIAHELGRMPRKGESVVLGGLQFVVMHTKGGSVRWFKV
FT                   APAAGTPESER"
FT   gene            558425..560023
FT                   /locus_tag="Dtpsy_0540"
FT   CDS_pept        558425..560023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0540"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: ajs:Ajs_0524 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32020"
FT                   /db_xref="GOA:B9MCM0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCM0"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ACM32020.1"
FT                   /translation="MAVAPPLAAHAPRRGPLPWVLALVAGLAQAASLAWPWGGQPLWWL
FT                   QILSLGLWAHVLLGAGGTRRAGLLGWVFATAWLAGTFWWLFISMHTYGGLAAPLAVLAV
FT                   LGLAAFLGSYYAAVSACFWALAPVHRALAAIVFAALWLLAELARGQWWTGFPWGAGGYA
FT                   HVQGPLAALARSVGVYGIGAAAALLAMLLAQARRADLRNARAWALVLALTAVGAGAAWQ
FT                   RHCAVEGCGAPPPVHAPLSLALLQGNIPQDEKFQPGSGVPMALQWYYDQIHAAKASLVV
FT                   APETAIPLLPQQLVPGYLEGMAERYAAGGQALLLGIPLGSLEEGYTNSVLGFAPEQSQP
FT                   YRYDKHHLVPFGEFIPPFFRWFTEMMNIPLGDFNRGAVGQPSLAWAGERIAPNICYEDL
FT                   FGEEIGVRFLDPASSPTILVNLSNIGWFGNTVAVDQHLAISRLRALEFERPMVRATNTG
FT                   ATAVIDHRGQVTHRMPAYQRGVLRAQVQGRGGAATPYARWVARWGLWPLWALGFAVAGL
FT                   AWCLRGRTGRARAGN"
FT   sig_peptide     558425..558517
FT                   /locus_tag="Dtpsy_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.708) with cleavage site probability 0.661 at
FT                   residue 31"
FT   gene            560207..560731
FT                   /locus_tag="Dtpsy_0541"
FT   CDS_pept        560207..560731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0541"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /note="KEGG: ajs:Ajs_0525 3-hydroxydecanoyl-(acyl carrier
FT                   protein) dehydratase; TIGRFAM:
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32021"
FT                   /db_xref="GOA:B9MCM1"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCM1"
FT                   /inference="protein motif:TFAM:TIGR01749"
FT                   /protein_id="ACM32021.1"
FT                   /translation="MADSFSYEQLIASGEGRLFGPDSGRLPLPPMLMFDRITHIDTDGG
FT                   AHGLGKIVAELDVKPDLWFFACHFQGDPVMPGCLGLDAMWQLIGFYLTWLRLPGRGRAL
FT                   GAGEVKFTGEVGPDVKLVTYEIDIKRVIKRKLNMAIGDARLLADGKEIYVANDLRVGLF
FT                   LREGDAQGSAA"
FT   gene            560728..561951
FT                   /locus_tag="Dtpsy_0542"
FT   CDS_pept        560728..561951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0542"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: ajs:Ajs_0526
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32022"
FT                   /db_xref="GOA:B9MCM2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCM2"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ACM32022.1"
FT                   /translation="MTKKRVVITGAGIVSCIGNDLQTVEEALRASRSGIKAVPQFTELG
FT                   LRSQVAGVPEIDVEARIDRKQLRFMGDAAAYAQIALEDAIQQAGLTPEQVSHPRTGLIM
FT                   GSGGGSPANQIEAADTLREKGIRRVGPYQVTRCMSSTVSACLATNFKVKGINYSITSAC
FT                   STSAHCIGAAAQQIAWGLQDVMFAGGGEELSWGMSLLFDGMGAMSSKYNATPEKASRAY
FT                   DANRDGFVIAGGGGAVVLESLEHALARGATILGEVVGFGATSDGEDMVAPSGDGAIACM
FT                   QQAMEGLGAPIDYINTHGTSTPVGDMQEVRAMQAVFGEAVPPFSSTKSLTGHSLGATGV
FT                   QEAIYCLIMLNKGFIAGSANVETPDPLLGSMPLVTQTRDAQLTHVLSNSFGFGGTNASL
FT                   VLRRWQGQ"
FT   gene            562058..563011
FT                   /locus_tag="Dtpsy_0543"
FT   CDS_pept        562058..563011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0543"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: ajs:Ajs_0527 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32023"
FT                   /db_xref="GOA:B9MCM3"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MCM3"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ACM32023.1"
FT                   /translation="MLTFQQIILKLQSYWADQGCALLQPYDMEVGAGTSHTATFLRALG
FT                   PEPWKAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPDNILELYLGSLEALGFDL
FT                   KKNDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLE
FT                   RLAMYLQGVDNVYNLTWTEGPNGAKLTYGDVYHQNEVEQSTYNFEHSDAEFLFTAFGAH
FT                   EKQANHLMGEQLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVAKAY
FT                   LDSRARLGFPMAPKAHADEVLAELAKAAEQQNKKAA"
FT   gene            563042..565204
FT                   /locus_tag="Dtpsy_0544"
FT   CDS_pept        563042..565204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0544"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: ajs:Ajs_0528 glycine--tRNA ligase; TIGRFAM:
FT                   glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32024"
FT                   /db_xref="GOA:B9MCM4"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MCM4"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ACM32024.1"
FT                   /translation="MNHQNLLVELFVEELPPKALQKLGDAFAGVLLEQLQAQGLTSAHS
FT                   QLTAFASPRRLAAHITEVLPAAADKAVSQKLMPVAVGLDASGQPTPALLKKLAALGADA
FT                   ASVPQLKRVHDGKAEVLFFESMAKGALLADGLQKALDEAIAKLPIPKVMRYQLQDGWTS
FT                   VHFVRPAHGLVALHGSEVLVGVQALGLTAGNTTHGHRFEASVDPVVIQSADSYAEQLRS
FT                   EGAVIASFAERRAEIARQLQAAADRVGGGVRPIDDDALLDEVTALVERPNVLVCEFEKD
FT                   FLAVPQECLILTMKANQKYFPLLDAEGKLTHQFLVVSNISPQDASAVIQGNERVVRPRL
FT                   ADAKFFFDQDRKKTLVSRVDQLAKVVYHNKLGTQGERVERVRHIAKAIATQLFTALAQG
FT                   NAALDSQEGEIAQDYLLTCVDNAALLAKTDLVTDMVGEFPELQGIMGGYYAVSDGLPDE
FT                   VAHAIEDHYKPRFAGDALPRENVGVVVALADKLETLVGMFGIGNLPTGDRDPFALRRHA
FT                   LGVIRMLVEKELPLDLDALLASAVPAFGDKIEDTSAQLADFIYDRLAGSLREQGYSAQE
FT                   VDAVIALRPQRLALVPRQIEAVRAFATLEQAPALAAANKRVTNILKKAGEVDPHVNEEL
FT                   LQEPAEKDLYAALQRFVPEANAQFDSGDYTASLQTLAVLRAPVDAFFDDVMVNAEELAL
FT                   RLNRQGLLKKLHMAMNRVADLSRLAV"
FT   gene            565289..565864
FT                   /locus_tag="Dtpsy_0545"
FT   CDS_pept        565289..565864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0545"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; KEGG:
FT                   ajs:Ajs_0529 D-alpha,beta-D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32025"
FT                   /db_xref="GOA:B9MCM5"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCM5"
FT                   /inference="protein motif:TFAM:TIGR01656"
FT                   /protein_id="ACM32025.1"
FT                   /translation="MKLAILDRDGTLNALGDGFIASPDEWVPVPGALEAVARLNHAGWH
FT                   VVVATNQPGLGRGLFDAQTLVAIHAKMHRQLATLGGRIDAVFYCPHTESEQCHCRKPAP
FT                   GLMEQIRDRYGAEGQEILVAGSSAAHLQAASELGAQLHMVCTGRSAHLDPRQSLPPGWP
FT                   AGTRAHASLGALADFIAPQNGASLPVAL"
FT   gene            565942..566691
FT                   /locus_tag="Dtpsy_0546"
FT   CDS_pept        565942..566691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0546"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: ajs:Ajs_0530
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32026"
FT                   /db_xref="GOA:B9MCM6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCM6"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACM32026.1"
FT                   /translation="MALIRSILHLLVMVVTVVPYTLGILLVRVLGGSPAARYRVARAWL
FT                   KLCIDSARWLLGIRTQITGMEHLPQGEQQGAVLLVKHQSTYETFLMPAIMPHPLAYVFK
FT                   KELLSVPFFGWSIGSLDMIHIDRGQRARAFAKVLQQGRRLLAKGTWVIMFPEGTRTERG
FT                   AKGDYKSGGTRLAIDAGVPVVPIAVTSATVWPRKAFIKRPGVVHVSVGRPIPTEGRKPD
FT                   ELMREVEAWIEGEMRRLDPDAYPPTAG"
FT   gene            566693..567613
FT                   /locus_tag="Dtpsy_0547"
FT   CDS_pept        566693..567613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0547"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   ajs:Ajs_0531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32027"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCM7"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ACM32027.1"
FT                   /translation="MQRLVQLALDFLGGGSSPDSGVPQPKRAMAPVQQAPEAPLLVAPA
FT                   PPLGDLLTPAVFRHPAASREVLLGDAVVAYALQRARRRSIGFTVGPEGLSVRAPSWVTL
FT                   AGVDAALRDKAPWILRKLGEQQARRQQEERARIVWGDGAVLPYLGEPLTVVLDPTHGFA
FT                   ARGGALEEQGGATGRALRIALARSAAPAQVRDAVQAWLMRDARRCFTERLHHFAPLLDV
FT                   RWTRLRLSSANTRWGSARADGSIRLNWRLMHYRPAIIDYVVAHELSHLRVMDHSPRFWD
FT                   TVATVVPDYAALRRSLREQPAPPWD"
FT   gene            567643..568092
FT                   /locus_tag="Dtpsy_0548"
FT   CDS_pept        567643..568092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0548"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: ajs:Ajs_0532
FT                   rhodanese domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32028"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCM8"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ACM32028.1"
FT                   /translation="MAAMNTPTPDLHASEQPLPAEGYAGDVSPPLAWQWVRAGQAVLVD
FT                   VRTDAERDWVGFVPGAVAAAWKQWPGMQPNADFDAQLRAAVPPGGTAVLLCRSGVRSVA
FT                   AARRATELGIKAYNILEGFEGEPDENGQRNRRSGWRFRGLPWRQG"
FT   gene            complement(568189..568677)
FT                   /locus_tag="Dtpsy_0549"
FT   CDS_pept        complement(568189..568677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0549"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM;
FT                   transport-associated; SMART: Peptidoglycan-binding LysM;
FT                   KEGG: ajs:Ajs_0533 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32029"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCM9"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACM32029.1"
FT                   /translation="MGLFSFIKEAGEKLFGGKDAQASTATAPTQAELNDKAGKAIEAYI
FT                   ASQNLGVSDVQVHFEGPEGKVTVKGTAPTQAAKEKVTLCCGNVASVTSVDNQMSVTNPE
FT                   PEAQYHDVVRGDTLSAIAKKFYGDANKYPVIFEANKPMLTHPDKIYPGQKLRIPPLAK"
FT   gene            568834..569610
FT                   /locus_tag="Dtpsy_0550"
FT   CDS_pept        568834..569610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0550"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: ajs:Ajs_0534 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32030"
FT                   /db_xref="GOA:B9MCN0"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9MCN0"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACM32030.1"
FT                   /translation="MTFLAIDVGNTRLKWALFDAAQPGAGLLAHGAEFLDHIERLAEGP
FT                   WSHLPAPRHMLGCVVAGDAVKRRVAEQMELWDVPARWVVPSAQEAGVINGYDHPTRLGA
FT                   DRWVAMIGARHRLLAQGPARPLIVVMVGTAVTVEALDAEGRFLGGLILPGHGIMLRALE
FT                   SGTAGLHVPTGEVRLFPSNTSDALTSGGTYAIAGAVERMYQHLRQHCGQEPACMMTGGA
FT                   GWKMAPSMTRPFELVENLIFDGLLEIAARRFAELPA"
FT   gene            complement(569632..570294)
FT                   /locus_tag="Dtpsy_0551"
FT   CDS_pept        complement(569632..570294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0551"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ajs:Ajs_0535
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32031"
FT                   /db_xref="GOA:B9MCN1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCN1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACM32031.1"
FT                   /translation="MAKKAPRRTAERILESSLALFNRFGEPNVSTTAIAADLHISAGNL
FT                   YYHYPAKDEIVNALFARYDEALSGLLHAGADVQDVEDAWFFMHTLFELIWQYRFFYRDL
FT                   NNLLSCNRRLEEQFPVLLQAKTAAMHDLLQALRRRGALQMEPADAMQPTATSMVVVLTY
FT                   WLSFEYVRAPRQALEPESAQAALLHGARHVLGLLMPYLEPTQRAHLARLVGAYDQAA"
FT   gene            complement(570387..570860)
FT                   /locus_tag="Dtpsy_0552"
FT   CDS_pept        complement(570387..570860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0552"
FT                   /product="poly(hydroxyalkanoate) granule-associated
FT                   protein"
FT                   /note="TIGRFAM: poly(hydroxyalkanoate) granule-associated
FT                   protein; PFAM: poly granule associated family protein;
FT                   KEGG: ajs:Ajs_0536 poly(hydroxyalkanoate)
FT                   granule-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32032"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCN2"
FT                   /inference="protein motif:TFAM:TIGR01837"
FT                   /protein_id="ACM32032.1"
FT                   /translation="MPRVPPDDDTDPAREFPRMARESAQQIWLAGLGAFAKAQAEGGKV
FT                   FEALVREGMALQRKTQDTAQEHWGEAAQRMGQMASGLGERAAGQWDRLEGIFEERVSKA
FT                   LQRLGVPTAQEVQALHERIDALTQELQALQERQADRDGMTTAPPPSRPSTHEG"
FT   gene            571044..572111
FT                   /locus_tag="Dtpsy_0553"
FT   CDS_pept        571044..572111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0553"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: ajs:Ajs_0537 dTDP-glucose
FT                   4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32033"
FT                   /db_xref="GOA:B9MCN3"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCN3"
FT                   /inference="protein motif:TFAM:TIGR01181"
FT                   /protein_id="ACM32033.1"
FT                   /translation="MILVTGGAGFIGANFVLDWLAVGDEPVVNLDKLTYAGNLHNLDSL
FT                   QGDASHVFVQGDIGDRTLLDRLLAEHQPRAVINFAAESHVDRSIHGPEDFIQTNVVGTF
FT                   RLLEAVRHYWQALPATQKEAFRFLHVSTDEVYGSLAPAAAAFTEEHNYEPNSPYSASKA
FT                   ASDHLVRAWHHTYGLPVLTTNCSNNYGPLHFPEKLIPLMIVNALAGKSLPVYGDGMQIR
FT                   DWLYVKDHCSAIRRVLQAGRLGETYNVGGWNEKPNIDIVNTVCALLDELRPRSDGQSYT
FT                   TQITYVTDRPGHDRRYAIDARKLERELGWKPAETFETGIRKTVQWYLDHPEWVAQVQSG
FT                   AYREWVQKQYEGAAA"
FT   gene            572108..572998
FT                   /locus_tag="Dtpsy_0554"
FT   CDS_pept        572108..572998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0554"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="KEGG: ajs:Ajs_0538 dTDP-4-dehydrorhamnose reductase;
FT                   TIGRFAM: dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32034"
FT                   /db_xref="GOA:B9MCN4"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCN4"
FT                   /inference="protein motif:TFAM:TIGR01214"
FT                   /protein_id="ACM32034.1"
FT                   /translation="MNILLLGKSGQVGWELQRSLAVLGRVTALDHDSTEHCGDFANPEG
FT                   VRETVRALRPDVIVNAAAHTAVDKAESEPEIARLLNATTPGVLAEEAARLGTWLVHYST
FT                   DYVFDGSGTRPWVETDAPAPLSVYGATKLEGEQRIQQTGCRHLILRTSWVYAARGGNFA
FT                   KTMLRLGSERERLTVIDDQWGAPTGADLLADVTAHAVRHLQSRPGDGGLYHCVASGETN
FT                   WHSYAKYVLEHARQAQPAIELKATEVAPVPTSAFPTPARRPHNSRLDTTRLQTTFGLVL
FT                   PPWQQGVARMLTEIL"
FT   gene            573019..573909
FT                   /locus_tag="Dtpsy_0555"
FT   CDS_pept        573019..573909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0555"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: ajs:Ajs_0539
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32035"
FT                   /db_xref="GOA:B9MCN5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCN5"
FT                   /inference="protein motif:TFAM:TIGR01207"
FT                   /protein_id="ACM32035.1"
FT                   /translation="MTTPTRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLST
FT                   LMLAGIREILIISTPQDTPRFEQLLGDGSQWGLQLQYAVQPSPDGLAQAFLIGEDFLAG
FT                   SPSALVLGDNIFYGHDFHELLANAMARPQGASVFAYHVHDPERYGVAEFDASGKVLSLE
FT                   EKPQKPKSSYAVTGLYFYDSQVVELAKGLQPSPRGELEITDLNRLYLEQGQLSVEIMGR
FT                   GYAWLDTGTHDSLLDASQFIATLEQRQGLKIACPEEIAWRSGWIDAARLERLAQPLAKN
FT                   GYGQYLQRLLKETVY"
FT   gene            573909..574454
FT                   /locus_tag="Dtpsy_0556"
FT   CDS_pept        573909..574454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0556"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: ajs:Ajs_0540 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32036"
FT                   /db_xref="GOA:B9MCN6"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCN6"
FT                   /inference="protein motif:TFAM:TIGR01221"
FT                   /protein_id="ACM32036.1"
FT                   /translation="MKATRLAIPEVVLIEPQVFGDARGFFFESFNQKTFNEATGTNHQF
FT                   VQDNHSRSSQGVLRGLHYQIQQPQGKLVRVARGKVWDVAVDIRKSSPTFGQWVGAELSE
FT                   DNQHQLWVPPGFAHGFVVLSESADFLYKTTDYYAPEHERCIAWNDEALTISWPVSITPI
FT                   LSAKDQLGAALCDAEVFK"
FT   gene            574468..575601
FT                   /locus_tag="Dtpsy_0557"
FT   CDS_pept        574468..575601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0557"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pol:Bpro_4016 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32037"
FT                   /db_xref="GOA:B9MCN7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCN7"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACM32037.1"
FT                   /translation="MRVLQFGRFWNVEHGGLERHVTLLGQGLAGQGVEVVNLVAASGLV
FT                   SSDETRGLYRLVRAPSFGMAYGTALSPALPLKALALHREQPFDLFHLHLPDPLSHLASI
FT                   LLPSNVPRVISWHSDIVRQKRLLKLYKPSLSRLVCQADALVAATQAHFDSSTQIPDCVP
FT                   LARRHVIPYGLDYAPLQLNARTMALRDELRSRAGGRGLVFAMGRHVYYKGFDVLIRALE
FT                   LTDAFLVLGGNGPLRTSLEQQVAAMGLSDRVYFSGRIPEEDLSAYFHACDVFCLPSVEP
FT                   SEAFGLVQLEAMACGKPVVCTQLGNGVNVVNVHGQTGFAVPVGDPVALGHCLARLLRDK
FT                   TLCQILGAQGLHRTELYSVSAMTASHIKLYEELLSTR"
FT   gene            complement(575574..576719)
FT                   /locus_tag="Dtpsy_0558"
FT   CDS_pept        complement(575574..576719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0558"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pol:Bpro_4015 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32038"
FT                   /db_xref="GOA:B9MCN8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCN8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACM32038.1"
FT                   /translation="MIRVAFNATSLLSPLTGIGQYSRQLALGLAYHEGIDADFFYGAAW
FT                   SKKVRGAPLPGPAGLVPWLRSHVPYSYALRRLVQNNRFAQYASTRAFDLYHEPNILPLP
FT                   FDGPTVITVHDLSWIRYPEAHPPERVRAMHKYFQPGLERASLVLTDSEFVKRELMDVFG
FT                   VKPARICPVLLGVEAAFHPRSAGETQAVLDTHRLVHGQYLLAVGTLEPRKNLAVALQAF
FT                   MQLPSPLRQRFPLVLVGMKGWHTSALEQQLVHLLAAGEVRQLGYLPRADLAAIIAGATT
FT                   LIYPSVYEGFGLPPLEAMACGVPVITSNVSSIPEVVGDGGFMLAPQDVDGFATAMETLL
FT                   SAPDVRDRMAHRALARSAHFTWDRCISQTVEAYYRVLSSSS"
FT   gene            complement(576716..577543)
FT                   /locus_tag="Dtpsy_0559"
FT   CDS_pept        complement(576716..577543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0559"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: pol:Bpro_4014 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32039"
FT                   /db_xref="GOA:B9MCN9"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCN9"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ACM32039.1"
FT                   /translation="MTSHSPTSPRLTPSRAGAQILQAHLGTGGDIFYLSPRSPVGSVPI
FT                   RGGVPVLFPQFADRGPLPKHGLARTALWALVQESKSDEAHSAVFELALAPRPLGVWPHA
FT                   AHLILQAEASLHGLRLCLQITNTGSSAFSWTGGLHPYFAVDDVQTCSLTGLAGLRVQDR
FT                   YDPCLSTEPGGAPNWNGQPVERLYGACPPLTLFTGSRALAITANGFEQWMVWNPGHDGG
FT                   DALPDLPTGDWRRFVCIEPVCVSHPVSLLPGQVFTGTLDIRVLPYAPTSGESA"
FT   gene            complement(577556..578422)
FT                   /locus_tag="Dtpsy_0560"
FT   CDS_pept        complement(577556..578422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0560"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: pol:Bpro_4013 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32040"
FT                   /db_xref="GOA:B9MCP0"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCP0"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACM32040.1"
FT                   /translation="MRILLTGANGFTGRPFAEAARAAGRVVVPLKANLADRDALRHEVL
FT                   ETRPDAVVHLAAISFVGHADDGAFYAVNTVGTCNLLVALAALPNRPQKVLLASSANVYG
FT                   NCDASPIDETQPPAPVNHYAMSKLAMEHMARTYANRLPLVITRPFNYTGPGQNVNFVIP
FT                   KLVDHFARKAASIALGNLHVEREFNDVQMVCNAYLQLLEHGEPGEAYNVCSGQPYTLQH
FT                   VIDTLSRITGHAMHVEVNPAFVRANEVHRLCGSPAKLQALLVKQGYASTNPPLEDTLQR
FT                   MLSAAGA"
FT   gene            complement(578419..579459)
FT                   /locus_tag="Dtpsy_0561"
FT   CDS_pept        complement(578419..579459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0561"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: pol:Bpro_4012
FT                   GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32041"
FT                   /db_xref="GOA:B9MCP1"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCP1"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ACM32041.1"
FT                   /translation="MNNKQAIITGITGQDGAYLTQLLLDKGYTVYGTYRRTSSVNFWRI
FT                   EELGIQNHSKLHLIEYDLTDLGASIALVQKVQPDEIYNLAAQSFVGVSFDQPSTTAQIT
FT                   GIGALNLLEAIRLVNRKIRFYQASTSEMFGKVQAIPQVEDTPFYPRSPYGVAKLYAHWM
FT                   TVNYRESYDIFGSSGILFNHESPLRGREFVTRKITDSVAKIKLGKLDVLELGNLDAKRD
FT                   WGFAKEYVEGMWRMLQADEPDTFVLATNRTETVRDFVRMAFKGAGITVDFKGSAESETA
FT                   VDTTSGKTVVRVNPKFYRPAEVDLLIGNPAKAKAKLGWEPKTTLEQLCQMMVEADLRRN
FT                   QAGFSF"
FT   gene            complement(579679..581529)
FT                   /locus_tag="Dtpsy_0562"
FT   CDS_pept        complement(579679..581529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0562"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; glycosyl
FT                   transferase group 1; KEGG: cau:Caur_1741 glycosyl
FT                   transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32042"
FT                   /db_xref="GOA:B9MCP2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCP2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACM32042.1"
FT                   /translation="MPSKARTPIAIIILTWNGLALTRCCIETLHLDNLPDHVSVIVVDN
FT                   GSTDGSVEYLRSLPRLTLIENGQNLGYARAVNIGIRAAAPNADIVLLNNDVELIEPDWL
FT                   DRLSEVAASDPAIGVIGVKILRENGTLQHCGAYLPLDTMWGQQLGGGEVDIGQYAGVRD
FT                   AESVVFACALIKRAVIEKVGLLSEDFFAYFEDTDYCLRTELEGFRVVVCGDIRVRHAEN
FT                   SSTKINGVSHSAIFLKSQDTFKRKWGEYLGHTRYTSEMDWHSIVNFPSGYAGSSRSFIL
FT                   ALDQLGVSVAYKYVYGPGTVFPTSEPEHSDSYVVNMIRSREFGRADVQVVYAQGDVFAR
FT                   NTGKYRIGFTMLEVDGLPPEWVRQANMMDEVWVPSTFNERTFRDSGVKVPIRVVPLGVD
FT                   TAYFSPQIRSVKQPDVYTFLSVFEWGERKAPEVLLQAFSDEFSADEPVRLVCKANNFDP
FT                   SFRIFDKVAELALRSNGGRIVMAENQILQQYELAVLYRSADCFVLPTRGEGWGMPILEA
FT                   MACGLPVIATNWSSQTDFMTEQNSLPLEVERLVPAEAKCPYYEGFRWAQPSYEHLRKLM
FT                   RWTFEHQDEARAIGLRAAADAAQRWTWNASARHMINLISA"
FT   gene            complement(581519..582709)
FT                   /locus_tag="Dtpsy_0563"
FT   CDS_pept        complement(581519..582709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0563"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bac:BamMC406_0768 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32043"
FT                   /db_xref="GOA:B9MCP3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCP3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACM32043.1"
FT                   /translation="MTSDFYRTFEDKHRGTRDLITSRLRIYLPFVEPLLAYYPKGNAID
FT                   LGCGRGEWLELALAAGFDAIGIDLDVGMLAQCHARQLPVRQADALEVLRTLPADSHALI
FT                   SAFHVAEHLSFVQLELLVNESLRVLQPGGLLILESPNSENLMVGTSSFYLDPTHNRPVH
FT                   PQLLSFLMEYAGFARSQVLRLNEDPGLLSKRAIRLYDVLAGASPDFAVIAQKSAPTEIL
FT                   ATFDREFNAQHGLPIHRLANHYDELLDRRLERLDSRAQIQLKALSAEIDGLRGHVVYLE
FT                   SLLNQSHGTTRTQRVLTHVRSLAGRILRRSMPMLRTAVVRVPWAKHAALAVLRSSPRLA
FT                   NFIGRFLPPGQAPVPSTLSAPQHFEDLRSVRIMRAVSALPSSAQSVTFLEIGDHAK"
FT   gene            complement(582833..584053)
FT                   /locus_tag="Dtpsy_0564"
FT   CDS_pept        complement(582833..584053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0564"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bac:BamMC406_0767 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32044"
FT                   /db_xref="GOA:B9MCP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCP4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACM32044.1"
FT                   /translation="MGTISVSNLGKAYKQYPHRWSRLAEWILPGSKPRHTLKWVLQDIS
FT                   FTVNPGEAVGIIGMNGAGKSTLLKMITGTTQPTTGSVRMTGRVAALLELGMGFHPDFTG
FT                   RQNVFMAGQLLGYSVAEIELLMPEIEAFAEIGDYIDQPVRVYSSGMQVRLAFSVATARR
FT                   PDVLIVDEALSVGDVYFQHKSFERIRQFRTEGTTLLIVSHDKQAIQSICDRAILLNGGR
FT                   LAMEGEPEAVMDYYNALLADHQNQVVKQETREDGKLRTISGTGEATISDAWIADVNGQR
FT                   VEVVGVGQRVTLGVTAHCRSELPELVIGYMIKDRLGQPVFGTNTHHLNHKLHRLAAGTN
FT                   IQFEFSFDVNIGPGTYSVALALHAEQTHLGKNYEWRDLAVMFNVVNINKSEFVGLAWIP
FT                   PDVRCSA"
FT   gene            complement(584053..584844)
FT                   /locus_tag="Dtpsy_0565"
FT   CDS_pept        complement(584053..584844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0565"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mfa:Mfla_1269
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32045"
FT                   /db_xref="GOA:B9MCP5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCP5"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACM32045.1"
FT                   /translation="MTILKALWAYRGFILGSVKREFQSKYRNSLLGAAWTVINPLAMIV
FT                   VYTVIFAEIMRAKLPGVDKAFAYSIYLCAGILTWGLMTEIISRAQNTFIENANLLKKLS
FT                   FPRLCLPVIVVANAGLNFAIIFSLFTAFLLISGNFPGWPFIALLPLIVVLVVFAIGLGV
FT                   TLGVLNVFFRDVGQFFGIFLSFWFWLTPIVYTPSILPEELRPYMTLNPIASLIAAFQDV
FT                   LVAGQWPQWETLWPVTMLAVFFCMLGLWLFRRHAGEMADEL"
FT   gene            complement(584844..586274)
FT                   /locus_tag="Dtpsy_0566"
FT   CDS_pept        complement(584844..586274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0566"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /note="KEGG: pol:Bpro_3999 mannose-1-phosphate
FT                   guanylyltransferase (GDP); TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; PFAM:
FT                   mannose-6-phosphate isomerase type II; Nucleotidyl
FT                   transferase; Cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32046"
FT                   /db_xref="GOA:B9MCP6"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCP6"
FT                   /inference="protein motif:TFAM:TIGR01479"
FT                   /protein_id="ACM32046.1"
FT                   /translation="MHLVSVVLSGGSGTRLWPVSRQSYPKPFMQLGGSTLLGQAIGRGQ
FT                   DCGTDDLIIVTNQDYFFLSRNVVNELSDVPHTQYLLEPKGRNTAPAIALAALACARLHG
FT                   PEAVMLVLPADHLIPDTEAFVACALEAARHAQQGQLVVFGISPTGPETGFGYIEVEKPS
FT                   RHTQQALRFVEKPDLPTAQRYLASGRYYWNSGMFCFTAGAILQAMKEHAPEVLHATENA
FT                   WAASHTQDGATKFDARTFGLLPDISIDYAVMERARNVTLVPAKFGWSDVGSWPAVAQAH
FT                   PADTSGNTFVDGQRTEFVAVGTTGTHVQVESHGPKVVATVGVQDLVIVDTPDALLVAHK
FT                   SVAQKVKTVVDTLRDRRHDSTQLPAAVHRPWGTYATLKEEDGYKVKRITVNPGQALSLQ
FT                   YHHQRAEHWVVVQGTAMVQIGEDEHHTLPGQYRYIPLKEKHRLTNIGQDELVLIEVQCG
FT                   DYLGEDDIVRLADTYGRA"
FT   gene            586445..587539
FT                   /locus_tag="Dtpsy_0567"
FT   CDS_pept        586445..587539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0567"
FT                   /product="glycosyl transferase family 4"
FT                   /note="PFAM: glycosyl transferase family 4; KEGG:
FT                   pol:Bpro_3998 glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32047"
FT                   /db_xref="GOA:B9MCP7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCP7"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ACM32047.1"
FT                   /translation="MIVVLFLSFVVAAMAGMVLIRWAHDHASRYRPDMPQRFHVGDVPR
FT                   LGGGSVLFGMLVGWVWIAAALTSANIPWSWSSMLACVGAILPATLGGISEDLTQKLSVR
FT                   LRLWLTLLSAVLACWWLGLSVPRLGLPWVDEAMLVLPWLGVVVAALAICGLPHAFNIID
FT                   GYNGLAGVVALLVCFAVAHVALQVGDRQLAAMVLCLAGATAGFLVWNFPKGLLFAGDGG
FT                   AYLWGVVIAIGVILLVQRHPQVSPWFPPLLLIYPIWETFFSSYRKFARGISPSVADALH
FT                   FHQLIYRRIVRSVFNDDEARRVLMRNNRTSPYLWGFTLLTVVPAVVFWDNTPVLMAFCG
FT                   LFVVTYVAAYLAIVRFKVPGWLRR"
FT   sig_peptide     586445..586516
FT                   /locus_tag="Dtpsy_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.912 at
FT                   residue 24"
FT   gene            587586..588491
FT                   /locus_tag="Dtpsy_0568"
FT   CDS_pept        587586..588491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0568"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: ajs:Ajs_0588 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32048"
FT                   /db_xref="GOA:B9MCP8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCP8"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACM32048.1"
FT                   /translation="MPPNIQPDLLGIAPRDKAEILAQALPYIRKFHGKTMVIKYGGNAM
FT                   TDPALQADFAEDVVLLKLVGMNPVVVHGGGPQIEQALNRLGKKGEFIQGMRVTDAETME
FT                   VVEWVLAGEVQQDIVGLIHQAGGKAVGLTGRDGGMIRAKKLKMVDNKDPSVEHDVGQVG
FT                   DIVAIDPSVVKALQDDAFIPVISPIGFGEENESYNINADVVASKLATVLQAEKLVLLTN
FT                   TPGVLDKEGKLLTDLTAREIDALFADGTISGGMLPKISGALDAAKAGVNAVHIIDGRVP
FT                   HSMLLEILTDQAYGTMIRSH"
FT   gene            588686..589330
FT                   /locus_tag="Dtpsy_0569"
FT   CDS_pept        588686..589330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0569"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ajs:Ajs_0589
FT                   nucleoid occlusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32049"
FT                   /db_xref="GOA:B9MCP9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCP9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACM32049.1"
FT                   /translation="MTEFTPATDAPASTDDAPAARRRPRPGERREQILQTLAAMLEQPG
FT                   AERITTAALAARLQVSEAALYRHFASKAQMFEALIDFIEQSVFTLVHQIMERGGESEGA
FT                   QRAARITAMVLQFGERNPGMVRVMVGDALVFENERLQQRMNLFFDKVEATLRQCLRPVA
FT                   DADGSATPTVQTQVRAAALSDLIRGRLQRYARTGFRRMPTEHLDATLALWL"
FT   gene            589537..590202
FT                   /locus_tag="Dtpsy_0570"
FT   CDS_pept        589537..590202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0570"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ajs:Ajs_0591
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32050"
FT                   /db_xref="GOA:B9MCQ0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCQ0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACM32050.1"
FT                   /translation="MSLSPSPTKTVRAPRREGRALHKGQHTKAVIIDAALGLATHIGLE
FT                   GLSIGALADVTGMSKSGVFAHFGSREELQISVIREYHTRFEQEVFYPAMQAPRGVPRLR
FT                   ALFANWMKRTSIEIDSGCIYISGAVEFDDRTGPVRDALANSVMTWQAAMKRAIQQCKEC
FT                   GEIRDDVSEDQMLFEIHGLILALHYEARFLHTPGSIDRANTGFDNILARYSALPGHRG"
FT   gene            590267..592063
FT                   /locus_tag="Dtpsy_0571"
FT   CDS_pept        590267..592063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0571"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ajs:Ajs_0592
FT                   acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32051"
FT                   /db_xref="GOA:B9MCQ1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCQ1"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACM32051.1"
FT                   /translation="MPTYTPPLRDMQFVLHEVFKVTDEFKAMPAHAEVDADTINAVLEE
FT                   AGKFAAGVAFPLNISGDTEGCTLNQQTHEVTTPKGFKEAYAQYVEGGWAALSCDTAYGG
FT                   QGLPFVMNQCLYEMLNSANQAWTMYPGLSHGAYEALHAHGTDEQKKLYLPKLTSGEWTG
FT                   TMCLTEPHCGTDLGLLRTKAEPQADGTYKITGNKIFISAGEHNFTSNIVHLVLARLPDA
FT                   PKGSKGISLFVVPKFKVNADGSLGERNPIYCTGLEHKMGIHGNATAQIAIDGAIGTLVG
FT                   EPNKGLAAMFVMMNAARLGVGNQSLGLTEVAFQNALAYAKDRIQMRSLSGTKAKDKEAD
FT                   PIIVHPDVRKMLLTAKAYAEGARALQIFCTLLLDKAHSHPDEKVRKDSDELVALLTPIV
FT                   KAFITDNGHIATNACMQVFGGHGFIKEWGMEQFVRDNRINMIYEGTNTVQSLDLLGRKV
FT                   LGNNGATLKKFGKLVGQLVAEEGVNEKMAEFINPIAYLGDQMTKFTTEIGFRGFQNPDE
FT                   VGAAAVDYLRVAGHLVFGYMFARMAQVALREIAAGNTDPFYQAKLQTARFYFAKLFPEV
FT                   HTLMRTARAGSKVLMDTDAALA"
FT   gene            592116..592550
FT                   /locus_tag="Dtpsy_0572"
FT   CDS_pept        592116..592550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32052"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCQ2"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0593"
FT                   /protein_id="ACM32052.1"
FT                   /translation="MRQALAAIIFAAIAAPAWAQMSPVGLWRSVDDKTGEAKAEIRIAE
FT                   TSGVLNGRIEKSLKKDADPAATCTECKDDRKGKAIAGLEIIRGVKKADDREVWEGGKIL
FT                   DPENGKEYRASLTPIEGGKRLEVRGFLGPFWRTQTWQRVQ"
FT   sig_peptide     592116..592175
FT                   /locus_tag="Dtpsy_0572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            592651..595053
FT                   /locus_tag="Dtpsy_0573"
FT   CDS_pept        592651..595053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0573"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   ajs:Ajs_0594 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32053"
FT                   /db_xref="GOA:B9MCQ3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCQ3"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACM32053.1"
FT                   /translation="MSRFQVKKVAVLGAGVMGAQIAAHLVNVKVPVVLFDLPAKEGPKN
FT                   GIVTRAVENLKKLKPSPLGVADDAALIQQANYEENMALLGECDLIIEAIAERMDWKLDL
FT                   YKKIAPHVAPHAIVASNTSGLSITQLSEALPDAIKPRFCGIHFFNPPRYMVLVELINTP
FT                   TTRPEVLDQLEAFVTSGLGKGVVRAHDTPNFIANRVGIAGMLSTMKEVENFGLTFDVVD
FT                   DLTGKKLGRASSGTFRTADVVGLDTMAHVIKTLQDNLNEQTDPFYGSFGTPAVLQKLIE
FT                   LGNLGQKAKAGFYKKVGRDILRFELESEEYVPAGAKADEVYGRMLKKPAAERLKLLRNA
FT                   EGAQGRFLWAILRNSFHYAAVHLATIADTARDVDQAMRWGFGMSQGPFELWQEAGWLEV
FT                   ARMVQEDIDAGKALSKAPLPEWVFKGPVADAGGVHTAQGSWSARQGKFVPRRQLPVYER
FT                   QYFPEKLLGEDNLPDWRKAGTTISETDALRTWTLDGKVLIASIQSKMHAISPDVMEGLM
FT                   EAVDLAEREYDGMVIWSGDAPFSVGADLQATMPAYVVAGIAAIEGVEHELQNLMLRLRY
FT                   AQVPVVSAIHGMALGGGCELAVHSARRVAHMESYIGLVEVGVGLVPGAGGLTYIARRAA
FT                   ENAAASTGKDLLPFLTEGFTAAAMAKVGTSALESKKLGYLLDSDLIVPHKDEVLFVAIN
FT                   EAKAMAAGGWRAPHKRLFPVAGRSGIATIRGSLVNMRDGGFISEHDQHIATLIAEVVCG
FT                   GDVDAGTLVSEEYLMALERKAFCALIEHPKTQERILGMLNTGKPVRN"
FT   sig_peptide     592651..592722
FT                   /locus_tag="Dtpsy_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.574 at
FT                   residue 24"
FT   gene            595075..596271
FT                   /locus_tag="Dtpsy_0574"
FT   CDS_pept        595075..596271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0574"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: ajs:Ajs_0595 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32054"
FT                   /db_xref="GOA:B9MCQ4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCQ4"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACM32054.1"
FT                   /translation="MKQIQDAYIVAATRTPIGRSHKGFFRNYRPDDLLATTLKSALAQV
FT                   PGLDPASIEDIICGCAIPEAQQGLNVARIGAVLAGLPTSVGGITVNRFCASGLSAVAMA
FT                   ADRIRVGEAEVMIAAGVESMSMVPMMGNAPSLSPSIFERDGDVGIAYGMGLTAEKVAQQ
FT                   WKVSREAQDAFALESHRRAIAAQQAGEFADEITPIEVTDRTAHLETGEVIAGTRTVSLD
FT                   EGARPDTSLEGLAKLRTVFAARGTVTAGNSSQTSDGAGALILASEAAVKRFGLTPLARF
FT                   VSFASKGVPPSIMGIGPIEAIPAALRYAGLKQDDIGWYELNEAFAAQSLAVINTLGLDT
FT                   AKVNPMGGAIALGHPLGATGAIRSATVVHALRRKQLKYGMVTMCVGMGQGAAGIFERV"
FT   gene            596352..597248
FT                   /locus_tag="Dtpsy_0575"
FT   CDS_pept        596352..597248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0575"
FT                   /product="putative hydrolase"
FT                   /note="KEGG: ajs:Ajs_0596 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32055"
FT                   /db_xref="GOA:B9MCQ5"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCQ5"
FT                   /inference="similar to AA sequence:KEGG:Ajs_0596"
FT                   /protein_id="ACM32055.1"
FT                   /translation="MQSETLMVDGAVPLALRVYVPRPGPARASVVIGGAMGVRQAFYGP
FT                   FAAWLAQQGLRVTTFDYRGQGESLNGGMREVRANLFDWARDYDAVIAHAAQALPGQPLL
FT                   LLGHSLGAQLPGLLGEHARVSGLLSVAAGSGYWRDNAPRIRRAMPAFWHVLVPLSVRLC
FT                   GYFPGRRLRAVGDLPAGVMLQWRRWCLHPRYSVGAEGESAQRSYAAVRFPVHAWSMQDD
FT                   ELMTWRGTQSLLALYANAPCSVERIAPHEAQARRIGHFGFFREQFRDTLWPRALQQLEA
FT                   LAQAQPQGTAGATATAG"
FT   gene            597274..598116
FT                   /locus_tag="Dtpsy_0576"
FT   CDS_pept        597274..598116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtpsy_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtpsy_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACM32056"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:B9MCQ