(data stored in ACNUC7421 zone)

EMBL: CP001399

ID   CP001399; SV 1; circular; genomic DNA; STD; PRO; 2736272 BP.
XX
AC   CP001399;
XX
PR   Project:PRJNA18987;
XX
DT   26-APR-2009 (Rel. 100, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Sulfolobus islandicus L.S.2.15, complete genome.
XX
KW   .
XX
OS   Sulfolobus islandicus L.S.2.15
OC   Archaea; Crenarchaeota; Thermoprotei; Sulfolobales; Sulfolobaceae;
OC   Sulfolobus.
XX
RN   [1]
RP   1-2736272
RX   DOI; 10.1073/pnas.0808945106.
RX   PUBMED; 19435847.
RA   Reno M.L., Held N.L., Fields C.J., Burke P.V., Whitaker R.J.;
RT   "Biogeography of the Sulfolobus islandicus pan-genome";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(21):8605-8610(2009).
XX
RN   [2]
RP   1-2736272
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Sims D.R., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Anderson I., Whitaker R.J., Richardson P.;
RT   ;
RL   Submitted (30-JAN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 37baa45dd74ff74a9d821e2710e544c5.
DR   BioSample; SAMN02598420.
DR   EnsemblGenomes-Gn; EBG00001103125.
DR   EnsemblGenomes-Gn; EBG00001103126.
DR   EnsemblGenomes-Gn; EBG00001103127.
DR   EnsemblGenomes-Gn; EBG00001103128.
DR   EnsemblGenomes-Gn; EBG00001103129.
DR   EnsemblGenomes-Gn; EBG00001103130.
DR   EnsemblGenomes-Gn; EBG00001103131.
DR   EnsemblGenomes-Gn; EBG00001103132.
DR   EnsemblGenomes-Gn; EBG00001103133.
DR   EnsemblGenomes-Gn; EBG00001103134.
DR   EnsemblGenomes-Gn; EBG00001103135.
DR   EnsemblGenomes-Gn; EBG00001103136.
DR   EnsemblGenomes-Gn; EBG00001103137.
DR   EnsemblGenomes-Gn; EBG00001103138.
DR   EnsemblGenomes-Gn; EBG00001103139.
DR   EnsemblGenomes-Gn; EBG00001103140.
DR   EnsemblGenomes-Gn; EBG00001103141.
DR   EnsemblGenomes-Gn; EBG00001103142.
DR   EnsemblGenomes-Gn; EBG00001103143.
DR   EnsemblGenomes-Gn; EBG00001103144.
DR   EnsemblGenomes-Gn; EBG00001103145.
DR   EnsemblGenomes-Gn; EBG00001103146.
DR   EnsemblGenomes-Gn; EBG00001103147.
DR   EnsemblGenomes-Gn; EBG00001103148.
DR   EnsemblGenomes-Gn; EBG00001103149.
DR   EnsemblGenomes-Gn; EBG00001103150.
DR   EnsemblGenomes-Gn; EBG00001103151.
DR   EnsemblGenomes-Gn; EBG00001103152.
DR   EnsemblGenomes-Gn; EBG00001103153.
DR   EnsemblGenomes-Gn; EBG00001103154.
DR   EnsemblGenomes-Gn; EBG00001103155.
DR   EnsemblGenomes-Gn; EBG00001103156.
DR   EnsemblGenomes-Gn; EBG00001103157.
DR   EnsemblGenomes-Gn; EBG00001103158.
DR   EnsemblGenomes-Gn; EBG00001103159.
DR   EnsemblGenomes-Gn; EBG00001103160.
DR   EnsemblGenomes-Gn; EBG00001103161.
DR   EnsemblGenomes-Gn; EBG00001103162.
DR   EnsemblGenomes-Gn; EBG00001103163.
DR   EnsemblGenomes-Gn; EBG00001103165.
DR   EnsemblGenomes-Gn; EBG00001103166.
DR   EnsemblGenomes-Gn; EBG00001103167.
DR   EnsemblGenomes-Gn; EBG00001103168.
DR   EnsemblGenomes-Gn; EBG00001103169.
DR   EnsemblGenomes-Gn; EBG00001103170.
DR   EnsemblGenomes-Gn; EBG00001103171.
DR   EnsemblGenomes-Gn; EBG00001103172.
DR   EnsemblGenomes-Gn; EBG00001103173.
DR   EnsemblGenomes-Gn; EBG00001103174.
DR   EnsemblGenomes-Gn; EBG00001103175.
DR   EnsemblGenomes-Gn; EBG00001103176.
DR   EnsemblGenomes-Gn; EBG00001103177.
DR   EnsemblGenomes-Gn; EBG00001103178.
DR   EnsemblGenomes-Gn; EBG00001103179.
DR   EnsemblGenomes-Gn; EBG00001103180.
DR   EnsemblGenomes-Gn; EBG00001103181.
DR   EnsemblGenomes-Gn; EBG00001103182.
DR   EnsemblGenomes-Gn; EBG00001103183.
DR   EnsemblGenomes-Gn; EBG00001103184.
DR   EnsemblGenomes-Gn; EBG00001103185.
DR   EnsemblGenomes-Gn; EBG00001103186.
DR   EnsemblGenomes-Gn; EBG00001103187.
DR   EnsemblGenomes-Gn; EBG00001103188.
DR   EnsemblGenomes-Gn; EBG00001103189.
DR   EnsemblGenomes-Gn; EBG00001103190.
DR   EnsemblGenomes-Gn; EBG00001103191.
DR   EnsemblGenomes-Gn; EBG00001103192.
DR   EnsemblGenomes-Gn; LS215_R0001.
DR   EnsemblGenomes-Gn; LS215_R0002.
DR   EnsemblGenomes-Gn; LS215_R0003.
DR   EnsemblGenomes-Gn; LS215_R0004.
DR   EnsemblGenomes-Gn; LS215_R0005.
DR   EnsemblGenomes-Gn; LS215_R0006.
DR   EnsemblGenomes-Gn; LS215_R0007.
DR   EnsemblGenomes-Gn; LS215_R0008.
DR   EnsemblGenomes-Gn; LS215_R0009.
DR   EnsemblGenomes-Gn; LS215_R0010.
DR   EnsemblGenomes-Gn; LS215_R0011.
DR   EnsemblGenomes-Gn; LS215_R0012.
DR   EnsemblGenomes-Gn; LS215_R0013.
DR   EnsemblGenomes-Gn; LS215_R0014.
DR   EnsemblGenomes-Gn; LS215_R0015.
DR   EnsemblGenomes-Gn; LS215_R0016.
DR   EnsemblGenomes-Gn; LS215_R0017.
DR   EnsemblGenomes-Gn; LS215_R0018.
DR   EnsemblGenomes-Gn; LS215_R0019.
DR   EnsemblGenomes-Gn; LS215_R0020.
DR   EnsemblGenomes-Gn; LS215_R0021.
DR   EnsemblGenomes-Gn; LS215_R0022.
DR   EnsemblGenomes-Gn; LS215_R0023.
DR   EnsemblGenomes-Gn; LS215_R0024.
DR   EnsemblGenomes-Gn; LS215_R0025.
DR   EnsemblGenomes-Gn; LS215_R0026.
DR   EnsemblGenomes-Gn; LS215_R0027.
DR   EnsemblGenomes-Gn; LS215_R0028.
DR   EnsemblGenomes-Gn; LS215_R0029.
DR   EnsemblGenomes-Gn; LS215_R0030.
DR   EnsemblGenomes-Gn; LS215_R0031.
DR   EnsemblGenomes-Gn; LS215_R0032.
DR   EnsemblGenomes-Gn; LS215_R0033.
DR   EnsemblGenomes-Gn; LS215_R0034.
DR   EnsemblGenomes-Gn; LS215_R0035.
DR   EnsemblGenomes-Gn; LS215_R0036.
DR   EnsemblGenomes-Gn; LS215_R0037.
DR   EnsemblGenomes-Gn; LS215_R0038.
DR   EnsemblGenomes-Gn; LS215_R0039.
DR   EnsemblGenomes-Gn; LS215_R0040.
DR   EnsemblGenomes-Gn; LS215_R0041.
DR   EnsemblGenomes-Gn; LS215_R0042.
DR   EnsemblGenomes-Gn; LS215_R0043.
DR   EnsemblGenomes-Gn; LS215_R0044.
DR   EnsemblGenomes-Gn; LS215_R0045.
DR   EnsemblGenomes-Gn; LS215_R0046.
DR   EnsemblGenomes-Gn; LS215_R0047.
DR   EnsemblGenomes-Gn; LS215_R0048.
DR   EnsemblGenomes-Gn; LS215_R0049.
DR   EnsemblGenomes-Gn; LS215_R0050.
DR   EnsemblGenomes-Tr; EBT00001694972.
DR   EnsemblGenomes-Tr; EBT00001694974.
DR   EnsemblGenomes-Tr; EBT00001694976.
DR   EnsemblGenomes-Tr; EBT00001694978.
DR   EnsemblGenomes-Tr; EBT00001694979.
DR   EnsemblGenomes-Tr; EBT00001694981.
DR   EnsemblGenomes-Tr; EBT00001694983.
DR   EnsemblGenomes-Tr; EBT00001694985.
DR   EnsemblGenomes-Tr; EBT00001694987.
DR   EnsemblGenomes-Tr; EBT00001694990.
DR   EnsemblGenomes-Tr; EBT00001694992.
DR   EnsemblGenomes-Tr; EBT00001694994.
DR   EnsemblGenomes-Tr; EBT00001694997.
DR   EnsemblGenomes-Tr; EBT00001694999.
DR   EnsemblGenomes-Tr; EBT00001695001.
DR   EnsemblGenomes-Tr; EBT00001695004.
DR   EnsemblGenomes-Tr; EBT00001695006.
DR   EnsemblGenomes-Tr; EBT00001695009.
DR   EnsemblGenomes-Tr; EBT00001695012.
DR   EnsemblGenomes-Tr; EBT00001695015.
DR   EnsemblGenomes-Tr; EBT00001695018.
DR   EnsemblGenomes-Tr; EBT00001695019.
DR   EnsemblGenomes-Tr; EBT00001695022.
DR   EnsemblGenomes-Tr; EBT00001695026.
DR   EnsemblGenomes-Tr; EBT00001695029.
DR   EnsemblGenomes-Tr; EBT00001695031.
DR   EnsemblGenomes-Tr; EBT00001695033.
DR   EnsemblGenomes-Tr; EBT00001695036.
DR   EnsemblGenomes-Tr; EBT00001695038.
DR   EnsemblGenomes-Tr; EBT00001695041.
DR   EnsemblGenomes-Tr; EBT00001695044.
DR   EnsemblGenomes-Tr; EBT00001695047.
DR   EnsemblGenomes-Tr; EBT00001695051.
DR   EnsemblGenomes-Tr; EBT00001695054.
DR   EnsemblGenomes-Tr; EBT00001695057.
DR   EnsemblGenomes-Tr; EBT00001695060.
DR   EnsemblGenomes-Tr; EBT00001695063.
DR   EnsemblGenomes-Tr; EBT00001695066.
DR   EnsemblGenomes-Tr; EBT00001695069.
DR   EnsemblGenomes-Tr; EBT00001695072.
DR   EnsemblGenomes-Tr; EBT00001695074.
DR   EnsemblGenomes-Tr; EBT00001695076.
DR   EnsemblGenomes-Tr; EBT00001695079.
DR   EnsemblGenomes-Tr; EBT00001695081.
DR   EnsemblGenomes-Tr; EBT00001695084.
DR   EnsemblGenomes-Tr; EBT00001695088.
DR   EnsemblGenomes-Tr; EBT00001695091.
DR   EnsemblGenomes-Tr; EBT00001695094.
DR   EnsemblGenomes-Tr; EBT00001695100.
DR   EnsemblGenomes-Tr; EBT00001695104.
DR   EnsemblGenomes-Tr; EBT00001695107.
DR   EnsemblGenomes-Tr; EBT00001695110.
DR   EnsemblGenomes-Tr; EBT00001695113.
DR   EnsemblGenomes-Tr; EBT00001695116.
DR   EnsemblGenomes-Tr; EBT00001695119.
DR   EnsemblGenomes-Tr; EBT00001695122.
DR   EnsemblGenomes-Tr; EBT00001695125.
DR   EnsemblGenomes-Tr; EBT00001695127.
DR   EnsemblGenomes-Tr; EBT00001695130.
DR   EnsemblGenomes-Tr; EBT00001695131.
DR   EnsemblGenomes-Tr; EBT00001695133.
DR   EnsemblGenomes-Tr; EBT00001695138.
DR   EnsemblGenomes-Tr; EBT00001695139.
DR   EnsemblGenomes-Tr; EBT00001695142.
DR   EnsemblGenomes-Tr; EBT00001695145.
DR   EnsemblGenomes-Tr; EBT00001695147.
DR   EnsemblGenomes-Tr; EBT00001695149.
DR   EnsemblGenomes-Tr; LS215_R0001-1.
DR   EnsemblGenomes-Tr; LS215_R0002-1.
DR   EnsemblGenomes-Tr; LS215_R0003-1.
DR   EnsemblGenomes-Tr; LS215_R0004-1.
DR   EnsemblGenomes-Tr; LS215_R0005-1.
DR   EnsemblGenomes-Tr; LS215_R0006-1.
DR   EnsemblGenomes-Tr; LS215_R0007-1.
DR   EnsemblGenomes-Tr; LS215_R0008-1.
DR   EnsemblGenomes-Tr; LS215_R0009-1.
DR   EnsemblGenomes-Tr; LS215_R0010-1.
DR   EnsemblGenomes-Tr; LS215_R0011-1.
DR   EnsemblGenomes-Tr; LS215_R0012-1.
DR   EnsemblGenomes-Tr; LS215_R0013-1.
DR   EnsemblGenomes-Tr; LS215_R0014-1.
DR   EnsemblGenomes-Tr; LS215_R0015-1.
DR   EnsemblGenomes-Tr; LS215_R0016-1.
DR   EnsemblGenomes-Tr; LS215_R0017-1.
DR   EnsemblGenomes-Tr; LS215_R0018-1.
DR   EnsemblGenomes-Tr; LS215_R0019-1.
DR   EnsemblGenomes-Tr; LS215_R0020-1.
DR   EnsemblGenomes-Tr; LS215_R0021-1.
DR   EnsemblGenomes-Tr; LS215_R0022-1.
DR   EnsemblGenomes-Tr; LS215_R0023-1.
DR   EnsemblGenomes-Tr; LS215_R0024-1.
DR   EnsemblGenomes-Tr; LS215_R0025-1.
DR   EnsemblGenomes-Tr; LS215_R0026-1.
DR   EnsemblGenomes-Tr; LS215_R0027-1.
DR   EnsemblGenomes-Tr; LS215_R0028-1.
DR   EnsemblGenomes-Tr; LS215_R0029-1.
DR   EnsemblGenomes-Tr; LS215_R0030-1.
DR   EnsemblGenomes-Tr; LS215_R0031-1.
DR   EnsemblGenomes-Tr; LS215_R0032-1.
DR   EnsemblGenomes-Tr; LS215_R0033-1.
DR   EnsemblGenomes-Tr; LS215_R0034-1.
DR   EnsemblGenomes-Tr; LS215_R0035-1.
DR   EnsemblGenomes-Tr; LS215_R0036-1.
DR   EnsemblGenomes-Tr; LS215_R0037-1.
DR   EnsemblGenomes-Tr; LS215_R0038-1.
DR   EnsemblGenomes-Tr; LS215_R0039-1.
DR   EnsemblGenomes-Tr; LS215_R0040-1.
DR   EnsemblGenomes-Tr; LS215_R0041-1.
DR   EnsemblGenomes-Tr; LS215_R0042-1.
DR   EnsemblGenomes-Tr; LS215_R0043-1.
DR   EnsemblGenomes-Tr; LS215_R0044-1.
DR   EnsemblGenomes-Tr; LS215_R0045-1.
DR   EnsemblGenomes-Tr; LS215_R0046-1.
DR   EnsemblGenomes-Tr; LS215_R0047-1.
DR   EnsemblGenomes-Tr; LS215_R0048-1.
DR   EnsemblGenomes-Tr; LS215_R0049-1.
DR   EnsemblGenomes-Tr; LS215_R0050-1.
DR   EuropePMC; PMC2689034; 19435847.
DR   EuropePMC; PMC5127849; 27965637.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01139; sR2.
DR   RFAM; RF01140; sR20.
DR   RFAM; RF01145; sR14.
DR   RFAM; RF01148; sR13.
DR   RFAM; RF01150; sR11.
DR   RFAM; RF01304; sR5.
DR   RFAM; RF01312; sR9.
DR   RFAM; RF01338; CRISPR-DR25.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001399.
DR   SILVA-SSU; CP001399.
XX
CC   URL -- http://www.jgi.doe.gov
CC          http://www.life.uiuc.edu/S.islandicus
CC   JGI Project ID: 4023470
CC   Source DNA and archaea available from Rachel Whitaker
CC   (rwhitaker@life.uiuc.edu)
CC   Contacts: Rachel Whitaker (rwhitaker@life.uiuc.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Meta information:
CC    Organism display name:  Sulfolobus islandicus L.S.2.15
CC    GOLD ID:  Gi01316 http://genomesonline.org/GOLD_CARDS/Gi01316.html
CC    Sequencing Status:  Complete
CC    Phenotypes:  Acidophile
CC    Diseases:  None
CC    Habitat:  Fresh water
CC    Oxygen Requirement:  Facultative
CC    Cell Shape:  Coccus-shaped
CC    Motility:  Nonmotile
CC    Sporulation:  Nonsporulating
CC    Energy Source:  Lithotroph
CC    Temperature Range:  Hyperthermophile
CC    Biotic Relationship:  Free living
CC    Isolation:  Lassen National Park in California.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2736272
FT                   /organism="Sulfolobus islandicus L.S.2.15"
FT                   /strain="L.S.2.15"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:429572"
FT   gene            468..764
FT                   /locus_tag="LS215_0001"
FT   CDS_pept        468..764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34155"
FT                   /db_xref="GOA:C3MIU8"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIU8"
FT                   /protein_id="ACP34155.1"
FT                   /translation="MVIRRMFIKSTLAVSFSISYLLYIIAKISFGSGKLAFIIALLQLY
FT                   PYFLIDYLPTVQVVSLFFQSLLLLLFAIFILLITYMLFLFYKLYKMVKTSILK"
FT   gene            839..2026
FT                   /locus_tag="LS215_0002"
FT   CDS_pept        839..2026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0002"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34156"
FT                   /db_xref="GOA:C3MIU9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIU9"
FT                   /protein_id="ACP34156.1"
FT                   /translation="MNVIRETLKGGKGEVIKNPKVFIDPLSVFKEIPFREDILRDAAIA
FT                   IRYFVKNEVKFSNLFLGLTGTGKTFVSKYIYNEIEEVKNEDEEYKDVKQAYVNCREVGG
FT                   TPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIKAIIYLDEVDTLVKRRGGDI
FT                   VLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEY
FT                   GLIKGTYDGDILGYIAAISAKEHGDARKAVNLLFRAAQLASGGGMIKKEHVDKAIVDYE
FT                   QERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISEL
FT                   DMFGIVKIRIVNRGRAGGVKKYALVEDKEKVLRALNETFEDSIGIGDFVDDLGEN"
FT   gene            2007..2327
FT                   /locus_tag="LS215_0003"
FT   CDS_pept        2007..2327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIV0"
FT                   /protein_id="ACP34157.1"
FT                   /translation="MIWEKIKRLEERLYELRKEIEEVEKELEELPSGHLEVKTINGNVY
FT                   YYLRYWEDGRLRSKYIGKFASDIKEKLLKSEQLRRRLTQLKEEEKKLSNIIDKIEKIIT
FT                   DY"
FT   gene            2397..3230
FT                   /locus_tag="LS215_0004"
FT   CDS_pept        2397..3230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0004"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34158"
FT                   /db_xref="GOA:C3MIV1"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIV1"
FT                   /protein_id="ACP34158.1"
FT                   /translation="MIPVIIASAQTSVSQALSGIATSIIDAIPSIIVFIIILIIGYIIA
FT                   NIVSYSIRAFLGRIFREEHVRASVDIIAGTIKALIILIALSIALSFLQLGAASGYVQQI
FT                   ANYLPKLAGAIVLLTIGLTLVNILVDYMQRQIGARSQDDLITAIFNVLRFGLYAAIITV
FT                   AAALAIFSVIPYVDPYVFYAVILGAVILYAAYALIDKVLVPFANSNPDLAYVANYGRLI
FT                   LYIIVLLIAIAIIVEPFGNVTSIIYALSWGLAIAFAIALIPLVIALVKKFLAEIK"
FT   gene            3278..3577
FT                   /locus_tag="LS215_0005"
FT   CDS_pept        3278..3577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0005"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34159"
FT                   /db_xref="GOA:C3MIV2"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIV2"
FT                   /protein_id="ACP34159.1"
FT                   /translation="MSGIFSKGLEELKNNGWLILEDGKKIKKEFKFKDFKQSIDFLKDI
FT                   QPSADALDHHPDVCIYYNRVIVELTTHDMGGLTDLDYKLAIKIDELYKMKTSNL"
FT   gene            complement(3645..4223)
FT                   /locus_tag="LS215_0006"
FT   CDS_pept        complement(3645..4223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34160"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIV3"
FT                   /protein_id="ACP34160.1"
FT                   /translation="MSSTKRSFTALFASRDRAEKEEKMSEKITPIFSLGNFVMDKLGNV
FT                   TQYTFFYYYDPENYYASLTREMLDKEIEVVKGNMQSFLDVEKIIINDRSTRAKVVSTDI
FT                   FLLDITHPVIEFIITFRGKLRKGLNVYENFYEEEITEYPYEAIWRFPGKILNVKMKGQI
FT                   SILENFLKIKVNKGVKVGGRERIEFFLTS"
FT   gene            complement(4151..4864)
FT                   /locus_tag="LS215_0007"
FT   CDS_pept        complement(4151..4864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34161"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIV4"
FT                   /protein_id="ACP34161.1"
FT                   /translation="MKCSTKSIREIRGFSFLVPNCDSTLLREKFESFRKLSNEENKTYI
FT                   IRIADSNYFKFEVLMLPNSITLLTISTVRGTNNINLRDFEMVDELQTLACCAYQKEELK
FT                   TATSNFLSPTAQIAEAEVVDLISTDEEFECQTECNNISWNEIKLPESTEGKWTTTELAS
FT                   TGKLYLKALSGQAKFLTISTERPQNSIKFTSMERLGALCCFLTELKRKLNECPALKEVL
FT                   QPYLQVEIGRKRRKR"
FT   gene            complement(4898..5725)
FT                   /locus_tag="LS215_0008"
FT   CDS_pept        complement(4898..5725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0008"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34162"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIV5"
FT                   /protein_id="ACP34162.1"
FT                   /translation="MKCARSYKMLILPKRLIDILSESMSLKEAYTQYKNRNLNYALKLL
FT                   DELITQDPDLKEAYSLKGKILFELGKLQEAYENFQKAEDKIGMAKVLIAQGLYRDALTY
FT                   LDDNSKESSKLRGLIYLKLENYEKALDETKTIEDEDPLIYKIRGISELKLGRYNDAIID
FT                   LSFAIEKYPTDAELYFYRALAQRGLGNYKEAESDLEMAINLNPYYAEVYFSLGELKESR
FT                   GLLQEAVDMYSKTININPLYRSAYVRRAKSLMKLGREDEAYADIRKANELDSS"
FT   gene            complement(6216..7046)
FT                   /locus_tag="LS215_0009"
FT   CDS_pept        complement(6216..7046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0009"
FT                   /product="AIG2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34163"
FT                   /db_xref="GOA:C3MIV6"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIV6"
FT                   /protein_id="ACP34163.1"
FT                   /translation="MYLFVYGSLRYGFELNHLVAKSRFIGLGYIEGYEMYDLGNYPGII
FT                   KGDGIVWGEVYEIDENLIKLLDEVEDYKGSPDDLYVREKTRVYFDQKRKYYLDNVYFYR
FT                   YNREIANDMEKIEDGDYSAWSGMPIIVNYFAYAENTNEKILRQRGVDIMLSEIPAYMKG
FT                   YRLIFNVPCKYGYCANLLEDENGIICGYLQKVFLHTLNSLDKAEQHLIKYIREVVKVYD
FT                   RNGKEYFAYAYVSSHKDDREKPSEEYLKMIREGLMRGWGNECVSTGLYDEAGIS"
FT   gene            complement(7049..7333)
FT                   /locus_tag="LS215_0010"
FT   CDS_pept        complement(7049..7333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34164"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIV7"
FT                   /protein_id="ACP34164.1"
FT                   /translation="MKPAEYKKLIDMLTRRGFDVRENGEELLAIFYPPTIEEAGGEGEI
FT                   PNQRYYVIKFKIRNGLAYYDSTTLMENDKPIKVLNIDEVELWLESFLGE"
FT   gene            complement(7314..7688)
FT                   /locus_tag="LS215_0011"
FT   CDS_pept        complement(7314..7688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0011"
FT                   /product="protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34165"
FT                   /db_xref="GOA:C3MIV8"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIV8"
FT                   /protein_id="ACP34165.1"
FT                   /translation="MAHPVAITLIIIAVLIAILVITGYISDPIIDIPTLALLGFLTYRV
FT                   INVVIKTRGRNLYSYEGKIGKAVDDIKSGQEGYVIVEGEYWRALALEDIKKNEDIVVVK
FT                   REGMKLMVRKKVSDIETSRV"
FT   gene            7724..9052
FT                   /locus_tag="LS215_0012"
FT   CDS_pept        7724..9052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0012"
FT                   /product="Peptidase A5, thermopsin"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34166"
FT                   /db_xref="GOA:C3MIV9"
FT                   /db_xref="InterPro:IPR007981"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIV9"
FT                   /protein_id="ACP34166.1"
FT                   /translation="MYKVLLIIILLLPLSMPLTIHTISQPSSLAFPSGVTSYPLNTVIY
FT                   TDLVMGKINISYLNIGSSYLPGGEYFTTGNASLQLNAMVLGKYWAQNVILFHQISNNTF
FT                   YATPIVNLWNLSGPFSNTTGNSLVYQGLGVICYQGPTFKVNLPLSISLFMEIVNSTLDF
FT                   GYNINEERGIYFRYPLIGLFQLGGLSLLGLPNDLELVWGGPGGGSVVFMNVSSVANLYY
FT                   FNGNGLSIVPNAYSIGFDTAEAAFGVKIYSTFPSLFSPIAIETSGLNVPSVLWPIPPHV
FT                   LVNQTSDRITVKLSISNKSLSGQAVYLETGFPPSVVSSTLTNSSGIAVFPNNNYSFYVV
FT                   YFPGNFTLSSAYYFSSPILNSLSSKFHSYYQDLLNFLNSAQNSFKKGIKSILSKQETSI
FT                   TTTTLTSTTSSSPQFGVNLYIILYILAFVIGMVISAILIRFKL"
FT   gene            9077..9880
FT                   /locus_tag="LS215_0013"
FT   CDS_pept        9077..9880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0013"
FT                   /product="band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34167"
FT                   /db_xref="GOA:C3MIW0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIW0"
FT                   /protein_id="ACP34167.1"
FT                   /translation="MAINVGDIVGIVFLIIIIIIFIAMSFRVVREWERAVVLRLGRFLR
FT                   IKGPGIIFLIPFVDRPLIVDLRVNTVEVPPQTILTRDNVTVSVDAVVYYKVVDPQKAVL
FT                   SVYNYNVAVLNLAQTSLRDIVGQMELDELLSKREEINKRIQEILDVTTEGWGIKVTAVT
FT                   IRDIRLSQDLLSAMAKQAEAERLRRAKVILSEGERQAASILADASTYYKDNPSALQLRF
FT                   LETLSDISQRGGLIIVVPAGNEIYPTLGTSAALSTLSKKLQTETK"
FT   gene            complement(9911..11002)
FT                   /locus_tag="LS215_0014"
FT   CDS_pept        complement(9911..11002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34168"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIW1"
FT                   /protein_id="ACP34168.1"
FT                   /translation="MNINEIIKKVNELATKDVDERGKINMATNLIFDDITSNNSELKIG
FT                   ILEEIIDSDHIACAVDGSKYEIELSDVTLILARAVKILGKKKDKKSVPSEIAEDFKIIE
FT                   NYYDKNVISNKSILFMLSLETGLIEKCEDCDVIFVDGPIVDPPTYYEEDVEIENILSLD
FT                   KLALYRSTVLRRLKGKNKLIMGIVKNFSHRILIKEFLNSYPALIKARENYIISNIMYKY
FT                   RLEKSEFNKPIFLGWINWDSLINNQIILDDLKGISKAYNQYKKAFNYSLSIYSLYYQYN
FT                   ITSPIVRIDMLSEKEPDFTPIKYLNTWAMQGIREVTLLNKLADELSEINSQDAKKYALL
FT                   FNLARENYLDMNDKLAELMMRKT"
FT   gene            complement(10999..11688)
FT                   /locus_tag="LS215_0015"
FT   CDS_pept        complement(10999..11688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34169"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJ91"
FT                   /protein_id="ACP34169.1"
FT                   /translation="MDLDEFIEKLTQYKQNLDVEKLREEDRKITEMIEELEVSKQSLKE
FT                   SLKKLRSLEKKINELNKYEDNLEEIKADIERLGKLNSAEEIIRYVEKIKGKIDSLEKDV
FT                   EQDLNKIIDDKIKNIEEINDRLKLYAKILYHFLKIQKDVKTFSIPKEKSLSKLNEVEIQ
FT                   AKQHLNELYEIIVNELGKLNLNENEINILIILIDKGEIKISKDNLEEAIKVMKMLVERN
FT                   ISIKVKV"
FT   gene            complement(11675..14713)
FT                   /locus_tag="LS215_0016"
FT   CDS_pept        complement(11675..14713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34170"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJ92"
FT                   /protein_id="ACP34170.1"
FT                   /translation="MSCYKRISETASDSSYIYQIFSCISENPLYINRLRFFKQVKDEID
FT                   RISKTKQSPEIISLVADWGQGKSTFLDIIEEYAKSKNISVIKVPFVELLSKTEDLLTFR
FT                   NNIYLIDEVESSVDYFAEYQNEIKDFWSKVKELANSTGNSIVYLSMTPSAYSKIFGTGG
FT                   LIYNLFSETYPSLLERIRKVSIENPSKLEFLLMLKCMLKMANVKDFKILQYMDLPYWVI
FT                   DQERRKYVRFFNDILCDNLPNIDRIFNELARSEKGISLNSEGETIKLDTLTKMENELDS
FT                   QESSNLYRVLMSRIFTDEKLIIKQLEGHVVKGVLLPYLKWIEIFPKGQEYVEDFLLTYY
FT                   QDDFHVFISDNIESVVYESIDTSKLKENIKKLTLFSKTEAYALSWNFFESVANTNIGGL
FT                   VVEFKSREIRDKALQFVNTYITDREKELESLEYFMEVLGIKIDSANRTRDYIRFLKIVD
FT                   RNDKITIILAKPSNEDEIKSLIKEIKESDDIIHGIILIEPQIGKEELSKTLDELSIPLI
FT                   ELKITTPKKRQLLYLLFSKIYGQSRIRLDSIELRLGDLKNSISSLLLKIRDNLNLKQLP
FT                   IPKNKRLIQSFNWIIFYPSIKMANADEVFDKVNDIINEKFRMYGSKQFHLEDIETSNTF
FT                   IEDVITYFYNNYIIKIRTNYIDFEDLAGDSLSSFSKLFAGLIRQKYKQEAEDVVFNYIM
FT                   YYVNPQDTRRKDNKNNPLAFAYQIFNPDKKIGQNPTLDFLVYSSIVSGEVAKYLNKDSI
FT                   YMKINDQIRKIKEKLDNPYSAYGYFITAKKRGAAVRSLEEMREAIETYEKSCTENKDIR
FT                   LCYDYLYLSNIYLELLRETEKSVIETDKIVEEISKKLEVVEKAKRYIKINEKIEEIEKV
FT                   REIVRELKDNFKIHMDKLAKRIQEINERGETESFKRYLDYLLTTIHVEDNSNLYFILFK
FT                   LLKETLNGIAIVGEELKGTIVDEITSLSKVGIQLNNIETIVNELEKISPELPKLRENVE
FT                   RNTQKITQLIQEIKEVLEEHGFG"
FT   gene            complement(14718..16331)
FT                   /locus_tag="LS215_0017"
FT   CDS_pept        complement(14718..16331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0017"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34171"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJ93"
FT                   /protein_id="ACP34171.1"
FT                   /translation="MLMEKGEIIGIVLQKSEANELQGLIRADEEINIGQLLLIDDSEKL
FT                   SLVRVENYEFLNEFFDERGDIAKSILKEPSIYEILDMNTIIKATLHLIKKYDHSTTPKP
FT                   GSFVRKLPEIKSEKDLLSFYGIKSKKGLIEYGALAGSEIPLLLDLNAITMHIGVFGETG
FT                   SGKSYNMRYLIKLLSNIKIGDNITALPMIVIDANGDYIDLASTNLDIVSRGRGWIKRYI
FT                   LKDPKEQNDIKLTIDLSIFTPRELSEFIMSLKYGEASYNTLQLNFLEQVLANHDSKEYN
FT                   TLLGTAIGIENLRNEILTMAQNKDIGITTSTARGIASALEIFKNKVISRLQLVNSSASL
FT                   TENTLEVIWRNRGLAIIDFSAEGSPGIDVLTKQLIVSYITRLIFNYLTKSKYNGNQRFL
FT                   GFVIEEAQNYIPSVDYPVNANLTKDVLVTLATQGRKFGASLILVSQRPAFIDKYVLSMI
FT                   NTFFFHRIYHEDVRYVMSASGGLPESLTRNLTSLETGHVIVSGLMSIMKSPALVRIPWD
FT                   ARLGSYAGNVERIDLILSEG"
FT   gene            complement(16376..16942)
FT                   /locus_tag="LS215_0018"
FT   CDS_pept        complement(16376..16942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34172"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="InterPro:IPR040777"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJ94"
FT                   /protein_id="ACP34172.1"
FT                   /translation="MSSACERLYEYLKPDFTRISKKDNTDDLFRHPVVMRWHHYFLENW
FT                   NSDKEIGLLLPCTVVKPYSLSPTHKIAYATLNKYNLEEKVQVYSVSEPMLLVPKELEEC
FT                   YPFNNYDYPPRLMSKEEKEEFIMLLTKPLIKVSMLHNRLIGILPRHHYEIVKRAAEISN
FT                   LKITIYPYGRLAFKTIANVITSISS"
FT   gene            complement(16914..17798)
FT                   /locus_tag="LS215_0019"
FT   CDS_pept        complement(16914..17798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34173"
FT                   /db_xref="GOA:C3MJ95"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJ95"
FT                   /protein_id="ACP34173.1"
FT                   /translation="MKIILGIPDLKIPVWTFKQPLMVNQLNWNNLSWENETWVDSGGYQ
FT                   IMVKGIKVEIEKVVEKYKILDATQYMSLDIPSNPCHKPSELNYKYFEYLYAVFDKKIVP
FT                   VIHAYDVESIKKSIDFYSQYTDLVAFGGIIPPTLNKSGNKKLAVTIYHLVRKLWKGKIH
FT                   VLGAGSPFMRKVYFNANSVDTSTYRIKGIHGMVIIPGKGERYVGERKIVWGTRRASEEE
FT                   LETLLSFLDRTNYPFPIRLDNWVDRSLINAWVLLNSEYEINNPLIEYSKKLDSFPEDEI
FT                   EEEVNELCMRATI"
FT   gene            18041..18721
FT                   /locus_tag="LS215_0020"
FT   CDS_pept        18041..18721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34174"
FT                   /db_xref="GOA:C3MJ96"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJ96"
FT                   /protein_id="ACP34174.1"
FT                   /translation="MSKGAEILILFTVFVFTLNIISNAYVVNVKILSPFPVTLLFSDSH
FT                   GVKLVSSNQTLNVNSSNLRIQAFVLAPYSYSILINGNNTNELNVNLSNYSEFNLTVIVI
FT                   PSYAFLKVDVVGKGTVYIELNNGTIIAVRNSSVVKLYNGSNVLLEASGDLLNWSNGGNT
FT                   MTIWYTVNGNSTITAFFGNSSILLKSGTVKPIVNYTEVGLSLFAIGFFVLYKIYSRKDQ
FT                   DTNV"
FT   gene            18763..20694
FT                   /locus_tag="LS215_0021"
FT   CDS_pept        18763..20694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0021"
FT                   /product="protein of unknown function DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34175"
FT                   /db_xref="GOA:C3MJ97"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJ97"
FT                   /protein_id="ACP34175.1"
FT                   /translation="MNERLRNSQSGYLRKAVNHPINWYTWSNEIFEIAKREDKPILIDV
FT                   GAAWCHWCNVMDEDTYSNPEIVKIVNENFIPVKVDRDEMPDLDRLLQNAAMAITSESGW
FT                   PLTIFMTPEGKVFFGGTYFPPEDKYGRIGFKKLLLEILRIWREDRNQIFSSSIDPNMLI
FT                   ARNTGGVLSSSVLDDAFSYITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGK
FT                   KLGLFTLRKMYYGGIFDQVGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYTATN
FT                   DIEILDALRNSVDFVLRELYMDGKGFANSLDADSEGMEGKYYTWTEDELKGALGNDYGI
FT                   AIRVFDLKNTVEVEGRKVLLRTTELRELSKVTGLQANEIIEKVSEIRAKLLTYREQNRK
FT                   MPYRDDSTYTYPNAKLTESILFSSLILNKGIEEAKLVLSKLGKSVSRRLDGGKAGLPED
FT                   YAAALLASISAYEVLSEEKYYDLAIELGRNIGGIRPNNFTDMPNESANSMYIRALFKLS
FT                   LLSDEFKVDEGKIKPLIPSLTAENSQFIAGIVNTISSYINGMAHIVVVDEKDGLAERLH
FT                   RTALLTYYPFKLIERVDDSRTDYVSSVIRAMIKYNAGKSRAYVCIGNTCSMPVSEEEKI
FT                   KQLLKTKL"
FT   gene            20706..21425
FT                   /locus_tag="LS215_0022"
FT   CDS_pept        20706..21425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0022"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34176"
FT                   /db_xref="GOA:C3MJ98"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJ98"
FT                   /protein_id="ACP34176.1"
FT                   /translation="MGRLDNKKVAIIGVSEGLGYATAYFALKEGAQVCINSRNENKLKR
FT                   MKKTLSKYGNIHYVVGDVSSTDSARNVIDKCASLLNGIDHLVVTVGGYVEDTIDNFSGL
FT                   EEMLTNHIKIPLYVINSSIRFLKEGSSVVLVSSMSGIGKASPDQLSYAVAKAGLAKEVE
FT                   ILASELLGRGIRVNGIAPTTISGEFEPERNWKKLRKLGDDMAPPEDFARIIIWLLTDES
FT                   DWVDGVVIPAHGGARLK"
FT   gene            21426..22067
FT                   /locus_tag="LS215_0023"
FT   CDS_pept        21426..22067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0023"
FT                   /product="TENA/THI-4 domain protein"
FT                   /EC_number="3.5.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34177"
FT                   /db_xref="GOA:C3MJ99"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJ99"
FT                   /protein_id="ACP34177.1"
FT                   /translation="MSIVSNVENLIESVGELWNRYVKHEFVLKMRDGSLPLDIFRYYLI
FT                   QDGKYVEDMLMALLIASSKGPIDKVTKILNLVFSTLNKGLEIHSKLYSELSISRDEIVK
FT                   TRYNLINYAYTRHLYFYANLDWNKFLVAWTPCMFGYSIIGDYVVESPHQLYKTWASFYA
FT                   SNEYKKRVEAILHALNEVNITEGLLSIFVDSVRFEIGFWEASLRKDPMVY"
FT   gene            22070..22732
FT                   /locus_tag="LS215_0024"
FT   CDS_pept        22070..22732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34178"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJA0"
FT                   /protein_id="ACP34178.1"
FT                   /translation="MSWIRDTSFLMECVKNGSIKIEINVSNYSMSFNLLNGKYNLSLFS
FT                   SDNIRISYDGNRLIDMHNLRVLKDHDARVHISNMISNIKGNMSNEINNLAIMYNIPVKI
FT                   LNDNLEAIFNLNFSLLSCLDYGLDYFLIHLTNDFAKQSSQFDVIKKLKLILANEKGCIK
FT                   AILALSNTYESDSFLFSNDCISFQVNVNGFSKFLMDYRTLNAKYTEVIDYLKQRLSQ"
FT   gene            complement(22726..23439)
FT                   /locus_tag="LS215_0025"
FT   CDS_pept        complement(22726..23439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0025"
FT                   /product="protein of unknown function DUF91"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34179"
FT                   /db_xref="GOA:C3MJA1"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MJA1"
FT                   /protein_id="ACP34179.1"
FT                   /translation="MYSVLLNPSNTEIYSFLTERIYRELVVIFATCKVNYKGRAESVAS
FT                   ESPRLIILKPDGTVIIHESVKREPLNWQPPGTKIEIMNDYPLKIVAQRKRPKEVIEIDL
FT                   KEVFYITSAEVKDGDFVIKGREIDIVNTIIQNPSMIEEGFVPLTREYNTPYGKIDLVGL
FT                   DKKGNFVIIEVKRSKAQLSAVSQLYRYYLHIRETKEDKVRGILVAPDLTTHARELLQKL
FT                   GLEFIRYDIQKYSSY"
FT   gene            23491..24549
FT                   /locus_tag="LS215_0026"
FT   CDS_pept        23491..24549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0026"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34180"
FT                   /db_xref="GOA:C3MJA2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJA2"
FT                   /protein_id="ACP34180.1"
FT                   /translation="MEYYDLILYLLVFGANMLIILQTYNEIKMRKTVKGSFIGKVSIIV
FT                   PIKGIDTGLERNIESLLSQDYPYPYEVIYVVEKGDEVENVLKKYNVKIVYSDFNCDSCS
FT                   GKIRAQISGLLRASNDVIVFADSDTWYPRYWLRNLISPLDRYEATTTFSWPSPSRITLS
FT                   NLIRAGFWTLGFESQSLQSSRFLWGGSMALRREFFDNEVLDELSKEWCDDCTLTRIIKR
FT                   RGGKIGFVMSAIPLNVYDEDSLIRWSSRQIITILAYSPRGAKAYLVAGTFFTLILIYSL
FT                   VYLNIITFTPYLLWIVKNVIRGAKYPKQALIASLMTIVAIPYALFLVVFNWNRREVYWR
FT                   GKRYIVKPLREK"
FT   gene            24673..25236
FT                   /locus_tag="LS215_0027"
FT   CDS_pept        24673..25236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJA3"
FT                   /protein_id="ACP34181.1"
FT                   /translation="MQSTSVEIYLNIYSFRHELEHFTIEEERDEWSIVKDKANEKYIVK
FT                   EFADYGILIYPVYDLKDDILSSFSIQLPSVGKLKEILYTPEKWIDRLDLRINDNSIEVT
FT                   SLILDYLTGIDIINSLISSFGFQYAQLDDNSLIIKIRISRPLNRTLLDSHIRAIYHMLK
FT                   LYYSVKKAQEEIASKVTLSYIKSI"
FT   gene            25261..26313
FT                   /locus_tag="LS215_0028"
FT   CDS_pept        25261..26313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0028"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34182"
FT                   /db_xref="GOA:C3MJA4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023819"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJA4"
FT                   /protein_id="ACP34182.1"
FT                   /translation="MLWLVMTTGKCNLKCDYCGGSFPANVVPYGVKYDINLLKRLVEND
FT                   KESTIIFYGGEPLLNYKFIMTVLDNVIAKRYGIQTNGIAVRLLPEKYWRKINVALLSID
FT                   GREETTDKHRGKGIYKAVLRSAKYLKDLGVETIARMAVTQDSDIFADVMHLIDLGLFDK
FT                   VHWQLDVIWSEEWDFKSWSFSYLHGIKRLTEYFLSELRKGRVVKIIPILGVISAHFFDG
FT                   YKGSPCGAGYSSVTVTPDGRILSCPIAVREKWAELGNVNLGYRLLEDPLPDDCKRCEFK
FT                   RYCGGRCLYVQKERYWGEEGFKVVDEVNKEYLRTVLSIIPEIEKLIRDGNIRLSDLYYN
FT                   PLLDSTEIIP"
FT   gene            26339..27034
FT                   /locus_tag="LS215_0029"
FT   CDS_pept        26339..27034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34183"
FT                   /db_xref="GOA:C3MJA5"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJA5"
FT                   /protein_id="ACP34183.1"
FT                   /translation="MSVKFEESSRLLETIKSMLASATSSILIVTYSIDQEAASEILTRA
FT                   ASGVNTVLVTADKDWARWLKNQSEAYKKDEEKRLYRELRRNESIYVQIIYFTSIISIAI
FT                   AIIDIILYFMMGSLIYYDVPLSLIAIGFLIYYGIRKRREALSQISILRESVQNFVQEVS
FT                   QIRDKIKEKLKIIEIDSQVSFSIVSCDDKTILFSAPLKFSMDKPSVHVVMEISKQLADQ
FT                   LVNLILKIS"
FT   gene            complement(27164..28207)
FT                   /locus_tag="LS215_0030"
FT   CDS_pept        complement(27164..28207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0030"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34184"
FT                   /db_xref="GOA:C3MJA6"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MJA6"
FT                   /protein_id="ACP34184.1"
FT                   /translation="MIKEYYGAETFILNKDFAYILVIGTTDVSLIPGLTIAGATPELTH
FT                   FTPAADAEYVLLGKCKSINTIPVSPTGIPTPALLTRASLSFINPLKIVVNAGSRILPKI
FT                   PYIDLQGEPGKDIRKQALSMEKVNNIIENSIKLGEELSNEYELIMIGESIPAGTTTAMA
FT                   TLLALGYDAMDKVSSASPDNPKELKRKVVEEALRNLPTDSLQRLAKVSDPVLLGVAGTS
FT                   LGFKGKILLAGGTQMTAAAAIINEFDKNKLKDITIGTTKWIVEDKFADMLSLAKQVGVK
FT                   VLASMLDLSISAYEGIRAYEKGYVKEGVGAGGSAIMALVRGVSNNTLVRKIDELYGELV
FT                   GSNNLHI"
FT   gene            28271..28600
FT                   /locus_tag="LS215_0031"
FT   CDS_pept        28271..28600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34185"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJA7"
FT                   /protein_id="ACP34185.1"
FT                   /translation="MIESGTLVSLEEFKSNQKLKESVKNGIKGLVKLLFQEAGKIIKFT
FT                   SNDDLIFQLMKLGLISATLAQELLDILKIVNNLDSVDDEILHSMLVRIMEVIEEAINSI
FT                   DKYMG"
FT   gene            complement(28606..29736)
FT                   /locus_tag="LS215_0032"
FT   CDS_pept        complement(28606..29736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0032"
FT                   /product="aminotransferase class V"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34186"
FT                   /db_xref="GOA:C3MJA8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJA8"
FT                   /protein_id="ACP34186.1"
FT                   /translation="MRLRDPREFRENLPVTRKYVYLNHAAVSPTPLPSLFEAYRYLYEV
FT                   ANRGSIAANEEEEDELYHIRSKIANLIGAYPDEISLIPNTSYGVNLVAHGLEWKKDDNI
FT                   VTDNLEFPTVVYPFLKLAKKGVKVNVVKTNPYNFEEDIISNINKNTRLVAISHVSFNTG
FT                   LKVDVRKIVKAARENDALVLLDIIQSAGAVRINVEELDVDFAIAGGYKWLMSPQGSGFI
FT                   YVKRGLIEDPPFYGWKTSADYLDFNPNKFTLEKGPRRFEIGTVDIAANLSLAKSCEIIS
FT                   ENMELIESSVTYLSQFAIRLAKDHNMEVITPEEKRAGIVVVKVKKPKEVVKELLREDIV
FT                   VSPRGEGIRISTHFYNTEEEVQKTIEKILEIERKLN"
FT   gene            complement(29708..31420)
FT                   /locus_tag="LS215_0033"
FT   CDS_pept        complement(29708..31420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0033"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34187"
FT                   /db_xref="GOA:C3MJA9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJA9"
FT                   /protein_id="ACP34187.1"
FT                   /translation="MDYYTLYDLSLEKPETYWETFANKLSFFKKWEKVIEKNKQLPIAK
FT                   WFVNGTTNIAYNALNHTGKALIFYKEHKYKGDEITFNELNNMSSMIAGLLLDKGVRRGD
FT                   RIAIYMPNSIYTIATILAAARIGVIYTLVFAGLGINAIVSRISNLEPKLVISTDKTFRR
FT                   GKEIKLYTNLANIIFPRDSQFDYPREYKEFEKIESNEPLKIMYTSGTTGKPKGIILPHG
FT                   AWMVGDYTVFELMFSLKSNDIVLTTADVGWITFSRIMYGTLMHGSTLAFIEGAPDYPTD
FT                   RLPKIIDELQPKVLFTSPTLLRTLQKLDVKLPRVEFIATAGEIMDETAWKYALRFSDKV
FT                   VDVYGQTELGYVIGYPYALDSVEPKIGYAGLPFPGAVIDTVDEYGKSLRGHVGHLIARG
FT                   PFPTQFIGIWKDEAKFLSYFEKFNGHDTGDLAIINEKGYVKIVGRDDDMIKIAGHRITS
FT                   GEVESVINSLEGIVESAAVGIPDEIKGEKLVVFYVGNIDEKTIVTKVREMLGPIYVIDK
FT                   IYKVERLPKSRSGKIVRRVLRDLLLEKEIDETILEDPEILKEIKSEIKRSERI"
FT   gene            complement(31478..31954)
FT                   /locus_tag="LS215_0034"
FT   CDS_pept        complement(31478..31954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0034"
FT                   /product="Nucleotide binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34188"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJB0"
FT                   /protein_id="ACP34188.1"
FT                   /translation="MHIIFDTSAFLAGLQLSLDRIYTTQEVINEIKDKYSRFNLEIAIS
FT                   SGKVIIMKPSTRSVEKVTKVLNLTKERKLSNTDISVIALALDLQPSIVFTDDLSVQNIL
FT                   KHVGIQFSSIKINKKVEKSFKFKYVCIDCKREFDIDYRECPYCGGKVVKRRIME"
FT   gene            complement(31938..32687)
FT                   /locus_tag="LS215_0035"
FT   CDS_pept        complement(31938..32687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0035"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34189"
FT                   /db_xref="GOA:C3MJB1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MJB1"
FT                   /protein_id="ACP34189.1"
FT                   /translation="MRVKIVSKPTSQLNNIIEKIKNISTKLGFEVVDKDFDYVIAVGGD
FT                   GTLLRAVKQNKPVIAVKAGRRGLLMDVPVDKFEEALLRLKKGDYEEEEYMLLEMIYNDK
FT                   VELGFNEVGILYDRPEAIKVGISFDTERVSVEGDGVLVSTPQGSSGWGMSATNSLLYKD
FT                   LSAIEIIFVNPIFYYLRSVVIPPKPLTLRLEDKGYPQTARAVVDGEVVTLIKTNQEITV
FT                   RVSQRKAKILRFFKLDLIGEVLHAYHI"
FT   gene            32792..33859
FT                   /locus_tag="LS215_0036"
FT   CDS_pept        32792..33859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0036"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34190"
FT                   /db_xref="GOA:C3MJB2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJB2"
FT                   /protein_id="ACP34190.1"
FT                   /translation="MKGIKIIVARVIYAIHWFYLAPLIPFLASKLNLSLQIVGLIPFSF
FT                   FLGSGIMQVPSAYLSTKIGLRNTLLLGLIIMSISPLLISFSSNFIELLIFYLTDGIGAS
FT                   MFFSTGGGILASLNRDSPGLALGIYNASFAVGGLIGLNWYTMFGNYLSFYGLSILTFLS
FT                   LIINLNNPNLKPSWKIIRDNRIVILGISIAGIWGVYYVIGELYPTFAYYYLHLNLVDSS
FT                   LFTSLLLISSVIGGSLTFLADRKIKKFNLLIISSLLGSVPSLLLYTKVYLLGIVITGIF
FT                   NELAISVLYSIIASLQRDANATMGLAVVNSLNILIGMNFEPLASYSSYYMWIVVNIIGL
FT                   VLFSLIMLVRQNISI"
FT   gene            complement(33837..34190)
FT                   /locus_tag="LS215_0037"
FT   CDS_pept        complement(33837..34190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34191"
FT                   /db_xref="GOA:C3MJB3"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJB3"
FT                   /protein_id="ACP34191.1"
FT                   /translation="MTDQTQLGIVILALPLPILTYLWFRYYNIIITEGTKYVGENYREE
FT                   EIFLLPSSTKTVKIDGKVSILVYGVNPWITIRVNGGPKQKIFKIRLLNESGNLELINES
FT                   KVFQVRVKLRYSA"
FT   gene            34275..35273
FT                   /locus_tag="LS215_0038"
FT   CDS_pept        34275..35273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0038"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34192"
FT                   /db_xref="GOA:C3MJB4"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJB4"
FT                   /protein_id="ACP34192.1"
FT                   /translation="MNEYDMVIIGGGPVGLFGTFYAGLRDMKALLIDAQDELGGQLVSL
FT                   YPEKIVYDVGGLAGIQAYELAQRLIEQAKMFGPDIRVNEWADMIEKTSDNMWIVKTDKG
FT                   SYKTKTIFIAAGIGKIVPSRLGAKGEIEYENKGVYYTVRRKKDFEGKRILVVGGGDSAV
FT                   DWALNLAPVAKSVTLIHRRDQFRAHERSVKELFRVANVYVWHELKEIKGDGNKVTQAII
FT                   FDNRTKEEKVLNVDSVIISIGYKGDLGNIPKWGVNMKGRDIVVNGKMETNLPGVYAGGD
FT                   IVQLEGSPKLALIAVGFAHAAIAISVAKKYVEPSASLFAGHSSEMDKFKPK"
FT   gene            35295..36035
FT                   /locus_tag="LS215_0039"
FT   CDS_pept        35295..36035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0039"
FT                   /product="protein of unknown function Met10"
FT                   /note="Critica"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34193"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJB5"
FT                   /protein_id="ACP34193.1"
FT                   /translation="MKTERLNAYFPGVRSYYIIGEIAIVTPKRVNVDYNLVAQKIMQAH
FT                   PKIKAVYLKKKVKGELRTNELEFLSGERISSTIYKENGVLFYVDIVTVYVNPSLSGDRL
FT                   KNVELVEEGSIILDAFTGYGAIALNIAHKKRAYIVAGDVNINGLYMLKKSLSLNKIKGM
FT                   IDIVQYDAHYLPFRDKVFKLSFGDNPTLIIDFKEELCRVSENVVFYILCESKDKANSSL
FT                   GKTEWVKINDYSKNLFIFKGVVRC"
FT   gene            complement(35958..36443)
FT                   /locus_tag="LS215_0040"
FT   CDS_pept        complement(35958..36443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0040"
FT                   /product="Protein of unknown function DUF371"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34194"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJB6"
FT                   /protein_id="ACP34194.1"
FT                   /translation="MIAIDKIKIKGHYNIRGLHKTTLEITKDHYLTTRGDCIIGILANK
FT                   GARDLSESFKKIARNDERFIYAVIRVKELFDIIHGRGSSKFTFENQNKIIFRKSTFIEG
FT                   STVMIRSDKAARDINREIINLLKTEVEGEVHILASDNPLEDKEILRIVVDLNPLSFT"
FT   gene            complement(36403..36696)
FT                   /locus_tag="LS215_0041"
FT   CDS_pept        complement(36403..36696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0041"
FT                   /product="protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34195"
FT                   /db_xref="GOA:C3MJB7"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJB7"
FT                   /protein_id="ACP34195.1"
FT                   /translation="MYSQEIKDLIKKTRAERADIRIGKYGVTEGMLNEIKRRLNEHKVI
FT                   KIKIGIKEIDDRKEFAKRVAEMVGAKLIEVRGYTFILAKIDSNRQDKDQGAL"
FT   gene            complement(36656..36970)
FT                   /locus_tag="LS215_0042"
FT   CDS_pept        complement(36656..36970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0042"
FT                   /product="RNAse P, Rpr2/Rpp21 subunit"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34196"
FT                   /db_xref="GOA:C3MJB8"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="InterPro:IPR016432"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MJB8"
FT                   /protein_id="ACP34196.1"
FT                   /translation="MRIKNKIKKRIIELIELAYITARKGDLELAREYIKLAEMYSRKGR
FT                   IKIPLKYKRMFCRKCYTPLITGVTERRRIRSKILIRTCLICNWQRRYVLSRNKGSNKEN
FT                   "
FT   gene            36992..37663
FT                   /locus_tag="LS215_0043"
FT   CDS_pept        36992..37663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0043"
FT                   /product="Suppressor Mra1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34197"
FT                   /db_xref="GOA:C3MJB9"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR023503"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJB9"
FT                   /protein_id="ACP34197.1"
FT                   /translation="MLKYSMHLNIVLLEASLELVPKEIVNHPAVIKNAKRRNKKPEETL
FT                   LDISLHYHAMKSLENSHKRGRPDILHQALLVILNDPVIKGDLFIHTIQSKIIKVNPNMR
FT                   PPKNYLRFMGLMEQLLKYGRIPINGDESLMEVTNLTLEEIAARYNLILLSEKGEKINPE
FT                   ELCKLDEKWILGIGTFPHGDFSEKILSLAKKIYSISEFQLETQQVLCRIFSACNSILGW
FT                   P"
FT   gene            complement(37644..38219)
FT                   /locus_tag="LS215_0044"
FT   CDS_pept        complement(37644..38219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34198"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJC0"
FT                   /protein_id="ACP34198.1"
FT                   /translation="MPRVNIAAEADLIEQLESEAKKRGYTIYSLTNAALKALLKLLKEG
FT                   EDANTLESLVDYYTISKALDIVPVTSWFLENLTKLAYEKDSKQYENMCEEVGEQIGSFL
FT                   RSKASTLDELFDFYNAIKIILPIRNVAIKNAGDVIEFRITGTGFSLISTLCAGKIFSKI
FT                   AEAYDLSIQDVDVVPGGIVTIKAKANLK"
FT   gene            complement(38294..38473)
FT                   /locus_tag="LS215_0045"
FT   CDS_pept        complement(38294..38473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34199"
FT                   /db_xref="GOA:C3MJC1"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJC1"
FT                   /protein_id="ACP34199.1"
FT                   /translation="MRKHKLRWWIYLSQKKSEIKSWANLIKTLFADNNWYLGVFIVLLI
FT                   LFIIFDLIAFTPHS"
FT   gene            39048..39932
FT                   /locus_tag="LS215_0046"
FT   CDS_pept        39048..39932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0046"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34200"
FT                   /db_xref="GOA:C3MJC2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJC2"
FT                   /protein_id="ACP34200.1"
FT                   /translation="MISVKVLRRLSIIFLFSSIFLIPIFLLEFIVGILFKSYILIADSY
FT                   HTLIDFLISLLFYFTLVKINTRSRRFPWGLYNLESLVILATSIFIVYLSANLILSMFDS
FT                   SITFSISPWYSIILFASSIYSLALYFVERRYAEIQIVKNDMVHSFLDSIAEVVSGITLI
FT                   VQNMVLIDVVTLAILTFTLSDVIREIKDSILSILGASIDSPMKFQLINELRSKNIPIIN
FT                   LYLKRCGSFYAVYAYIGLPKDITLEKAYKIKRKTKRIIKKYDNIACIDVILVPLTEIKK
FT                   KKILEQVNTLYSR"
FT   gene            complement(39900..40766)
FT                   /locus_tag="LS215_0047"
FT   CDS_pept        complement(39900..40766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0047"
FT                   /product="protein of unknown function DUF191"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34201"
FT                   /db_xref="GOA:C3MJC3"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJC3"
FT                   /protein_id="ACP34201.1"
FT                   /translation="MVTIRVGALADSGDLYPFIPLMEGKVRPEGFNLEFEVIPTVQDIN
FT                   EAVLKKEVDVSVPSAAMYPYIQDDYYILSNAVATAVDGITGMPILAIKEMSENEIKRSR
FT                   LIVHGPNTTAFTLYKLLMGKYGRLVIIRRVLDEIKALGKEGDVLVAVHEIKMMYALKKL
FT                   GINVVRIGSMWDMWKAISNNTPMPMGMVVISKEVGKDFALKFKETYEKSKKYAEKHLDE
FT                   IIPRDVQIMRESQKVDLDEEIVRKTIWADIQEYNVPVDEVRRGLEFFFKISEERGILPR
FT                   VKSINLL"
FT   gene            40870..41400
FT                   /locus_tag="LS215_0048"
FT   CDS_pept        40870..41400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0048"
FT                   /product="protein of unknown function DUF84"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34202"
FT                   /db_xref="GOA:C3MJC4"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MJC4"
FT                   /protein_id="ACP34202.1"
FT                   /translation="MVTIALGSKNPVKINATKEALDVLKLNWDLIGIEVDSGVDKQPFC
FT                   DQTYVGARNRALNVIRVTNADIGLGIEGGVCNVYGKFIANAVVYVITKEGLENFAISSS
FT                   FTLPSSMVSLILQGKELGEASDIIFKTNNSKTKEGAIGLLTNNVINRKMLYVQPIVLAL
FT                   YPIYNTMINNTPF"
FT   gene            complement(41381..42034)
FT                   /locus_tag="LS215_0049"
FT   CDS_pept        complement(41381..42034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34203"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJC5"
FT                   /protein_id="ACP34203.1"
FT                   /translation="MNPLLLGIDGLSYTSFMKCNPRTLFTLFSSTYRGVVLNKKPQFPQ
FT                   TSWMSVLELKDIKDMSAVNLNNEKPRLLKETNAVAINLPITNPTYGKLSLPYDTSVNAE
FT                   EEINKVTQIVLELIEESPVIASITAIDRLLHKDPTEKCKIYSLVDSAVRKILNKVDDFI
FT                   IFSLYGEPKGENEDGNHEDYGVFLATIPRPSEHDTVKLQEIGELFIKLVKKEYY"
FT   sig_peptide     complement(41975..42034)
FT                   /locus_tag="LS215_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.503 at
FT                   residue 20"
FT   gene            complement(42047..42454)
FT                   /locus_tag="LS215_0050"
FT   CDS_pept        complement(42047..42454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0050"
FT                   /product="thioredoxin"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34204"
FT                   /db_xref="GOA:C3MJC6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJC6"
FT                   /protein_id="ACP34204.1"
FT                   /translation="MNDELNDPELQKILSKKANQILNSLKEKVEEPVKHLNSKNFEEFI
FT                   TKNKIAVVDFWAEWCAPCFILAPIIEELANDYPQVAFGKLNTEENQDIVMRYGIMSLPT
FT                   VMFFKNGEPVDQILGAVPREEIEVRIKALLE"
FT   sig_peptide     complement(42341..42454)
FT                   /locus_tag="LS215_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.823) with cleavage site probability 0.237 at
FT                   residue 38"
FT   gene            42511..43425
FT                   /locus_tag="LS215_0051"
FT   CDS_pept        42511..43425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0051"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34205"
FT                   /db_xref="GOA:C3MJC7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJC7"
FT                   /protein_id="ACP34205.1"
FT                   /translation="MPKLIIVGSGITGLITALKYSGDVIILEKNKIVANNSKASLWSII
FT                   PPLCSNHREDCEKGMRFYEEICEKYGIYCKKTHILRVSSKKIGGKIVDRKEIRGLEPQL
FT                   NIEEAEFFENGLFVEGDELFSILETEFNIKSNSEVTDILVKDNEIKSLLTSKGEVKGEF
FT                   YIFATGYLTPKLFSKLGIEVNLFKGHLIITKKTSLNGILIVNDRIAVEGKKLYLNGDSK
FT                   QNSSMTIDYDEISKTINEIGRVLKIDTTNLEIRVGFRSVSKDREPIVKKIYSNAILITG
FT                   YRFGFALAPVLAEKAIQMIKYGH"
FT   gene            43415..44128
FT                   /locus_tag="LS215_0052"
FT   CDS_pept        43415..44128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0052"
FT                   /product="Protein of unknown function DUF516"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34206"
FT                   /db_xref="GOA:C3MJC8"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MJC8"
FT                   /protein_id="ACP34206.1"
FT                   /translation="MDIKLVYSTSDPVGLTIKKLGYSFEEIDEDVTDFHYKNGEAIVIF
FT                   SRHESKASIPSLTVHYPGNPSEEVMGGEPKKLGIAYPRLLTSILREIKKIDLDIEKTME
FT                   ATHHGPTYQNVPVIFVEIGSDKTYWTNERIVRTLVDSTLKGIDKVDETDCRDYISGFGG
FT                   PHYSKLFTKLADESCIGHVISKHYVDKLDDKVIIQAIANSVNNINKVVIDSLNLKQRER
FT                   IIAALKSFDIHIQLR"
FT   gene            complement(44093..44725)
FT                   /locus_tag="LS215_0053"
FT   CDS_pept        complement(44093..44725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0053"
FT                   /product="Phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34207"
FT                   /db_xref="GOA:C3MJC9"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJC9"
FT                   /protein_id="ACP34207.1"
FT                   /translation="MTIIIFIRHGQSTSNVSKILSHDINTYPLTEEGVTQAKDAGKELM
FT                   KLKVEKIYTSPVLRAYQTALIIGETLGIFPIVDQRLRERSLGELNNTTFDPNDHWKLKV
FT                   FKKQMEIKGLESWEDMTKRMKSFLESVINKDNNVIAAVSHSDPIRAIVTYILDMDDISG
FT                   WGVRIPNASLTILRCENNIDSCKVLSIGSPLLTPQILSKLNMNIKAF"
FT   gene            44794..45771
FT                   /locus_tag="LS215_0054"
FT   CDS_pept        44794..45771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0054"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34208"
FT                   /db_xref="GOA:C3MJD0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJD0"
FT                   /protein_id="ACP34208.1"
FT                   /translation="MVSLFKRNKHSTNSTTDLRILFSSDLHASYTVFKKFINAGKIYKV
FT                   NALIIGGDIAGKTLIPIIDLGNNNYNIQDKIVTSSELNSFIERFKSEGIYYAILSKNEY
FT                   EEASQNKKAQDELFKKAIIATIREWMKIAEERLKDYKIPIFINLGNDDPEYLFEVLKES
FT                   EIFKVGEGEVFDFNGYEIVSYGYVNPTPWNTFREKKEEEIYNDLSKIVSKITNYSKAIY
FT                   NFHAPPYNTNLDNAPLLDENLKPIVRGGEIVYTHVGSKSIRRIIEETNPLLGLHGHIHE
FT                   SRGFDKVNNTIVINPGSEYNSGLLHAALVILEGESIKAHQFILG"
FT   gene            45983..46309
FT                   /locus_tag="LS215_0055"
FT   CDS_pept        45983..46309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34209"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJD1"
FT                   /protein_id="ACP34209.1"
FT                   /translation="MIIFYAIGERDRAKELVRIITKTRWKTISKHAIKIASSSIGPSVV
FT                   IFKPTMAGLAVALWLKQRAEELGMTSAVGWFQPINQIPPQVEDAIRTDLNKILVKKLEV
FT                   PWSP"
FT   gene            complement(46311..48074)
FT                   /locus_tag="LS215_0056"
FT   CDS_pept        complement(46311..48074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0056"
FT                   /product="BPS2 protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34210"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJD2"
FT                   /protein_id="ACP34210.1"
FT                   /translation="MKVRVFNIGGITQDYSLDLEKGVTSYEAPNAYGKTSLVRALISLL
FT                   TSSIKAEDLLNVFADSGYIEVELDNKLYYRRIKRIKNGLSEDKNLIMDDDRALLLTYFS
FT                   PENKLVTQILSGDGNVEWFISATSKINEIKAKKEELQKLLTAEINARDDLQKKYNNIRE
FT                   IQAKIRAIDEEIDKLEKERESSSNIVAKTTYTITLTRQNKINEIVNKIKVKKDELANLE
FT                   FALKKIEEEIQNKESKVSPDIKTQLQKELEEINEKLKLKTSDRSELEIELKVLERVLEE
FT                   VDESDKHHLDTCNVCGSKVDPSIWKERAEIISRELRDKTSLLDSLRNDIIGLQKRKEEI
FT                   DLRLKEFQTLENEIAKLKAKKEELINRIGSVKFQIDDLERQKRETEERFNKSESLSGAI
FT                   ATSDDSTSILKRIEELRKKREEYEYELQLLGVPSSILEELKEKEEHIEQLQKKVDELQV
FT                   EYIRRLTKAREEFNRISNQLLRKFEFDMEAEIDGNYRLIVRRKGAIIDIKKLSSSERTT
FT                   LALILVLSALRAYFKTPYFIIDESAMTFDQKRFNRLLEYLTEIADYVIVTRSSENTEIK
FT                   TLPPKQIEISS"
FT   sig_peptide     complement(47925..48074)
FT                   /locus_tag="LS215_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.836 at
FT                   residue 50"
FT   gene            48282..49205
FT                   /locus_tag="LS215_0057"
FT   CDS_pept        48282..49205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0057"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /EC_number="3.2.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34211"
FT                   /db_xref="GOA:C3MJD3"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJD3"
FT                   /protein_id="ACP34211.1"
FT                   /translation="MRKVVLDSDTASDDTIAILLASRYFQLLGVTIVAGNVNYNQEVKN
FT                   ALFTLEYIGKQDVPVYLGSQRPILGNWRTVEEVHGSNGMSDWDYPEPTKRPEKEHAIDS
FT                   ILRLSKEYDGELEILAVSPLTNIALAYLKDPSVVKRIRKIWIMGGAFSKGNTTPIAEFN
FT                   FWVDPEAAKIVLDAGFDITVVPWEVAETSGSLNERDWEFISKLNTKLSKFFINVNKTLK
FT                   EYTTKNQGISGSTHPDSLTVSIAYDRSIISESSLKYIDLELCSKSRGAMLIDWYSLHKN
FT                   KPNAEIVLKADSNKFKNLLFRTLSEF"
FT   gene            complement(49179..49589)
FT                   /locus_tag="LS215_0058"
FT   CDS_pept        complement(49179..49589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0058"
FT                   /product="ferric-uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34212"
FT                   /db_xref="GOA:C3MJD4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJD4"
FT                   /protein_id="ACP34212.1"
FT                   /translation="MEVDLANLLRQRNLKVTPQRIAILKLIMRGGHYSGEQIYEELKKT
FT                   EPSISLSTVYNTLETLKESGILNSFEVNGITWFEINRKPHVNVFCTDSNRIIDLDVEMD
FT                   NFMDKLVKNGLDVKNVNIIVYADCSKLGKGSE"
FT   gene            49693..50178
FT                   /locus_tag="LS215_0059"
FT   CDS_pept        49693..50178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34213"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJD5"
FT                   /protein_id="ACP34213.1"
FT                   /translation="MQNFREISIDIVLSHRIRNYDQIILEGSRKRDSCAFFIYGYCKKI
FT                   SSKSKVLASWISNGKIVPHPLFCYLCPFYSLRDDDKTVTIDLFDIYLTYKNLKTQIERE
FT                   LEFIESRLSEFSFSTSIALRRRREDLIAFLDDISTKIKILMEIIRVSEREHEDGRYI"
FT   gene            50156..50833
FT                   /locus_tag="LS215_0060"
FT   CDS_pept        50156..50833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0060"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34214"
FT                   /db_xref="GOA:C3MJD6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJD6"
FT                   /protein_id="ACP34214.1"
FT                   /translation="MRTEDIFNDPKSYKKWYELHNKLYENERKVVRSFNLKDCLDLGSG
FT                   PDIFHEEIRGKIVSLDISLLMLKESKSDEKVLADALHLPFRDDSFKCIFSSVTVCFIED
FT                   VKGFIKEIARVAKERAVICFIARDSPWGEYYEKLGKSGHNYYSYAHFISRRELYVVIND
FT                   FMKISRIRSTLKDMSETETDETYNDDRGSFICVEAIPKKSEPLSLSLNRHSGADPADPI
FT                   SKL"
FT   gene            51092..51910
FT                   /locus_tag="LS215_0061"
FT   CDS_pept        51092..51910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0061"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34215"
FT                   /db_xref="GOA:C3MJD7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJD7"
FT                   /protein_id="ACP34215.1"
FT                   /translation="MQRTFILTLFTSLSFIIAYYISLSPLILAEFSHALIDFLTITFSI
FT                   IALKFIGENEVSEGRLSYGLHRLEVIVAMINIFAIILLSLIVAYTSITSLLKETTNSSF
FT                   ALIISSALASILTFFASPKEKDNLGKRGLYVHIISDFLGYIIGFVIGILILISGIHELD
FT                   PVGAIILVILNFALAIPLLKESFLIFMEGSPVKIDNIMGELTKISPGIHHLHVWSICDH
FT                   VKVATLHVKASPNLTIAEADKIRGSICSLLREKYGISHVTVQFETTNDDD"
FT   gene            complement(51907..52926)
FT                   /locus_tag="LS215_0062"
FT   CDS_pept        complement(51907..52926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34216"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJD8"
FT                   /protein_id="ACP34216.1"
FT                   /translation="MIRKIYDKLAESHNEIKNQIYNIASYLRQEIQEKVNEFWTEYTRD
FT                   NELSEICRFVAIDGGSFSKPMRIGIVYAVGAESVIGDNKGVKTLSEDGQIGIFKPGNDA
FT                   QERISLLMEALELSLALRDGSKGDYILMDGSLNKKIGNKVDIQQVSDEELKLVKNVDIN
FT                   SIISIKDERKMRDLLMLLNQFLVSRIIEQYDSKVLWISKTSRGRDLFGTDYPDITVFEL
FT                   FTEKRGFSKLIIKNIDIRKISEIPELEILRKMEYTTFYTRLDNGKRVVRIDMVGRVDEK
FT                   IVKEIMDHLSGVSIKGYPFPLLKAHIDVRFSRMDREKIIKLMGSKLHKDIEWWPSQFY"
FT   gene            complement(52923..55517)
FT                   /locus_tag="LS215_0063"
FT   CDS_pept        complement(52923..55517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0063"
FT                   /product="Rad50 zinc hook domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34217"
FT                   /db_xref="GOA:C3MJD9"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR022982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJD9"
FT                   /protein_id="ACP34217.1"
FT                   /translation="MRIDKITLTNFLSHEHSEIHFLGEINVIVGQNGAGKSSIIDGIVF
FT                   SLFRTHSRGNNDNLIRKGSNKASVTLHLSNEKDKIEIIRDIRSTTEDRLIRNQIPVARS
FT                   ATVVSNEIEKILGIDKDIALSTIIVRQGELDKILENLQDIMGKILKLESIEKLIDSRGP
FT                   IVEFKKNLENKLRELDRIEQDYNDSKKNLEEKRNRVLELEKDRKKLEDEIKNLENQITE
FT                   LKKQFEDYEKKRNQYLELTTILKVKETKLNELNKSIEELRRQTENMDKLEKEVNELDNL
FT                   KNFRLKFEKYEVLSRSYIEISNNILNLEKEIEEYEKAIKRKKELEPHYLRYKELERKLE
FT                   ELQPKHEEYLKSKSNLDSKLNLKERLEKDASEFSKDIDRIGNLEQIMEEKRKRQLDLRA
FT                   QLGKVESLISEKNEIINNLSQVKGETCPVCGRPLDEEHKQKIVEEAKSYISRLELDKNE
FT                   LEEELKKTTDELNKIEKEYRKLSNNKANYDNVIKQLRKLNEEIENLHNRIEALKDIEEE
FT                   IKKINVEIKDLKQYYEEFMRLFKYDEKELERKKNRLDEMNKKKVEIEKEMRALETELQG
FT                   LDRKELENKISDLERKKKILDEMKKKRGVLEDYIGQVELLQEDVKKLREKLNIIQFDEN
FT                   KYNELKTSLDVHNASLKEKENRKSRVEGELDSLGKDIEEISNRIKNYELQLKDKEKIIN
FT                   GINKLEKIRDALGERKLQSYIIMATKQLIENNLNDIISKFDLSIKNVEMEIMPKTSRGK
FT                   GSGGNIVIYTNNGDTLPIVSLSGGERIALSIALRLAIAKALMSNTNFFILDEPTIHLDD
FT                   QRKAYLIEIIRAAKESVPQILVVTHDEEVVQAADYVIRVEKRGNKSFVREET"
FT   gene            complement(55514..56662)
FT                   /locus_tag="LS215_0064"
FT   CDS_pept        complement(55514..56662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0064"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34218"
FT                   /db_xref="GOA:C3MJE0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032885"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJE0"
FT                   /protein_id="ACP34218.1"
FT                   /translation="MMVQILHISDTHLGKRQYSLAEREKDIYDVFSQLIDIAIKERVDA
FT                   VIHSGDLFDVSNPTTNALVIAVKILKKLKDANIPFLSIPGDHDTPKRKGYIIPHNILTE
FT                   LDLIKILNYDKPYIIKDIEIYGIPHIPTVSKNVLVSTLSSLKPKSSRSILLLHQGVKQI
FT                   LPYDGSWQMELGSLPKGFGYYALGHLHTRWRLIQDDGSIIAIAGSPDIMREEEIEGYEK
FT                   FGKGAYLIDFSKDLPTLTTINTTVRPQKVVTINTKNLKNDISKIKSDLLKNNKGENNKP
FT                   ILHIIVEGERMRKDLLYRELLPLNDIALYYRIYKDETIQSVDNLTYTLPQDRGLDKIII
FT                   EYLTKYEKFNEDEANLILQMIKNVDSEDIVNEILKRLTGVNL"
FT   gene            complement(56662..58164)
FT                   /locus_tag="LS215_0065"
FT   CDS_pept        complement(56662..58164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0065"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34219"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJE1"
FT                   /protein_id="ACP34219.1"
FT                   /translation="MIIGYVIGQATTQEALILAERPVRLGTYVVLEYDNVKALGLITNV
FT                   TRGSPMLDDNMNDIEIVQRLKQFNNSIPVYTKAKVKMLCDMNNHFLMPDIPPFAGTPAR
FT                   EAEDEELKSIYSQDGQIRIGSLIGKNVEVKLNINSFARHLAILAATGSGKSNTVAVLSQ
FT                   RISELGGSVLIFDYHGEYYDSDIKNLNRIEPKLNPLYMTPREFSTLLEIRENAIIQYRI
FT                   LRRAFIKVTNEIREKLKEGQIPFSTLNSQFYELMRDELETQGNSDKKSSAKDEVLNKFE
FT                   EFMDRYSNVIDLTSSDIIEKVKRGKVNVVSLTQLDEDSMDAVVSHYLRRILDSRKDFKR
FT                   SKNSGLKFPIIAVIEEAHVFLSKNENTLTKYWASRIAREGRKFGVGLTIVSQRPKGLDE
FT                   NILSQMTNKIILKIIEPTDKKYILESSDNLSEDLAEQLSSLDVGEAIIIGKIVKLPAVV
FT                   KIDMFEGKLLGSDPDMIGEWKRAEENERIAKGFADFGTEIGD"
FT   gene            complement(58260..58808)
FT                   /locus_tag="LS215_0066"
FT   CDS_pept        complement(58260..58808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34220"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJE2"
FT                   /protein_id="ACP34220.1"
FT                   /translation="MALGKETEMGLKELFKANAEDFMSLMLVAEKLEQLGKKEEAKALR
FT                   EKALVELGHAKAIFETLLKNQELRGVVGEMAKEEQEQHISEYNKVAMTAKQEGHEDIEK
FT                   MLCSFADQEAKIAETIAKVSKVLNEMAKEEQEQHISEYNKVAMTAKQEGHEDIEKMLCS
FT                   FADQEAKIAETIKSVAKAL"
FT   gene            59066..60571
FT                   /locus_tag="LS215_0067"
FT   CDS_pept        59066..60571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0067"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /EC_number="2.7.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34221"
FT                   /db_xref="GOA:C3MJE3"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJE3"
FT                   /protein_id="ACP34221.1"
FT                   /translation="MISVKEMRALEINSSALGVSTLILMENAGRSVKDEIVKRFNVKDK
FT                   VAYVYVGHGGKGGDGLVAARHLADEGAKVTVILLGENKHEDAILNLNVIEEMDYSITLV
FT                   EIKDMDELKPISADILIDAMLGTGFSGKPREPFRSAIKAFNNSKGFKVSIDVPSGINAD
FT                   TGEAYEDEYVKPDLVVTFHDIKPGLLKYNFNTVVTKIGIPVEAQIYVGPGDLIVNVRSR
FT                   PYYSKKGDSGRVLVIGGSYTFSGAPTLAAMGALRAGADLVYVASPEDTARIIAGYSPDL
FT                   ITIKLRGKNFSPENFEELKSWIDRADVVVIGPGIGLAEETIEASKLIVNYVKEKNKLAV
FT                   IDADALKAISGFDLYENAVITPHAGEFKIFFGEEPNKNIRDRISQVIRYAKKCKCTVLI
FT                   KGYVDIISDGKRFKLNKTGNPGMTVGGSGDTLTGIIATLMAQKIEPFIAAYLGVFINSL
FT                   AGTLAYNRLGAHLTPTDIINEIPNVINNPLDSFKRKLYKRVLS"
FT   gene            complement(60563..61012)
FT                   /locus_tag="LS215_0068"
FT   CDS_pept        complement(60563..61012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0068"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34222"
FT                   /db_xref="GOA:C3MJE4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJE4"
FT                   /protein_id="ACP34222.1"
FT                   /translation="MNVGEEAPDFEAESTLGKIKLSDFRGKKVILYFYPKSFTSGCTRE
FT                   LQRFTELYDEFKKLNAEVIGVSVDKIDTQKKFAEKYGAKFPIVADAQKTISKLYSVLNE
FT                   RGTSAQRVTFIIDENGKIVDILKNLKKAEEHADKSLEIIKEQNST"
FT   gene            61093..62628
FT                   /locus_tag="LS215_0069"
FT   CDS_pept        61093..62628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0069"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34223"
FT                   /db_xref="GOA:C3MJE5"
FT                   /db_xref="InterPro:IPR007566"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MJE5"
FT                   /protein_id="ACP34223.1"
FT                   /translation="MRIIPRTMSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGV
FT                   HEVMWDAEGKDVDTHVVRKLLSNYPDYFREHILGKDVFLTYRLPNPKVEGADRKVFAET
FT                   MESIPITYDLAEKFYGNGITVPVFEVILPMTTSNLEIISVARYYEKAVANEDELELYDG
FT                   VKVKDLVGEIYPKVIEVIPLVEERDSLQNIDNIVEGYYKVIKPKYMRVFLARSDPAMNY
FT                   GMITAVLSVKIALSELYKLSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYT
FT                   YTIQSAFKYDYDYDKVKSAISSINNSRIGPAKILEKYEEDVLRKITILYTERYQPIIES
FT                   LANAINDVSVLLPRRRARKLHIGLFGYSRSAGKVSLPRAISFVGSLYSIGIPPELIGIS
FT                   SLSNLDEKEWDIFKQNYVNFKHDLQTAARFFNWESFELIKDIWKISEDTIAKIKEDIDY
FT                   AESVIGIKLGGIDYDSRKHILMSSLFLLSFKEKILQESKKYLYEMALIRRSLG"
FT   gene            62625..63434
FT                   /locus_tag="LS215_0070"
FT   CDS_pept        62625..63434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34224"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJE6"
FT                   /protein_id="ACP34224.1"
FT                   /translation="MRILVNGLLPLDSGKTTFSLSIIRLFNQVGIRLFPFKPIAGHNAW
FT                   YSFNTLIRSEELGILVGNDALKYYDETKYDIRRINPFAVLFVPIDLEKLSYNVSLYNMI
FT                   MEYGFPYLIRLSDCINGIDQYFVNSSADIYVPKSMLKFTRNLALKFNAKSYDKMREIID
FT                   ASPQLVDNCTIDVFRNYENVIIESYNDSASPTYNSADVDYVFTVSPTKAFLIKGEEFKK
FT                   ALSLFSIPPWNVRVSTLIKYLKIGKSFEIDVGERVAKDEILDILLKS"
FT   gene            complement(63424..64092)
FT                   /locus_tag="LS215_0071"
FT   CDS_pept        complement(63424..64092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0071"
FT                   /product="protein of unknown function DUF1641"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34225"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJE7"
FT                   /protein_id="ACP34225.1"
FT                   /translation="MTNGEFYALDNLLKDEKLNSLNKILDVINTTDRLGILDVIKGILE
FT                   DENTIGKIIGSLTSDDVLELLASWDKIIKTTKLFINDDNIYNIQFLINLIDKVRSRGIL
FT                   DPIIGLLEDEESLGKIINSLINDFTLSLINHWDEITNDLSRIDLTNFKYYTLLVSATGE
FT                   ALKTENVKPITSIWEIYKLLKDPDIQRGLGVAASVLKHIGKLYVPDRGLAFEAEKNSKT
FT                   "
FT   gene            complement(64099..65343)
FT                   /locus_tag="LS215_0072"
FT   CDS_pept        complement(64099..65343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0072"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34226"
FT                   /db_xref="GOA:C3MJE8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJE8"
FT                   /protein_id="ACP34226.1"
FT                   /translation="MKLIRMTKVLVLGARFGGLSAAYTLKRLAGNKAEIKVINNTRFSY
FT                   FRPALPHVATGVIDEDDVKVDLTKALPEKRMNFQQGTVEKIDASGGLVYYTKPDGNKTE
FT                   EDYDYLIIALGAHLGTELVKGWDKYGYSVCELDYALKLREKLKDFKGGTIAIGSGLFYQ
FT                   GKTPKPKVPENYVPVADAACEGPIFEMSLMLSGYFKKKGMLNKVKFVVFSPGEYLSDLS
FT                   TMSRKIVREMYKQMGIELFENFRIKEIRENEIVDEAGKTIKADLTILIPPYTGNPALKN
FT                   STPDLIDDGGFVPTDLNMVSIKYDNVYAVGDANSLTVPKLGYLAVKTGNVAAQHLATRL
FT                   GVQVKVDQYYPTIICVADNPFEGFGVAVKDDTWYGGTTSIAAPSPINHMKKELFHKYFI
FT                   WTKGDMALEKFLASW"
FT   gene            65477..66070
FT                   /locus_tag="LS215_0073"
FT   CDS_pept        65477..66070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34227"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJE9"
FT                   /protein_id="ACP34227.1"
FT                   /translation="MQQLVDKFLEVKGRKIHYIESGDGSPVLLFHGARFNARTWVETNT
FT                   VDSISNIGYKAISVDFPGFGSSEKIEGISLSEFINLFMNSLGISKAILLGASMGGKAVL
FT                   EFSLKYTESVYGLVLVGAVGVEEFEDQISKLNKIPLLLIWGSRDTVSPKRNYELILDKV
FT                   KNAKLEIVGKNHACYLDDPNTFNEKIVNFLKGMK"
FT   gene            66067..66708
FT                   /locus_tag="LS215_0074"
FT   CDS_pept        66067..66708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34228"
FT                   /db_xref="InterPro:IPR017139"
FT                   /db_xref="InterPro:IPR019254"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJF0"
FT                   /protein_id="ACP34228.1"
FT                   /translation="MSDKEELSAKLRIILRDIRYLTILKHLKIANVDYGKSIMLNTRIP
FT                   LAEIVEILDDLERLGLIERVHGATLKNTEAKFKLSSEVHKHHTYYRLTREGDHLLRHLE
FT                   DRMLIDAYMEIVKNDNLALNILRLADELNADHALTYAKLTHKRLEEITPKIEELVKMGL
FT                   LEEKNSKIIKFADRKAKPKKETRTHHKYYGLSRIGELVVREMKRRGILPK"
FT   gene            complement(66697..67644)
FT                   /locus_tag="LS215_0075"
FT   CDS_pept        complement(66697..67644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0075"
FT                   /product="LAO/AO transport system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34229"
FT                   /db_xref="GOA:C3MJF1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJF1"
FT                   /protein_id="ACP34229.1"
FT                   /translation="MLNNNLPKLIEEALNGNELAIARLLTKIEYMTDEGISALGALSKR
FT                   SGNAHVIGITGIPGAGKSTLIGGLIQEYVSRGHRVGVIVIDPSSPYTMGSFMGNRLRFQ
FT                   DKTMLKNVFVRSIGSRGYLGGISAEALMLTEALDGLGYDKIIIETVGAGQTDTEVEQSV
FT                   HTILVVTIPGAGDDIQALKAGIMEIGDIYVLNKTDRPDAELTFNTLKFAIDSSEISYRD
FT                   GWKPLIVKAVAIKNEGISEIVNKIEDHLNYLKQKELFKKRIIDRRAKIVELIARRKIDE
FT                   IISEIVKKNYNTIINEDITEAVPKVIHNVKELLR"
FT   gene            complement(67634..68059)
FT                   /locus_tag="LS215_0076"
FT   CDS_pept        complement(67634..68059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0076"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /EC_number="5.4.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34230"
FT                   /db_xref="GOA:C3MJF2"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJF2"
FT                   /protein_id="ACP34230.1"
FT                   /translation="MMITTKRIKVIVAKLGLDGHDRGAKVVARALKDAGMEVVYTGLRQ
FT                   TPEQIVKAALQEDADVIGISILSGAHLELIPKVIEIMRQNGLNDVGLIVGGVIPPDDIK
FT                   KLKDMGVDEVFLPGSSLKEIVEKVKKVARQKRGIDVE"
FT   gene            68240..68458
FT                   /locus_tag="LS215_0077"
FT   CDS_pept        68240..68458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34231"
FT                   /db_xref="GOA:C3MJF3"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJF3"
FT                   /protein_id="ACP34231.1"
FT                   /translation="MEFVRMRKEFRGKLTTVLVLLGSFLIAQFGSFLLDFIMWSNDKNP
FT                   IYIYPSLITVSLSFITILLFYYYITKI"
FT   gene            complement(68445..68852)
FT                   /locus_tag="LS215_0078"
FT   CDS_pept        complement(68445..68852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0078"
FT                   /product="regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34232"
FT                   /db_xref="GOA:C3MJF4"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJF4"
FT                   /protein_id="ACP34232.1"
FT                   /translation="MEEELTGTARKIYLYLLRQKRPVGIRKIQKDLNLSSPSVVSYHIK
FT                   KLIEDGLVKEVDEGYIVTKVILEDYIRFRSALVPRSIFLTSFLVSSLVILIYLIISHPF
FT                   SADIFSLVVVFIITIISVYDVTRKYKKLKSL"
FT   gene            68922..69011
FT                   /pseudo
FT                   /locus_tag="LS215_3008"
FT   gene            69059..69598
FT                   /locus_tag="LS215_0079"
FT   CDS_pept        69059..69598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34233"
FT                   /db_xref="GOA:C3MJF5"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJF5"
FT                   /protein_id="ACP34233.1"
FT                   /translation="MNIVVNVKQYLMVIAGVLVSLAIASLVVYVSHMFITYTIKKPNIV
FT                   ERQSGYAPQMYELTVNARPPNGSYINSYFIYSPLQSSLVINKDPVFHVYPSIIDLNSFN
FT                   NSAIITIYYSAHDRVNIAVTQQIFNVSVINTTVINDEIVATQVKITFYNASPNTIYLIP
FT                   IWNQYNVTYYVLIYYE"
FT   gene            complement(69682..70158)
FT                   /locus_tag="LS215_0080"
FT   CDS_pept        complement(69682..70158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34234"
FT                   /db_xref="GOA:C3MJF6"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJF6"
FT                   /protein_id="ACP34234.1"
FT                   /translation="MKDSEYYVWVLVGSIILTIILLSMAPLVPIDEPLVYRASSGVTYN
FT                   LTIPVGVSFSAFVALIIFIISILLVSGYKNDYYNMIIDASGISFVFLNYLNYYLIWYVW
FT                   RPQIQMLPFLVEISYNHAATLQLDIGQIVIVIFLYRLYKRLRKPRSLSGPDEKL"
FT   gene            70248..70553
FT                   /locus_tag="LS215_0081"
FT   CDS_pept        70248..70553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34235"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJF7"
FT                   /protein_id="ACP34235.1"
FT                   /translation="MSTTKKFYELQDLILAKMSLEKVKLHIEERKDRTIFKWVRKELTG
FT                   FFRKFSNVERFRDLVNSINKGLEEENYELILENVKRSLAIISDEIEQYYQDLQKMQ"
FT   gene            complement(70536..71417)
FT                   /locus_tag="LS215_0082"
FT   CDS_pept        complement(70536..71417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0082"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34236"
FT                   /db_xref="GOA:C3MJF8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJF8"
FT                   /protein_id="ACP34236.1"
FT                   /translation="MFQDPSFQITVTPLQYVLSIISGILVGFSLGLIGGGGSILAIPLL
FT                   LYFVGLANGIAPGTPEYSYITHLTLGTTALAVGINAYINSYMHFKRGNVRVSEGIVFTI
FT                   PGIIGDIIGAYLSHLMSGALILFLFGFLMIAVAIRMWKSKCNPNKSILSNNSHKLTLRE
FT                   RIKIDKVLPAGFLVGFASGYFGIGGGFLVVPGLLFSTGLDMLRAVGTSLIAVGTFGVAA
FT                   AITYAVYGYVDIVISLLYLVGGVAGGYAGSAIASRMPRQTLRKLFAIIIILVAIYTMYV
FT                   NRVGVVDLLHFL"
FT   sig_peptide     complement(71316..71417)
FT                   /locus_tag="LS215_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.446 at
FT                   residue 34"
FT   gene            complement(71621..72019)
FT                   /locus_tag="LS215_0083"
FT   CDS_pept        complement(71621..72019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0083"
FT                   /product="iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34237"
FT                   /db_xref="GOA:C3MJF9"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJF9"
FT                   /protein_id="ACP34237.1"
FT                   /translation="MSNLSRREFSYLLTIKRYNDGGEGAKINRIAKDLKIAPSSVFEEV
FT                   SHLEEKGLVEKKEDGVWITNNGTRSINYLIKAHRVIEILLVNIGIDKQTACEYSKQFDY
FT                   LVPGEIIDKLYNYLGRPSYCPHGLEIPL"
FT   gene            72075..72944
FT                   /locus_tag="LS215_0084"
FT   CDS_pept        72075..72944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0084"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34238"
FT                   /db_xref="GOA:C3MJG0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJG0"
FT                   /protein_id="ACP34238.1"
FT                   /translation="MKDNISALITPFDDKENINVEALQQLLDFLTRSGIKDFWVLGTSG
FT                   EFNMLSQDERILIVSKIREITKGKIYAGINENSLKNSLILAKKYYDIGVDYIFSVPPIY
FT                   HKPSEKGLVTYFNELRNTIDLPLFLYNIPSFAGYNVPLRIVEKLAEEEVLNGMKYSTTD
FT                   FVSFLKYLKGLKGVNKNFKVFIGEDRMILSALIYDADGAVSGISNLVPELVTNLFLEFD
FT                   RGNIQKAIEIQRMVNKLVDVVSLGDYPSGIKIGLRYRGINVGSVRKPLMEDSRAEGEIY
FT                   NALKEIGI"
FT   gene            73006..73656
FT                   /locus_tag="LS215_0085"
FT   CDS_pept        73006..73656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0085"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34239"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJG1"
FT                   /protein_id="ACP34239.1"
FT                   /translation="MDTLDLIAEEVRKCQKCRLWKYRKNAVPGEGNNKAEIMFIGEAPG
FT                   ENEDIEGKPFVGAAGKLLTRLINEVLGLSRDDVFITNLVKCRPPNNRDPEEDEIIACSP
FT                   YLHRQIELIRPRIIITLGRHSTSYLFQIMNIKMESIGKVRGKFYTWNEYGYKILVFPTY
FT                   HPAAALYNPPIRKILEEDFRKVKEALSSKPITLDNFLYGSGNKGEKGNSDSSK"
FT   gene            73607..74392
FT                   /locus_tag="LS215_0086"
FT   CDS_pept        73607..74392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0086"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34240"
FT                   /db_xref="GOA:C3MJG2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJG2"
FT                   /protein_id="ACP34240.1"
FT                   /translation="MDLGIKGKKVIVTAASKGIGLAIAKRFLEEGAKVIISSHEESNLI
FT                   KAYNKLREIYGDNVSYIKADLTNPQEVKYLVHEGYRKLGGLEVLAYVTGSPKPGNLFSL
FT                   TDRDWIDAFNLLLLSAVIAVREAGQLMQSGGRIILSTSTTLRQPIDNLDLSNVVRLSLA
FT                   GLIKVASRELGPKGILVNGIMPGWTKTERLLQIVRDRAMRDSKSEEEVLKAIVADVPLG
FT                   RAGEPEEIANVVIFLASNLATYVNGTLIPVDGGSIKGVF"
FT   gene            74503..75990
FT                   /locus_tag="LS215_0087"
FT   CDS_pept        74503..75990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34241"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJG3"
FT                   /protein_id="ACP34241.1"
FT                   /translation="MRITEFYVSNFRSLSEVNLKDLGGFNVVVGYNGYGKTNLLSSIFL
FT                   FIKNLSAGIEKRSVEDRNQEFILLWQGYDVSKPIMIGGKVEFSPEEANKIVGKNQKITL
FT                   EIVNKMRYNNKFVEWNLDTLYINGSPPGEDDLKVAKKLAEYASQAIEYVPIFDQAYFDE
FT                   TLRRMTDMNKSPINLRKYWYDFVNLVAATIPEVKGMEFWDGRRLVLNVYNLPIYIDLAA
FT                   SGFQRVILMLFIIWLSGNKILLIEEPEVNMHPTLQAKIMKLIKNWTDNNILQSFLTTHS
FT                   PYIVEMSADSYVVMRRVNGNSTAITVKPTADLRGTISLLNASLSSILFSRIIILTSELA
FT                   EPSVIVNWLKRLNINVEDNGISVYKVSSDLELQHWLKLKNMLNLDVIFLGLCDKLDMTL
FT                   KDYCVPLSREVENFYSKQALLEVLRRLGIYPDEKEIRDLGKEENLRWIINVLRKRGIEY
FT                   EKLRMSIGELITNADTIEIPKEIEILANKIKSLQATL"
FT   gene            75994..76239
FT                   /locus_tag="LS215_0088"
FT   CDS_pept        75994..76239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0088"
FT                   /product="Protein of unknown function DUF131"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34242"
FT                   /db_xref="GOA:C3MJG4"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJG4"
FT                   /protein_id="ACP34242.1"
FT                   /translation="MDLSILFDIGILLIFIGIILLFVGMIREASNSSDRNQKTHVGGVI
FT                   FIGPIPIVFGSSKGIAKWMLIVAVILVILMVIFYIL"
FT   gene            complement(76260..77543)
FT                   /locus_tag="LS215_0089"
FT   CDS_pept        complement(76260..77543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34243"
FT                   /db_xref="GOA:C3MJG5"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJG5"
FT                   /protein_id="ACP34243.1"
FT                   /translation="MRSTTVAILALITMWGILGSLVISQANTTIINSITIPTSMTYTVK
FT                   LINSTTVANKTITHVYNYTLTYQVTKFVQNVIYVNISGNFTNGSLKLGNDVYIKKGEYE
FT                   VNLLYQPLSIYYPFIEPSLIYNTSYGIITPNETMALVYKGKTFSITNGVNYTSYNYSVN
FT                   INNQQISVNILGNGIVSKLENRSLELILHSFSNLSTIPLNSIVNSQYTSFLNRSYLYAV
FT                   YNYSALSNSLIPEGYLQISYPIVLGNDTITAQITQIQMRAGQQLALPASLLGDSVNFVL
FT                   YINQPQNIPTSFTLNVGAKNITWNNNVFTLVGESKVSTPIGNFIAYQYVRNISQNQVQQ
FT                   VLYFTPNGTLIKEEVVEMINSTTQIPSFSLSFVGNNYISPYETYPNVFNYTNTSLPFKV
FT                   INPNLSFTISIVITIIIVAVLVILRKKD"
FT   gene            77483..78016
FT                   /locus_tag="LS215_0090"
FT   CDS_pept        77483..78016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0090"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34244"
FT                   /db_xref="GOA:C3MJG6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJG6"
FT                   /protein_id="ACP34244.1"
FT                   /translation="MTLKFPTWLLRPRLQLLLISYTIHHKLLNINFYRYFMDRPLVAVG
FT                   CLIVEENKVLLVKRKNPPNAGLWAIPGGKVEYGETLEDALKREMREETGLEVAVSNIIS
FT                   IVQVINEGYHYVILDFECKPIGGKLRASSDASEVEYIPFNKLKDIPTTKTTYDMLIMYF
FT                   KGEKPPYSIIQISK"
FT   gene            complement(77997..79409)
FT                   /locus_tag="LS215_0091"
FT   CDS_pept        complement(77997..79409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0091"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34245"
FT                   /db_xref="GOA:C3MJG7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJG7"
FT                   /protein_id="ACP34245.1"
FT                   /translation="MDFRIRIYNSLGRKLEEFNTINPNLVKMYVCGPTVYDYVHIGHGR
FT                   TFVVFDAISRYLRLKGYTVIRVQNITDIDDKIIKKSQDTGKDWNEIVNYYTKDYLDMLS
FT                   QLKVKIDIHPRVTHHIKEIINFVQKLIDKGHAYVAPSGSVYFDVDTYPDYGELSNTKKE
FT                   EWNQGEEFVKEKKHSYDFALWKAWKPGEPYWESPWGKGRPGWHIECSTMSTRYLGERFD
FT                   IHGGGADLVFPHHENERAQTEALTGEKWVSYWVHSAFVTIRKEKMSKSLGNIIPLNEAI
FT                   KKWGPSVLRYWYLTSHYRSPIDFSEEALEQAKSALQRIKDSMAIIRNIISEGPKFYAKD
FT                   DDIKVYREILNNLDSFHTAMSNDFDTSTALSYIHEIVRLVFSTLQYSRDFLGAMLAFEA
FT                   LSQFNEVFGVMDEEFYPTYDKMYKVIDAVVDIRNQLRQMKFYEISDKIREELLKAGVRI
FT                   LDSKDKSTWRFE"
FT   gene            complement(79424..80314)
FT                   /locus_tag="LS215_0092"
FT   CDS_pept        complement(79424..80314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0092"
FT                   /product="bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34246"
FT                   /db_xref="GOA:C3MJG8"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJG8"
FT                   /protein_id="ACP34246.1"
FT                   /translation="MDEIYLNWDRMFDEAYRIPIHEIKNDNIVFSGIGGSGIVGEIANI
FT                   LGVELSFKRKFTGKESLVAVSYSGTTSETIVDVENAVKAGSEVIIITSGGILEKFAKEK
FT                   SLKLINVPSGFQTRYAFPYLFTPLIKMTTKKRGIKINETELKEGVVEAKEKIKADAARL
FT                   AELLINRIPVIYSSKYLAIAKRFKQEINENAKHPAFYGEIPEINHNEIESYVHGPSLVS
FT                   VIVESSEIDKITEDVLNSIVIKPYFSNDLKNISSLLALAGVTSLEMAKKINEKPDKLYN
FT                   IPKARQLTSKLFRIN"
FT   gene            complement(80307..80744)
FT                   /locus_tag="LS215_0093"
FT   CDS_pept        complement(80307..80744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34247"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJG9"
FT                   /protein_id="ACP34247.1"
FT                   /translation="MKAVERLDNTMVELNKINESELGINELDLLRFLKNQLSKSKSLFE
FT                   SFSKSIDEKRWDDVLSYTFQISQRVNSIFGYLVQPAVFSMISRSKLSENIENIIDSLAF
FT                   SVSEMIIVLKQNNKSLGIDTITVNMSSNPPSMSISVVIKGG"
FT   gene            80797..82122
FT                   /locus_tag="LS215_0094"
FT   CDS_pept        80797..82122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0094"
FT                   /product="CoA-disulfide reductase"
FT                   /EC_number="1.8.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34248"
FT                   /db_xref="GOA:C3MJH0"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017758"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJH0"
FT                   /protein_id="ACP34248.1"
FT                   /translation="MERLIIIGGGAAGMTASSWARRLKPNIDITVFESTKMVSHAPCGI
FT                   PYFTEGLFDDENLFMTYTPEYFVEKRKINVKINSKVEEVDLRSRTITVRENQENKKYEF
FT                   DYLLLSTGAKPKKLNAEGDRIFYVHHPADASYIRQKLWSFDRIAIIGGGILGIEMAEAL
FT                   RARGKKLVLIHRGKYLLNKMLDEDMGKIITDKVGSEIELKLNESLISVTERGRLIVTDK
FT                   GKYEVDATVVGIGVEPNVDLVKDQLKIGETGAIWADNHMRTSFENVYAAGDSTESINII
FT                   TKKPDWVPFAPVANKMGFVAGNNIGGKDVTFPGVIGTMITKFEEYVIAKTGITENEAKR
FT                   HNIKTVSATVHHKTRARYYPGSKDIIVKLIAEANTMRIIGAQIIGEEEVLGRLNMMAAV
FT                   IQKGFTAEELFFVETGYVPPVNRVWDAITLAARKLYTGISGE"
FT   gene            82197..83315
FT                   /locus_tag="LS215_0095"
FT   CDS_pept        82197..83315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34249"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJH1"
FT                   /protein_id="ACP34249.1"
FT                   /translation="MAKKLELPVLLKDIISNYIVNYLTSSSSMTPGAENLVGENDNSGI
FT                   LVSPLNEFIKVVSAESNQSLIYSLDGSSRSFISSKGIISVASVVVSSTISPIFGVYPPI
FT                   SGFPELDLRKPFLALASSAHQSPLLPFFYSSEYVTTLSLDGSFFTSVNSPEEIETEIRT
FT                   ILETEALKKIPNDGSVILDGPLIPPLIFLRSKVRDDVLNLRLEAIRGRNVIGIVKRLDK
FT                   SRLLISSLYKLSSKFMEKFRIDPRRYFSDESFILDLIKANLSPPYSPISLGPILRNIGN
FT                   TPVYVNYLIYPLHPYVYKFAILRVESLSNDSRVIDQLSSLKFTKDGIPFVLAIADRTAK
FT                   EITNAILKIVMTSLESMGLQASFYSKLEQVRI"
FT   gene            83312..85141
FT                   /locus_tag="LS215_0096"
FT   CDS_pept        83312..85141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0096"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34250"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJH2"
FT                   /protein_id="ACP34250.1"
FT                   /translation="MSSDVPLYNDIKDKISKARALAITLGDFIGKVSRYVPSRVDEENN
FT                   VVNVTIDPNTYYKYPFLGKIGIFLGAIDIKTLYFILLRVIGYERNDASSLFIGDSNVLN
FT                   NIGLSDDEPGSLITNVTLKCEMLTKVDFLSSSEPDAADIILEPQSPVIIPKPEVIERSL
FT                   GTTRGLLRLGFLDVAYSKVRVSASLDDLNFHMLILGTTGAGKTSFIKDLIAGLNVANEE
FT                   GSKIFILDATGDYYHIFLPPDRSDKVVMRGVEEFNQLYSAIVKGINLDIIYPVSKSWVK
FT                   KYLGGAKSAGSIAKVYFDMFVKPILNHLNNKGISIYASIINNKIIISNAEWSSQVTIYP
FT                   FYFRFKDVKTILHRLNPYFTEQASHFIKIMIRKKGKDIGKLEDLIDLFNENSLEGVEIH
FT                   RSTRENIVRGLYLLKETQLFDVGVERFPLSKILKESSSSTLVFDLYNSELDDFSQKILT
FT                   YYFLDRLFEFRERQMRSGNVKGRNVIIIDEAHRFFPSSKGGEEDTNYIRRVAGKIATMM
FT                   RLGRRRKIGFVFATHNPNDLSDIIIQLANTKIIFRIKSEVAETLGLSKTEAKILNWERN
FT                   GVAYLLTPWLREGKIKIKTPVPPPLGHYDLSKT"
FT   gene            85166..85555
FT                   /locus_tag="LS215_0097"
FT   CDS_pept        85166..85555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34251"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJH3"
FT                   /protein_id="ACP34251.1"
FT                   /translation="MESNLENVINTLKRKKDKEVVIEFLKTVRKYLPPSDDFSITLWKS
FT                   GIYEYILDRNGVAIMRIAEDEYLPYMSAYEKRMDYSQLPDNLVNNLDWKGVLRQLRDIA
FT                   LEYAKRDKNFDKIADMVNHVILENL"
FT   gene            85533..86489
FT                   /locus_tag="LS215_0098"
FT   CDS_pept        85533..86489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0098"
FT                   /product="thioesterase superfamily protein"
FT                   /EC_number="3.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34252"
FT                   /db_xref="GOA:C3MJH4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJH4"
FT                   /protein_id="ACP34252.1"
FT                   /translation="MSYLKISDTTIETFRFIHYEQSNFLNRLHGGDMLFFLVEAGMLSA
FT                   TKVAMGTTVLASLDDVIFKKPVKLGDIVKVRAETVYVGNTSLEVEVSAFDRDEEVVSAY
FT                   ATYVKVDDLLRPAPVNVKIIAESEDDKRKMDEAKRRRENRLSKILNRQKMRFYVDDITD
FT                   GLRYRISNVVHVSPELTYDGRIMSAGKLLKLMDDLGGIICLNYINYNSKNIYDNVFNAV
FT                   VTVAVKGLAFYSPIRLNDIVTIRAGLIYVGNTSADILINVIREDVNGTKEHVATAYFTY
FT                   VRVDKEGKPIKMPEYVPVTEREKRLHEEALTRRGLRK"
FT   gene            complement(86450..87538)
FT                   /locus_tag="LS215_0099"
FT   CDS_pept        complement(86450..87538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34253"
FT                   /db_xref="GOA:C3MJH5"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJH5"
FT                   /protein_id="ACP34253.1"
FT                   /translation="MGQYFIITSFTMIGLLFPVEFYSETKSLILLGVITGIYNALNALG
FT                   SYIWGYLIDKTRLRKEYAVILSLFGVVIGLIYHYDKLIAYELSGFVSALDGPIYSAILL
FT                   ETTPQEKLVLGNTRLSQISLAGNVTGSLLSAFYHNDYLILIFFSVSLIFNVIHIPKYDG
FT                   GINYDVADRNKLLRILLIPIISYFWFNMAAEIFYTLFVPLNYLMLNPSYVIFLSYTFLY
FT                   LIEEVIYSKGISVVKGREEYFMLLVTFARSLIVLSLVYIILMGLKIYEGTMLLFLVFGP
FT                   LFPVYNISFFSLLIKGLKRNKATIIGIFNVSEDIANVVGGFLSGSTNNIVSGYQISFYS
FT                   FALSLFLLYIYLRKPLRVSASS"
FT   gene            87592..88371
FT                   /locus_tag="LS215_0100"
FT   CDS_pept        87592..88371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0100"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34254"
FT                   /db_xref="GOA:C3MJH6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJH6"
FT                   /protein_id="ACP34254.1"
FT                   /translation="MVVSYHMRFKDKVILITGGTRGIGRAITEAFLREEGLPIVLYNSA
FT                   ENEAKKLREKGVFTIKCDVGNRDEVKKSKEVVEKEFGRVDVIVNNAGIMVLMPFEEFDD
FT                   EKYNKMIKINLNGAIYTTYEFLPLLKLSKNGAIVNIASNAGIGTAAEGTTFYAITKAGI
FT                   IILTRRLAFELGKYGIRVNAVAPGWVETDMTLSGKNQEDAEKLRELFRNKTVLKTTGKP
FT                   EDIANIVLFLSSDEARYITGQVIVADGGRIDNLTHSL"
FT   gene            88382..89125
FT                   /locus_tag="LS215_0101"
FT   CDS_pept        88382..89125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0101"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34255"
FT                   /db_xref="GOA:C3MJH7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJH7"
FT                   /protein_id="ACP34255.1"
FT                   /translation="MKIVSWNVNGIRAALKKNLIDFIENNMFEVIMFQETKGDIVPLDF
FT                   IMMGYEVISFPAKRKGYSGVMTLTKIKPINVIKGLQIKEFDDEGRTVTLELKDFYVINA
FT                   YFPRAGDNLERLDFKLKFNNEIENFVLKLRKAKPVILCGDFNIAHQNIDGAFSDPTIPG
FT                   LTPQERSWFSHFLSLGFIDTFRYLHPNVRKYSWWSYMGKAREKNLGLRLDYCIVSEELK
FT                   DRIKMADILIDIQGSDHAPIILELT"
FT   gene            complement(89134..90786)
FT                   /locus_tag="LS215_0102"
FT   CDS_pept        complement(89134..90786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0102"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34256"
FT                   /db_xref="GOA:C3MJH8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJH8"
FT                   /protein_id="ACP34256.1"
FT                   /translation="MRRGVKSNEVRFVLAKNDILVSTIIPLLGYIMYGIALGSLPSIGY
FT                   STLAGILYTFTLYSPFIFFPSLLPLSAISYFLASIFLYKAYKYKTLRKYGIIAISLSVS
FT                   YIVLYVYNLFFVELIPKFLMSWVLIGFYEIGNTIQLLAWRVSLRTVLIKVYGLPNNLKW
FT                   KINIEGQKYTFSDSQAKVKVNKEKPSFYVDSILEGYNTYMPKPNSGIISSNLLEIYFTK
FT                   ISKIPDISNWDPKLWIGNKINEYEVIDIIAIGGSSYVLKVKRGNMLYAMKIPKISKSTP
FT                   GQTRISASNIIFDLSREFINLQEIGYKTQNAVQLFAISEIDISNIMKIEKGESYFYLTR
FT                   PPYIIIELMEGGNALQLLNISRSKDWYRIVGILIRDVAKALDIIHSSGYVHLDVKPQNI
FT                   YFSKFPGSKEKEILSNLTSGKVVVKLGDLGSASRIGESVAEFTEFYCPIDQIEAAMLKN
FT                   KGALPSMDVFALGATAYKLLFDSYVYPKEYYELIEKAIEEFQMGRGNYLNNLKLARQYA
FT                   ILPKINNMPSWLVNLLYDMLLQRTNARTIYILL"
FT   gene            91023..92560
FT                   /pseudo
FT                   /locus_tag="LS215_0103"
FT   gene            complement(92531..92920)
FT                   /locus_tag="LS215_0104"
FT   CDS_pept        complement(92531..92920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0104"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34257"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJH9"
FT                   /protein_id="ACP34257.1"
FT                   /translation="MNLEPLFQRANELLRASKFNFNSGFYEIAAIAAEESLYLMLNATL
FT                   IKLGADIPWYLDFDVLFRVVSRYSHDDRLSEIRIKERDIIRLLDDIKIRLGYSIPLELN
FT                   EKDIEKLIAFSEKMFDLLWRNFLKS"
FT   gene            complement(92968..93372)
FT                   /locus_tag="LS215_0105"
FT   CDS_pept        complement(92968..93372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0105"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34258"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJI0"
FT                   /protein_id="ACP34258.1"
FT                   /translation="MENIEYVFEDVVRIYDTDAQGIAHYAAYYRFFTNTIEKFIKEKVG
FT                   IPYPIVNDDLWFVIAESHAIYRKPVKLGDRLTILLNPKILSNKTIKFDFRILRDGELTT
FT                   EGYLIQIAINPKIWKSTEMPKEIMDKLSIK"
FT   gene            complement(93422..94105)
FT                   /locus_tag="LS215_0106"
FT   CDS_pept        complement(93422..94105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0106"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34259"
FT                   /db_xref="GOA:C3MJI1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJI1"
FT                   /protein_id="ACP34259.1"
FT                   /translation="MRVSEIPVYIVGVGPGDPEYLTLKGYKAIKDSSIVAGWKSVLERF
FT                   WPILEGKRTVVLTYKIESETLEEIIEIGKTENVAILDHGDPSVSDWQFVEKIRNIATSK
FT                   GVKVNIISGVSSLNIALSRLGLDINFIGFVTLHVRGDISKSLNDLLNILKMGRVAVVIP
FT                   EPYKDGPQKVAKFLYDNNLNCRIVVFEKLSYDDERRRDYDNLISLLNENNEFGDLTIMA
FT                   IFPKS"
FT   gene            complement(94092..95081)
FT                   /locus_tag="LS215_0107"
FT   CDS_pept        complement(94092..95081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0107"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34260"
FT                   /db_xref="GOA:C3MJI2"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJI2"
FT                   /protein_id="ACP34260.1"
FT                   /translation="MIENLWRGIAIISASEDGFKAGEIVKEKLKRFEIPVVHFKYKDAD
FT                   IETVWRCYDAIIFVMALEGATRIICKYAKSKTKDPAIICIDDKINYVIPLLGGHWGAND
FT                   IARDLSVILNSTPIITTAAELKGKLSVEKIANILVAKILNPENIVKINAVLLRDEYVCV
FT                   DGVDINVTFPENIRINSEECNYIVSLRNDKEYKDKIVVWLKPLKISIGVGSKKDVKIDE
FT                   IRDGIYKVLERLNLKRERIGIIASIREEVKKIADEINVKFRLVNEEEINNFTNPCLTPP
FT                   SKTLIEVGLKGVAEISALIAGGINSKLILRKIAISRNSTIAVATYEGE"
FT   gene            complement(95084..95872)
FT                   /locus_tag="LS215_0108"
FT   CDS_pept        complement(95084..95872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0108"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34261"
FT                   /db_xref="GOA:C3MJI3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJI3"
FT                   /protein_id="ACP34261.1"
FT                   /translation="MVGKVVFIGSGPGDPELITVKAKKYIETADVIVYAGSLVNPEILK
FT                   WSRKDAEVYNSSSLTLNEIVEIMVKKASEGKLVVRLKSGDSSIYGALFEEMWALEAAGI
FT                   PFEVVPGITAAIAAASVIPIELTVPKLSQTVIITRASLRVPMQGSIKDFAKMVKIGATM
FT                   VIYTGIHIIDRVVNELKEGGLTDDTPVIVVYRATWPEQRIIKGNLADIVSKVREAKIYR
FT                   DSVIIVGLASDPQQIKNMVRSSVYDPKHNHSYRPWKVEED"
FT   gene            complement(95878..96546)
FT                   /locus_tag="LS215_0109"
FT   CDS_pept        complement(95878..96546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0109"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /EC_number="2.1.1.151"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34262"
FT                   /db_xref="GOA:C3MJI4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJI4"
FT                   /protein_id="ACP34262.1"
FT                   /translation="MKLYVVGLGPGDEELITIRGAKILKEVRTIFIPYSTGTNRSLAEN
FT                   IVKKYAKSNSKLVLLGFPMAKDVNENELKKIGEKICNESEGDSAFVTLGDPTLYSTFFR
FT                   IKDKLPCNVNVEIIPGVSSVTACASKAMISLANSEDSISIIPASRLDSIEKASEIFETI
FT                   IVLKANENIKEIAQMLSNKYDLLYARRCFMNDEKLVNMEKEIVNDKDYFSMIIALRKKR
FT                   "
FT   gene            complement(96543..97142)
FT                   /locus_tag="LS215_0110"
FT   CDS_pept        complement(96543..97142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0110"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /EC_number="2.1.1.132"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34263"
FT                   /db_xref="GOA:C3MJI5"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR023475"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MJI5"
FT                   /protein_id="ACP34263.1"
FT                   /translation="MEWKYVIPGIPDNFFERDEEIPMTKEEIRALALSKLRIRKGDMIL
FT                   DIGCGTGSVTVEASLLVGSTGKVYGVDKEEKAINLTRRNAEKFGVLNNIVLIKGEAPEI
FT                   LFTINEKFDRIFIGGGSEKIKEIISASWEIIKKGGRVVIDAILLETVNNAISAMENIGF
FT                   MNLEITEVIIAKGMKTKVGTAMMTRNPIFIISGEKQ"
FT   gene            complement(97143..98192)
FT                   /locus_tag="LS215_0111"
FT   CDS_pept        complement(97143..98192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0111"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34264"
FT                   /db_xref="GOA:C3MJI6"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MJI6"
FT                   /protein_id="ACP34264.1"
FT                   /translation="MIINSLKRFGITTGAAASAAAKAAVIGLLNREKRNTVVIPTPIGL
FT                   RLEIPVEKVEIDSGIACAEVKKFSGDNPDILDGLVIRCCAKLNESNEIVIVGGKGVGKV
FT                   TRSGLKATMGETAISPTVRDMVINAIREVTDKGIQITIEVPNGDIIAENTLNKMVGIVG
FT                   GISILGTTGIETPVSDDDYLEHIKCELNVIRQSYDFVVIAPGNSAAKYASKLFDSNSII
FT                   KVGDRIGDSIKLASSVFRKVILAGLPAKLLKVYAGIFNTHYSQGDARLESLTHASVLAG
FT                   LPYDVLTKITNALSVEEAFTYMTKEQRRKVMKIVAEKILSRIKSFNGDINFCVIIFDYD
FT                   SESLSRVGC"
FT   gene            complement(98189..98935)
FT                   /locus_tag="LS215_0112"
FT   CDS_pept        complement(98189..98935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0112"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34265"
FT                   /db_xref="GOA:C3MJI7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJI7"
FT                   /protein_id="ACP34265.1"
FT                   /translation="MGKLYVVGIGPGSKEQRTIKAQEVLEKSNVIIGYNTYLRLISDVL
FT                   DGKKEVIGARMKEEIFRANTAIEKALESDNIVALVSSGDPQVYGMAGLVFDLISRRKLD
FT                   LDVEVIPGVTAALAAAARLGSPLSLDFVVISLSDLLIPREEILHKVTKAAEADFVIVFY
FT                   NLINENLLIEVMDIVSKHRKPNTPVGLVKSAYRNNENIVITTLSSWKEHMNEIGMTTTM
FT                   IIGNSLTYSYKNYMITPRGYERKYEL"
FT   gene            complement(98938..99936)
FT                   /locus_tag="LS215_0113"
FT   CDS_pept        complement(98938..99936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0113"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /EC_number="5.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34266"
FT                   /db_xref="GOA:C3MJI8"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJI8"
FT                   /protein_id="ACP34266.1"
FT                   /translation="MDRQSNTAIMLIGHGSRRETYNSDIEGMINYLKEKISIPIYLTYN
FT                   EFAKPDWRSLLNEIIKEGYRRVIIGLVFLGRGNHVFRDIMGELGIQRLNSWEVSKISGK
FT                   EVEFYVTEPLSSSPLIGLALYYRLARALDALPTLEYTEDPYEIEERSMNYILPNLDVKD
FT                   AREKRVIGKAVFASGNPEVAKYLKVTNLDMGIEAIRSESEIVADVKMVSVGIRWKKVTC
FT                   MIDDERTKELSKELGITRAAAAMRLSIGQGGKVVVIGNAPTALIETIKLVKQGVDIPFI
FT                   VATPPGFTNAKESKEALIESKIPSVVLTGTYGGSGIAVAIINEIIKMAMEG"
FT   gene            complement(100854..101888)
FT                   /locus_tag="LS215_0114"
FT   CDS_pept        complement(100854..101888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0114"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34267"
FT                   /db_xref="GOA:C3MJI9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022563"
FT                   /db_xref="InterPro:IPR023863"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJI9"
FT                   /protein_id="ACP34267.1"
FT                   /translation="MSTLKPMIVGNVKRALLGVGVRKLPLIAGHKLLYTCNLRCRMCPF
FT                   WRRKDEKLLSLEEEVLMLKSLERAGVLFMGFEGGEPLLRRDLEQILEESYKRFYTSLVT
FT                   NGWLLKDRVKSISENLDYLFVSIDGIDEVHDKIRGISGAFERAVEGIKEARKYLPVAIS
FT                   FTITRENMDQVKDVIELARKLNVNISIQVEYDYSTAEKLSPDKRRLYDTLRLIIELKKR
FT                   GYPIVESVDYFEAIVNSWYNKMPWKCKPWLTINIDPQGRIVLPCYVLNEYSGTDKAWEV
FT                   NIVKLWNTYPWEKYENCNACALACYLEPSLFSWSNGKMVKEKIIDNMASYLYNAIPVKF
FT                   LLSR"
FT   gene            101882..102781
FT                   /locus_tag="LS215_0115"
FT   CDS_pept        101882..102781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0115"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34268"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJJ0"
FT                   /protein_id="ACP34268.1"
FT                   /translation="MTYLINIQTHVLIFCEKLNITDFVSQVMPTVKLTKNITVMTGSPN
FT                   TLIYDNRVVIDLGGKNSSLDLNAEVQLATHGHADHIAGLLKKDAKIRYLPKEDYWSLTL
FT                   MGRRAMIYGCSSKDSEIFIFDYVKENLDSLNNEIRNSEIEVVKLPGHTPGHSGYIVHNV
FT                   LYAGDAFFGEKVLESFSVPFYTDFWTALESLDKVKELAKSVDNIVISHGPVYTNKNKMV
FT                   SILESNITYAQKLIGKILDLLSNSEFTVEEIVVKLKQDLTPANVLLNSVVVRSILLGLE
FT                   NIEYNITQKGLVFRRKVH"
FT   gene            complement(103077..104498)
FT                   /locus_tag="LS215_0116"
FT   CDS_pept        complement(103077..104498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0116"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34269"
FT                   /db_xref="GOA:C3MJJ1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJJ1"
FT                   /protein_id="ACP34269.1"
FT                   /translation="MPRIFSIKNEVDSKYIFMLAFMLALFSSGVPPEIVILHLSREDTF
FT                   EPYTKVFKKIRNLVSGYRYKFSSAITYSIKNLNIRYLKEFLIRLSQAVTFGDDMIESLS
FT                   REIDFTLSEYNAYSARLIESMNNFLTIYATLNSSLTFLVADITILSLIYSGGTTLITQL
FT                   TILSLALLGNLTLVMYLLYRPENYIRYNVIDKLLLTLAISLSIIFSIIYTSYIVLMVTG
FT                   IVLLGVGLRYRIYENKINRIERHFLLFIRYFSRNYAIVSNLKESLMAVLRGDLGDVKPL
FT                   IKRSLNRLNFGINKEKIFRSIGDESGSVLVSMLSKVLYETISMGGNVMIIGEILSKIGD
FT                   SVLNIRSRKEQNGRAFETSIYALQTASAGVSAALISIVGMLNNIFSTQNVSTVFSFSEV
FT                   NIDMISRIFLIILLILSFTNGIAITLAYGKSLYVSLYFIGILIILSSISYHIVLILTGN
FT                   IFKELVSPSGLLQTT"
FT   gene            complement(104482..106023)
FT                   /locus_tag="LS215_0117"
FT   CDS_pept        complement(104482..106023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0117"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34270"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJJ2"
FT                   /protein_id="ACP34270.1"
FT                   /translation="MSFIEDYLSRFTEKPVIIDDPNKLKGSKNYNAIYKVDKYIYIHVQ
FT                   STKAEDGYNQYTVIEPPRPKPKEIEEIEEKFAKAISNVEPPIAVEEKEILMRKALDKIL
FT                   SKIRISVPKEYAIYHFIRDKLYLSILEPLIRDPFIEDISIPGLGHIYIVHKVFGPMRTS
FT                   LLIENEEELDNLIISLSEKTYRPVSHNRPIIDASLPDGSRVNFVYGIDISRRGSNLTVR
FT                   KFSKIPISVTQLISFGTLSPLLAAYIWMMLDEGMNLFVCGETASGKTTTLNAITAFIPP
FT                   NLKIVTIEDTPELTVPHSNWVAEVTRETGGEGSVKLFDLLKAALRQRPNYILVGEIRDR
FT                   EGNVAFQAMQTGHSVMATFHAANIRTLVQRLTGYPIEVPKSYINNLNIALFQTALYDKK
FT                   GNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDPAEDKIIFAGRGASYLVENKVAIKRGI
FT                   ERKNIGILYDELNLRAEFLKILISKKIFNYFDVWNQILRTRQFGIEEEIRYAKNI"
FT   gene            complement(106026..106730)
FT                   /locus_tag="LS215_0118"
FT   CDS_pept        complement(106026..106730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0118"
FT                   /product="flagellar accessory protein FlaH"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34271"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJJ3"
FT                   /protein_id="ACP34271.1"
FT                   /translation="MEGCTVIIKTGNEDLDRRLSGIPFPALIMIEGDHGTGKSVLSAQF
FT                   CYGLLIGGKKGYVITTEQTSKDYLKKMKDVKINLIPFFLKGVLGIAPLNTNRFNWNSTL
FT                   ANKILEVIIDFIKKRKNMDFVIIDSLSIVATFAEIKQILQFMKDARVLVDLGKLILFTV
FT                   HPDVFNEELKSRITSIVDVYFKLSATSIGGRRIKVLERIKTIGGIQGADAISFDIDPAL
FT                   GVKVVPLSLSRA"
FT   gene            complement(106712..107200)
FT                   /locus_tag="LS215_0119"
FT   CDS_pept        complement(106712..107200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34272"
FT                   /db_xref="GOA:C3MJJ4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJJ4"
FT                   /protein_id="ACP34272.1"
FT                   /translation="MGVSQVIAYVLLFFITISLGLIALGAYIKSQQFLLHAEYMRQNMD
FT                   LNQLNTRIFIKSVAINSYLLYMTITNNGSTVLYDFKDFAIIIKYYANVSNVSTLIISNY
FT                   NYSTSLGTYKWVSNTVLINPNMVGTFIADLPYPPYPNTEATVVVVSNYGPEAIWRGVL"
FT   gene            complement(107203..107670)
FT                   /locus_tag="LS215_0120"
FT   CDS_pept        complement(107203..107670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0120"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34273"
FT                   /db_xref="GOA:C3MJJ5"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJJ5"
FT                   /protein_id="ACP34273.1"
FT                   /translation="MASEVISETIMLIVAVTLVGVVAGSVFSVVSSISTNMVSYSILQS
FT                   QKLVTDLQIDYATNASSTTVIVYLHNIGESTIFNLKNSVLYFGPQGNLQQIGYNSSSTL
FT                   PYWVVNTNTLYPGSVAKIIIYLSSPLSTTQYYTVQLVTPNGYSVSYTFEAS"
FT   gene            complement(107663..108424)
FT                   /locus_tag="LS215_0121"
FT   CDS_pept        complement(107663..108424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34274"
FT                   /db_xref="GOA:C3MJJ6"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJJ6"
FT                   /protein_id="ACP34274.1"
FT                   /translation="MINLNLLELEQLMESPLFILLISISIPLAAFFISFFKIVFPRITR
FT                   PKNTQPPQTASTTQQNQQQQQITTNSSKEIEELLKNLINRMDKYQSDLVNVLNGSMEDL
FT                   KQTLQKLNSSIEDAVLSLKSAQADSSSPFNIISEQSKGEQRPEGNKELKAVAEIVGTSN
FT                   IDLSTFIRNCVLLEILDYDDSKLTALYELGYISADDMFIVNKVQSYIRTNNGKIRAKDL
FT                   ANIAMNVAESYSSVTAEMKKYLLVLEVGKNG"
FT   gene            complement(108502..109422)
FT                   /locus_tag="LS215_0122"
FT   CDS_pept        complement(108502..109422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0122"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34275"
FT                   /db_xref="GOA:C3MJJ7"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJJ7"
FT                   /protein_id="ACP34275.1"
FT                   /translation="MNTKKMLKEYNKKVKRKGLAGLDTAIILIAFIITASVLAYVAINM
FT                   GLFVTQKAKSTINKGEETASTALTLSGSVLYAVNYPSNTRSYWIYFTVSPSSGVSSVEL
FT                   SPSTTAISFTASAEGISYSNIYEYTLLTVSPSELANQVYANGQYLDLVNQQTNAGQTYV
FT                   YYPNPYYALLALNYTLSKIDKVSPSPLYITTTTPSSATQTYPFLAHDNMFTFTLNISGT
FT                   LVTYYAFVNQTFAFTYPVAGDPLIGSAIAPAGSVIGVMILFGPDLGSHVFQYQTITIQI
FT                   TPNIGSPLTISEYVYQPEGSVSVIG"
FT   gene            109545..110030
FT                   /locus_tag="LS215_0123"
FT   CDS_pept        109545..110030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34276"
FT                   /db_xref="GOA:C3MJJ8"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJJ8"
FT                   /protein_id="ACP34276.1"
FT                   /translation="MTPVFLEYKVIHDNITYYIIYIFIYNLSLKLVTMYTINPNSHTIL
FT                   SYNVSLEPQQIFSNITGISTYYSLDGKKILAYENNNGSIIVAYNGLILKKVSNNSVRYL
FT                   IAANYPGIDNSKFPNLYKLAKISIFDTNIRVLVLGVLLTILSSFVLKIMVGRYDKVR"
FT   gene            110014..111486
FT                   /locus_tag="LS215_0124"
FT   CDS_pept        110014..111486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34277"
FT                   /db_xref="GOA:C3MJJ9"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJJ9"
FT                   /protein_id="ACP34277.1"
FT                   /translation="MIRLDKNNFIPWISIVFLLFAYSIGTGLYITIQRVTYYPIFESKI
FT                   VSVLLTIFSSSLMTLYNYKRYVFLVPLSLLSFFSVSLTPLIISIFILHELRKVDRTVSI
FT                   ILLIIDASMLSWLTLRLLLGINTYFSFPLMILEAGAPTVIPFIWFAGVVFSAYKRDYLS
FT                   SKSQLFINPLIPFIVALLISLVPYFPFINPYKFPETVDFKYYYSWLLSPTLSGWFFYSR
FT                   PLYLMLLYALSFIFKPYTVAYYEFAFLSILYVYSAYKLASALDKSIASLAALLAAVSPM
FT                   LITFLYSGLEANLFSISLMFISMSYFLKKEKLSLAILFSLLSMFSHIYAWAQLSASIAL
FT                   YYLLKSIRLKSRPDNYTLTYLSFSIPFIAIGFFLILSGVFPVPMGLLNYNQLTYQIAVV
FT                   SWGSNNALLYFLLSSFGNKYIKEEVLDFVYSISVFAIIFLAPATNLIIDLPLFIPAAYT
FT                   IRNIDRQNVSVFLLLSLILWGIYMSINSVPML"
FT   gene            111483..111926
FT                   /locus_tag="LS215_0125"
FT   CDS_pept        111483..111926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34278"
FT                   /db_xref="GOA:C3MJK0"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJK0"
FT                   /protein_id="ACP34278.1"
FT                   /translation="MIVRFLFYLRRDLLTMRDIYQLLLVGIISLLVIITAASRLYVLLI
FT                   PIVLFSIYLITESRIPEIKDLKSFYKYVEKVYGRDFAATIRKKYNIIQGDLTLAYFPSS
FT                   IKDNTIVISNNHLILKLNSKVLVLSKYEGVDYLIDMIKDNRSS"
FT   gene            112010..112819
FT                   /locus_tag="LS215_0126"
FT   CDS_pept        112010..112819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34279"
FT                   /db_xref="GOA:C3MJK1"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJK1"
FT                   /protein_id="ACP34279.1"
FT                   /translation="MSYNVFDILRELDSIVDFARAKLQWDILFFINSKGPSSVSEIAEG
FT                   TNNSKKAVIDAIRKLIEKELIIKIKYDVYDLSDKGKQVLNKLNSFTSNTVPSQNDADHG
FT                   NSTLSNMDNPSQNFYLLELIKISLLNNDILPIDKAYRELGISKQTLKYYLELFMQKKIF
FT                   KKVNKKNFLGRNIQSAVLTNEGRKIAYRVPSLIKIRNNLFLRLLLKMTFSISYESALLK
FT                   LMVFFALSSPIIIYYDGDAPIRMIGILWLYMLVFTSLLSVFAYLTMR"
FT   gene            112833..113318
FT                   /locus_tag="LS215_0127"
FT   CDS_pept        112833..113318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34280"
FT                   /db_xref="GOA:C3MJK2"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJK2"
FT                   /protein_id="ACP34280.1"
FT                   /translation="MELANVSLLYLITGNYTHYLMLITILNVSKNFAIINMTEISHNIT
FT                   LSYVVAYPIFLLYVPNVTQQSTVTQFEGINTTILNIRNFTIYVDVYNGIVIHYIGHGIN
FT                   ATLIGATIPLGPGVYKLIPSYMLGHQRNNNVEEYETVLLTIVLVVSFYIIFERMDKK"
FT   gene            113315..113497
FT                   /locus_tag="LS215_0128"
FT   CDS_pept        113315..113497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34281"
FT                   /db_xref="GOA:C3MJK3"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJK3"
FT                   /protein_id="ACP34281.1"
FT                   /translation="MKIYNLGRALVLTGIVELILASLFYSDKRVILSVLLGDYSYFCLL
FT                   IGVIVIAVYGAITKN"
FT   gene            113723..113947
FT                   /locus_tag="LS215_0129"
FT   CDS_pept        113723..113947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0129"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34282"
FT                   /db_xref="GOA:C3MJK4"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJK4"
FT                   /protein_id="ACP34282.1"
FT                   /translation="MEKIVKVNDTTYILEDERSVVITFKLEENILSMVDEIVKKLGYDY
FT                   RSDFIRDAIEKYINYLKSSSNNSKMNINE"
FT   gene            114375..114536
FT                   /locus_tag="LS215_0130"
FT   CDS_pept        114375..114536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0130"
FT                   /product="conserved hypothetical insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34283"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJK5"
FT                   /protein_id="ACP34283.1"
FT                   /translation="MDLWGKAKDLIKGNVITKVVDEMWTYLYRNARAFYKWAFTRYVYT
FT                   SISIKFIV"
FT   gene            114777..114986
FT                   /locus_tag="LS215_2988"
FT   CDS_pept        114777..114986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2988"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2988"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34284"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJK6"
FT                   /protein_id="ACP34284.1"
FT                   /translation="MGDDYNYYFWLKNHIVVYPVNPNKPLYSSLRDRVRFKRATKAVNR
FT                   SRQMMRYSIAIVLWDRKLIPEFIP"
FT   gene            115132..115860
FT                   /locus_tag="LS215_0131"
FT   CDS_pept        115132..115860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJK7"
FT                   /protein_id="ACP34285.1"
FT                   /translation="MEAIYVLGVKGGIGKTTFSLYFAKRLSLMGKKVMYIDHDYFSFGC
FT                   LILGHNDLGLLEEIERNLPIFSRSLKNIDNLYVLKLFSNPLNINKNYPLLSNKIPQVLN
FT                   SILKREVDYIILDSSVGILPDNDIVMALLEELEIEKEGVFLSDMLSVNSTIKYAKLWEN
FT                   NIKYKVLVINMVPPIPENLSEAIKIANEVYNNYNELFNAAIVVQFDEKMYNYNPIIAEY
FT                   ENEKLNSILLSILYRYNTLK"
FT   gene            116123..116890
FT                   /locus_tag="LS215_0132"
FT   CDS_pept        116123..116890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34286"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJK8"
FT                   /protein_id="ACP34286.1"
FT                   /translation="MIRINVVGFKGGSGKSTVSYYLARQLSEYYNVVLVDKTYSGTISR
FT                   IYNINNNIFSFLKGRNELFYVSKNSFSVINMSFSSENDLNNFDFNTFKYLYGKLIKDSD
FT                   IVIVDHSSIPHDFATEIELKAFMENFKNFAYNTVLVLSGDEIPIKRYLNYTTLLNDFVK
FT                   NYAEKILGISLPRDVKFLKIVAVIINKILKGQESKLDEFIRADEILQRSARFVIPFYLS
FT                   LTQRHFKDIEPPKEMIDIVRYILDLLREPTSIL"
FT   gene            complement(116885..117880)
FT                   /locus_tag="LS215_0133"
FT   CDS_pept        complement(116885..117880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0133"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /EC_number="1.6.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34287"
FT                   /db_xref="GOA:C3MJK9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJK9"
FT                   /protein_id="ACP34287.1"
FT                   /translation="MKALVFDKSGLENLKVKEVQEPQLGPHDVLIRVVKSGLNPIDYFV
FT                   ISAIPVTPMPHIPGAEVAGIVEKVGDHVKGLAKGDKVVVYNRVFDGTCDLCLSGKEMLC
FT                   RNGGIMSVITNGGWSEYFSVPDKNVFKIPENMSWDIAASLPVAALTSYHSLKELKVSPN
FT                   DIVVIFGAGGNTGIFAVQLAKKFGATVIAVSRKNWLKDFGADYIIGYDDVVQKVKEITN
FT                   GKMADIVMNSLGSSVWEKSLEVLGLSGQLAFFGGLTGSEVKVNLSSLYGKHIKIVGTTG
FT                   GSRKELTELINICKDCKVKVHKTYRLDEGIEAVKQIMTENRDGRIMLQVS"
FT   gene            complement(117930..118388)
FT                   /locus_tag="LS215_0134"
FT   CDS_pept        complement(117930..118388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34288"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJL0"
FT                   /protein_id="ACP34288.1"
FT                   /translation="MVVNNSLGTTHISLFNIFFRFKLKTYKTNYTLLMSVIEKFVKHIE
FT                   KVYDNEEVRMLENLWMKKITNFPINLQVVEEEDGEKLHLFVLKGAEAILLHKSTSIFLY
FT                   ITNLTSVELETLRYITIKKKGEEADEDFVSLAYEYISFKNKAKIGIRQ"
FT   gene            118378..118989
FT                   /locus_tag="LS215_0135"
FT   CDS_pept        118378..118989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34289"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJL1"
FT                   /protein_id="ACP34289.1"
FT                   /translation="MTTNIVRVLSIKGGVGKSSIAYALARTISASGYKVLFLDMDNLHT
FT                   ISRVLGVKDCELTYVRDLFVFACDDFSKISFTNYEYVIIDTYSGISSETLSVIKGDLIY
FT                   NIFISDFSSIDNSLSYIKEWNGKRSINFLVVNMVIVEDNEYDILLRKFFDSLALKSNVK
FT                   INKVFLFFFDENYYGSYKVDLNHIELLASYVLGGIGESDP"
FT   gene            119265..120080
FT                   /locus_tag="LS215_0136"
FT   CDS_pept        119265..120080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34290"
FT                   /db_xref="GOA:C3MJL2"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR031857"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJL2"
FT                   /protein_id="ACP34290.1"
FT                   /translation="MRGTGFEPAQAFASGASVRPMGDTPIPPDLKNKGVITKDMEITRD
FT                   KLNEFFEWCVNKRKNSIDTCKDYISYLKRPLNKNKKWSIFAYRLYYEFLGKEDKAKELK
FT                   VEKKMSIPVYRIPSIEEIKKVLNNEDERIRILYRLLLESGIRLKEALFILNNYDPALAQ
FT                   MEDGFYVYTVNLIRKSKKSFYAFHITPLQKTYITESIIDHTDLPVKPKFIRKFVATKML
FT                   ELGIPSEVVDFFQGRTPSSILSKHYLDLLTLAKKEYKKYAEWLRSNFNF"
FT   gene            complement(120091..120918)
FT                   /locus_tag="LS215_0137"
FT   CDS_pept        complement(120091..120918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJL3"
FT                   /protein_id="ACP34291.1"
FT                   /translation="MRYLGDIIFQLSINDKTQLSNHQIYLYLYQLVYSSEITTSVDKLP
FT                   APYYPYLIVTYHLLFVQKNKKRAKQLFDKIKEEYTKTRGIRFSYDEEKMYEVLNALFER
FT                   IIVISYSLEVCEELRKVIDNIEINEYSWAYFFKQLILVQLGLNGIDSIEQKFEEYKNSL
FT                   IFPVDIEVAEHFNIISDEAGISRIIDYLDKEFQRIKKEYKNLNNEIAKLEKEIQKLEYR
FT                   YEKINNLIAWISKKGVIPIFSIISWTISKQISSKKNELSKKHEEICKWLFKDS"
FT   gene            complement(120970..121164)
FT                   /locus_tag="LS215_0138"
FT   CDS_pept        complement(120970..121164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34292"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJL4"
FT                   /protein_id="ACP34292.1"
FT                   /translation="MEKLWIIEAKDKEGDIIYMKNVKKKKIAEKLFEECKEFFDEYGIE
FT                   CEMRLGEFYSLDEAERLNL"
FT   gene            complement(121180..121890)
FT                   /locus_tag="LS215_0139"
FT   CDS_pept        complement(121180..121890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34293"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJL5"
FT                   /protein_id="ACP34293.1"
FT                   /translation="MTSKKNEMLWLAEKIVSAYNNVGFVSAVIFGKQGSGKTTYAFKVA
FT                   RDVFWKLNNLENKDDAWGYVRNAYFFELPDALNRIQDAIDNDYRIPLIIFDDAGIWLSK
FT                   YVWYEDYMKAFYKIYALIRTRVSAVIFTTPSPEDIAFYLREKGWYQIRVTMVNRKKMIA
FT                   RATLYAKDFSRNSKGEIVTEVKKKALDLFKVQIPDNIYKEYMERRRETERKLLDELRQI
FT                   LSTLNENKATIKGR"
FT   gene            complement(121871..122323)
FT                   /locus_tag="LS215_0140"
FT   CDS_pept        complement(121871..122323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34294"
FT                   /db_xref="InterPro:IPR020219"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJL6"
FT                   /protein_id="ACP34294.1"
FT                   /translation="MAKKAQTVEELKKENEELKQKLAELEAYINNNEDEKLQEIENPYT
FT                   VTNRTISELVEPKDTMFYLSGSQISLILTAFEFARLPSYFGEEPVVELAQFADKLKHYL
FT                   VSKGGRGRRDILRVLRVSSGQARENVNKSIFKQLLQGGKDSDVEEE"
FT   gene            complement(122461..122733)
FT                   /locus_tag="LS215_0141"
FT   CDS_pept        complement(122461..122733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34295"
FT                   /db_xref="InterPro:IPR035194"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJL7"
FT                   /protein_id="ACP34295.1"
FT                   /translation="MVVEEVKRILQKNGLKVEKVVILPSDDVNTKYIKKYEGFVRLTEI
FT                   YTGVAVVEGIQIPFIAQYLEGKVHVYLYPEKDFYLSHLVGELNGL"
FT   gene            complement(122735..123574)
FT                   /locus_tag="LS215_0142"
FT   CDS_pept        complement(122735..123574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34296"
FT                   /db_xref="GOA:C3MJL8"
FT                   /db_xref="InterPro:IPR035122"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJL8"
FT                   /protein_id="ACP34296.1"
FT                   /translation="MSDGKLVSVWEEEIKKAQTLEELKQKYEEAQKQIADSKTLKRLYK
FT                   VYEKKQTELLLQQYRQIKAELEKRKKIKKKDKADIRVRIIKKWINSRLFTAEHYVAMLQ
FT                   QSKDGLQLLFLRKAKLVENQGYLMLENKKMRKSWVLNGEPLLLERSKFPFGKKFVAVHF
FT                   VLPDYPYTLDLTVDEKIRQLTLKTLNAPQIIHSIVKTKFFEALARAGGGVDYTMLIIGA
FT                   IMGIGIGVAIGFGIANANLSHLLSQHVTNSTVTTTTHIPTTSTSSSFTIPSNSSKVS"
FT   gene            complement(123567..123851)
FT                   /locus_tag="LS215_0143"
FT   CDS_pept        complement(123567..123851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0143"
FT                   /product="Phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34297"
FT                   /db_xref="GOA:C3MJL9"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJL9"
FT                   /protein_id="ACP34297.1"
FT                   /translation="MILIPAKYAEIALGFDSIMLIMSLLFRKPKGWKERSTLDRKSIKR
FT                   LGYYLVISAIALLVLNHYAFYTNYLDYFEGLMVDAFFFYLGLRAVTQNE"
FT   gene            complement(123616..123867)
FT                   /locus_tag="LS215_0144"
FT   CDS_pept        complement(123616..123867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34298"
FT                   /db_xref="InterPro:IPR020272"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJM0"
FT                   /protein_id="ACP34298.1"
FT                   /translation="MRWGRDDTYTGKIRRNSPRFRFNYADYVITIQKAKRVEREVNIRP
FT                   EKHKTLRVLSGHISYRSLSLESLCFLHELSRLLRGVDG"
FT   gene            complement(123869..124117)
FT                   /locus_tag="LS215_0145"
FT   CDS_pept        complement(123869..124117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0145"
FT                   /product="phosphoribosylformylglycinamidine synthase I
FT                   (FGAM synthase I) (PurQ)"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34299"
FT                   /db_xref="GOA:C3MJM1"
FT                   /db_xref="InterPro:IPR020261"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJM1"
FT                   /protein_id="ACP34299.1"
FT                   /translation="MSALGDVIYVVSILFPAVGLISRNYLINLMGTFLGVIGFLVFVQG
FT                   YTDIAFSGSTFYLAIFPLLLGLVNLAYFFNWLKEERI"
FT   gene            complement(124158..124421)
FT                   /locus_tag="LS215_0146"
FT   CDS_pept        complement(124158..124421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0146"
FT                   /product="VP1/VP3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34300"
FT                   /db_xref="GOA:C3MJM2"
FT                   /db_xref="InterPro:IPR009379"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJM2"
FT                   /protein_id="ACP34300.1"
FT                   /translation="MEISLKTIIFLVLFIVLGTALLSPIVSYVNLLTTPSFTTVSGTVT
FT                   QTNPNPQYVGSSNAPILQLVPLFYILVLIIVPAVVAYKIYKD"
FT   gene            complement(124433..124738)
FT                   /locus_tag="LS215_0147"
FT   CDS_pept        complement(124433..124738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0147"
FT                   /product="VP1/VP3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34301"
FT                   /db_xref="GOA:C3MJM3"
FT                   /db_xref="InterPro:IPR009379"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJM3"
FT                   /protein_id="ACP34301.1"
FT                   /translation="MKVRASIADMLAVLAMTTNIEPKKLRRAEATNIGAILGLFIFILI
FT                   GIVLLPVIVSQVNNLTSGTAPAVTGTNATLLQLVPLFYILVLIIVPAVVAYKIYKD"
FT   gene            complement(124722..125033)
FT                   /locus_tag="LS215_0148"
FT   CDS_pept        complement(124722..125033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0148"
FT                   /product="Phosphoribosylaminoimidazolesuccinocarboxamide
FT                   (SAICAR) synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34302"
FT                   /db_xref="GOA:C3MJM4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MJM4"
FT                   /protein_id="ACP34302.1"
FT                   /translation="MTEYNANQIRAKILRRKILELIVENYVLSASLISHTLLLSYATVL
FT                   RHLRILNEEGLIELYKEGRTLYAKIKENSKQIQILNSELEGFKKLNEKTLVTKNEGKS"
FT   gene            complement(125030..125506)
FT                   /locus_tag="LS215_0149"
FT   CDS_pept        complement(125030..125506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34303"
FT                   /db_xref="GOA:C3MK05"
FT                   /db_xref="InterPro:IPR035130"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK05"
FT                   /protein_id="ACP34303.1"
FT                   /translation="MIGMGTKLIVYVLLFDIFLSLMVGAYGGISPPSIPPIPSYSFDQA
FT                   LASSIVWTVGWPPITLIPPFSILGANFPGVTIPGVTLFSISFSWLAPILYFIGWLTWMF
FT                   QTTASVLMYLISIFTSSVTLLSSVPVVGPFLTAFILIVNFILIWEVVKLIRGGP"
FT   gene            complement(125487..125732)
FT                   /locus_tag="LS215_0150"
FT   CDS_pept        complement(125487..125732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34304"
FT                   /db_xref="GOA:C3MK06"
FT                   /db_xref="InterPro:IPR020142"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK06"
FT                   /protein_id="ACP34304.1"
FT                   /translation="MTDAISLALSTGLGPVIAVIIILAMMGLTYKMAGKIPAIITGIAS
FT                   TFALMFMNFLPIFWGIAVIFGLIAGMVLTGGDRDGY"
FT   gene            complement(125729..128152)
FT                   /locus_tag="LS215_0151"
FT   CDS_pept        complement(125729..128152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34305"
FT                   /db_xref="GOA:C3MK07"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK07"
FT                   /protein_id="ACP34305.1"
FT                   /translation="MKWRLSLLLLTLLLLPIPTNGVITGPHPYFDGGGGFTGPFFKYSN
FT                   TIQVGSSTFSSKYNGSTLSTAPWLNPTYISIYNKYYLQVLPNQQYISNNVSLSLSSSQI
FT                   ALNVTWLLASSSNSGSYGSIAIGYGVNFPSGFTGNYAPAPPYASDGIVVYLEKGGFPTY
FT                   RLFVYFDGVKQLNVSVGSLSIGQQIGLGFWYLPASNQLYVYYYNGTLKTFSITPGQVIN
FT                   NQFYPLSLNTINSNYVIDAQNVGPGYGYGQWVLISYSIFQTKTYSATLSYTSVILGNGI
FT                   QALAGFTGAYNPLNVSTNVTSWSVVGIVTVVNYSVSNSQYSLIGSVSYLTSTNTVYFIL
FT                   NNIYPAPSVNTWYLNVTLEFQFVTPSSTVYKNITIPIFDGGFAVLVQVSLPQSSYLSGQ
FT                   TISVSNSTTIEYPPNAGYSLALKPFTQINIQGLTNGFVPLPYTITVNVNVQTTYYYVIN
FT                   IQFGQFSLGSATGTITIYPVSQLPVIFVSSYPTSVTAGTKVTITFQFTLNTPVSNVTTF
FT                   TYSTTTFTWTYAQIVSSSSLIEFKGYWLNASDGIIIITQSQNYLIPFNYVGLTFYNNSV
FT                   NTIQINIVNNALQLNVNNNVLNLANSSKVIGLGFYYGAGKLVLNWFFVSGIVLQSATAN
FT                   QAYTVLVGTSLSTLSQYTNGYTNASGFGQVTVTLTYTPYELVEIYWGGLQKYTILNISV
FT                   TQPTTTTTTTVNTTTINYNYTNPFSNNISPTSTLYNFSQPWAELIGIVVTVLVTLLGWK
FT                   FGGKGGASGGAVMGLIMVSYLGLVPWYIFYVFIFGIALLLAKIFVDKFMGSDEE"
FT   gene            complement(128193..128417)
FT                   /locus_tag="LS215_0152"
FT   CDS_pept        complement(128193..128417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34306"
FT                   /db_xref="GOA:C3MK08"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK08"
FT                   /protein_id="ACP34306.1"
FT                   /translation="MFNQMPTESITNVTNGSIIPIVKTYNPSPPSPFQVVYDYIPTIIL
FT                   SIGIALLVLTIYLSPSLRITLRKFFVRRK"
FT   gene            complement(128447..129343)
FT                   /locus_tag="LS215_0153"
FT   CDS_pept        complement(128447..129343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34307"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK09"
FT                   /protein_id="ACP34307.1"
FT                   /translation="MRKSLLALLTLSLALLMLATPTGAISASQLGASQIVFTTNQFNFA
FT                   GVSYSNEWISTFFHGWNPIAYDVEGIYLRNISLGYVNNPTGNGYNEIFIGIGLSAYATG
FT                   TLGGAGTPGQIINNSVLAGLYIVTTSSGYYYYVGAETLQNGNLIVAKDSSPITGSLPIS
FT                   LQIQLYDDGNGTATAYITLYYSYGLLTYSFYVPYPFNPSNGYASYSALTLIGAVLQLPY
FT                   ISGGLTSFDFVYQSNGQNYEWPNQIASGTQIMAGVYSISGSVNELTQVSLYNGFLNNGL
FT                   WSYIYNFSNPYPTTYAL"
FT   gene            complement(129381..129758)
FT                   /locus_tag="LS215_0154"
FT   CDS_pept        complement(129381..129758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34308"
FT                   /db_xref="GOA:C3MK10"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK10"
FT                   /protein_id="ACP34308.1"
FT                   /translation="MFAKNIISALVRWFIMDRLKVLWFIFILGNIYDVVISAIAWRYGA
FT                   MEINQTLIDLGLWYGNTSFFAVMEAFVGVKLILIVGVYWFLKLFEKLGVSKYEWLGLVP
FT                   FAIETIFVLIYDTYNFVMHLF"
FT   gene            complement(129724..130107)
FT                   /locus_tag="LS215_0155"
FT   CDS_pept        complement(129724..130107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0155"
FT                   /product="zinc finger C2H2-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34309"
FT                   /db_xref="GOA:C3MK11"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK11"
FT                   /protein_id="ACP34309.1"
FT                   /translation="MESGSERHLIYKSNHKGITIHVTLEELERYHSLTPEQKRIIRAIV
FT                   KTLIYNPQLLNESSYLYKLLTSKAVSPYVCPLCLTPFSSSVSLKQHIRYAEHTKVCPVC
FT                   EKAFQKTDALLDHVCKKHNICVS"
FT   gene            complement(130091..130708)
FT                   /locus_tag="LS215_0156"
FT   CDS_pept        complement(130091..130708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34310"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK12"
FT                   /protein_id="ACP34310.1"
FT                   /translation="MSRLLNILYNYEIVSQNDTKTIWVTELSRCLRRSYLMRKEGKTKV
FT                   GLNEAMKMHIGTGLHMRLQSLLRKHGFETEVRVQRKTALGFQIVGRIDVYDKEENTIYE
FT                   LKYTHNDKLDSVRLNNYLRQLNYYIEMANAMKGYLVIVHADGSVEEIKRDWAETDLEKR
FT                   TNAYGIYVDENILPPRKNRPDAECIECPFYNFCWGNRNGVRQ"
FT   gene            complement(130705..131013)
FT                   /locus_tag="LS215_0157"
FT   CDS_pept        complement(130705..131013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34311"
FT                   /db_xref="GOA:C3MK13"
FT                   /db_xref="InterPro:IPR020512"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK13"
FT                   /protein_id="ACP34311.1"
FT                   /translation="MYLNETLLDIILYYGFQFNDYWTTILGVNLGGREVNFVAKLFMKN
FT                   RLTLAIYKFDLATVALLLAFMLNDVKMIQTFLLIVDVVECLVTLNNTLTIYRHKVRR"
FT   gene            complement(131016..131255)
FT                   /locus_tag="LS215_0158"
FT   CDS_pept        complement(131016..131255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0158"
FT                   /product="zinc finger C2H2-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34312"
FT                   /db_xref="GOA:C3MK14"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK14"
FT                   /protein_id="ACP34312.1"
FT                   /translation="MYRCPICGFTTIRLFALKQHTRRNHVLTKCPVCKNSYIRLNQHLY
FT                   TKYDIEHLMYCYLFSTYKLPKNVMLAIKRKLEVE"
FT   gene            complement(131258..131413)
FT                   /locus_tag="LS215_0159"
FT   CDS_pept        complement(131258..131413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0159"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34313"
FT                   /db_xref="GOA:C3MK15"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK15"
FT                   /protein_id="ACP34313.1"
FT                   /translation="MISKDWGMDIISFRLPPEMNAKLEKIAHKKRISKSELIRMAIVEY
FT                   ISNHGE"
FT   gene            complement(131425..131742)
FT                   /locus_tag="LS215_0160"
FT   CDS_pept        complement(131425..131742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0160"
FT                   /product="orotidine 5'-phosphate decarboxylase (OMP
FT                   decarboxylase) (OMPdcase) (PyrF)"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34314"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK16"
FT                   /protein_id="ACP34314.1"
FT                   /translation="MFEPQTKELFEEEINLDFFIQTVKVIGKYNEYHKLYVRIKDTKIL
FT                   SEGEIKYQHLSPEEMQVTAILKQIAKLYDLYKNTNNEKLAEGAKEEILKLIALLIWNIN
FT                   H"
FT   gene            complement(131644..131811)
FT                   /pseudo
FT                   /locus_tag="LS215_3009"
FT   gene            131842..132288
FT                   /locus_tag="LS215_0161"
FT   CDS_pept        131842..132288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34315"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK17"
FT                   /protein_id="ACP34315.1"
FT                   /translation="MRYMKSTPFFYPEAIVLVYIYDNEGIATYDLYKKVNADFPMSTAT
FT                   FYDAKKFLIQEGFIEEKQEKGEKKIYLTEKGKLFAISLKPGIETYKRMKKEADPNKILI
FT                   AMALAGQTILIPYVEIFTRLGILDEEAKKRIIDDLKYLQRFLKS"
FT   gene            132296..132532
FT                   /locus_tag="LS215_0162"
FT   CDS_pept        132296..132532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34316"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK18"
FT                   /protein_id="ACP34316.1"
FT                   /translation="MFKHQKTFMLLLFKYKLTMKEYIGIKLDPEIKEKFVFLAKQEKLT
FT                   LTDAIEILIIEALSRGYIDKKRQEALKSSEVMQ"
FT   gene            complement(132456..132719)
FT                   /locus_tag="LS215_3010"
FT   CDS_pept        complement(132456..132719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_3010"
FT                   /product="site-specific integrase-resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_3010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34317"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK19"
FT                   /protein_id="ACP34317.1"
FT                   /translation="MSRVCACLSLSKVCLRANSLSIAFGLYLSSLTISSVSSSSSTISS
FT                   VSSTTSSSSSTISSSSKLIASPQKILMPLVSSYQYTLCLMLQ"
FT   gene            132529..132933
FT                   /locus_tag="LS215_0163"
FT   CDS_pept        132529..132933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK20"
FT                   /protein_id="ACP34318.1"
FT                   /translation="MSFDDEEIVEDEEEVVEDTEEIVEDEEETEEIVKEERYKPNAIDK
FT                   LLALKQTLLRDKHAQTLLILNRLEGANLTRISKEIHASHKRMRQILRDLESTGYIIAYR
FT                   KYPDTNTYYKLTVKGKKIVELIYEVITFRW"
FT   gene            133135..133566
FT                   /locus_tag="LS215_0164"
FT   CDS_pept        133135..133566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0164"
FT                   /product="chromosome partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34319"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK21"
FT                   /protein_id="ACP34319.1"
FT                   /translation="MNDKLTSELFFRVHSFVKEKYMSLSVRQKKIVKLALESIIVSLAE
FT                   DKENFSKIAKELGIELVKDNLTLSPININININEAKAQAKSEVKLDISKLTELLNELES
FT                   LLIAIQKNNFNAKQNVYTIPPARWKELNEKIDSLKKLMN"
FT   gene            133568..133756
FT                   /locus_tag="LS215_0165"
FT   CDS_pept        133568..133756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34320"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR037292"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK22"
FT                   /protein_id="ACP34320.1"
FT                   /translation="MEDLDSLTRKLLTKVREIKIDMLTNSDKTKEDVDKALNLTDQIYA
FT                   ELYSLKLKIEKQGVLTQ"
FT   gene            133753..134331
FT                   /locus_tag="LS215_0166"
FT   CDS_pept        133753..134331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34321"
FT                   /db_xref="InterPro:IPR022012"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK23"
FT                   /protein_id="ACP34321.1"
FT                   /translation="MTSTNSFANQLKEKYKDKWTLTTIREDIARKWLMLTLNLSENDIV
FT                   VNGIGVLDSNKVDETWEGDPKKKYDFYIPKYNMYIDITGTQFTKRQSSSRLHGMELKGS
FT                   YVAVLGVKYAVGLVLQQYYKAKAVIANIADNEGEIRFITVDYITLLKKKGIAISTKEFA
FT                   KGENEYILIPWKEFWKPSRFKNWLKAFIK"
FT   gene            134452..134724
FT                   /locus_tag="LS215_0167"
FT   CDS_pept        134452..134724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0167"
FT                   /product="ORF D-335 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34322"
FT                   /db_xref="InterPro:IPR012922"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK24"
FT                   /protein_id="ACP34322.1"
FT                   /translation="MGNKVFTFGDIRIREVKGKYYVYLIEKDNEGNRRDHYVGSLDQIV
FT                   KEYMRGTGFEPAQAFASGASVRPLCPDSGTPAHQYFILTRYKVLP"
FT   gene            complement(134597..134681)
FT                   /locus_tag="LS215_R0001"
FT                   /note="tRNA-Leu3"
FT   tRNA            complement(134597..134681)
FT                   /locus_tag="LS215_R0001"
FT                   /product="tRNA-Leu"
FT   gene            135192..136181
FT                   /locus_tag="LS215_0168"
FT   CDS_pept        135192..136181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0168"
FT                   /product="transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34323"
FT                   /db_xref="GOA:C3MK25"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK25"
FT                   /protein_id="ACP34323.1"
FT                   /translation="MQGNKVKSFTLPIISYAVPTFVLVYPSFFVGWLSDSMHLAYWEVF
FT                   AIVALPFLGRIIGSFIYQLFKGSVVSYCFPLLGFLVVLQNFLGALVFVRFLVGVIFGLL
FT                   TSYAVESAVRSGRNVLVGFTTAGWSMGWVISYLAYSLLKNWNVITISGILIMFLALFEL
FT                   NKEEFRERGMSSVSFPRLTSILIYISALTPAFILQVMPSFLETIKLTWLILPSYLLSIP
FT                   TYVLLPMISGKVGIRKVLVISSIIVILSSIITFLLLPMMVIVFTSIGLGILGITPKYLA
FT                   IRGEDPKRMGLALNIGSVMGLIVPVLYALMPFSPEFLLSILMVLMLLI"
FT   gene            136273..137346
FT                   /locus_tag="LS215_0169"
FT   CDS_pept        136273..137346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0169"
FT                   /product="eRF1 domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34324"
FT                   /db_xref="GOA:C3MK26"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK26"
FT                   /protein_id="ACP34324.1"
FT                   /translation="MKALIKELKKWKAPATVLLSLYIPPGRPIPDVVNLLRQEYSIAQN
FT                   IKLKRTRDAVLSAIGAAIDRLNKIPKIDGNGLVLFCGENFDTEDFKCFMFSPPDKVPLF
FT                   FYRTDKEFHVEFLEDMVEDTVVYGLIIVERDEATIGLLKGTRIEILEEIEGFVPGKHMM
FT                   GGQSQRRIDRIIDEMYHNFLKEVGEKVNAYFMPFIQTGKMKGILLGGPGYAKEDFYKED
FT                   YVDYRIKNLILQPLIDVSDQGEVGLREMIMRAEDLLKNQQYVEVEKLLEELKYHLAKDD
FT                   GLIIYGKEQIKKAMEMGAVEAIVIHEDSSDKELEKLAQDAENYGVKVFVVGDEVPEAEW
FT                   VKKTFNGVVGKLRYRLY"
FT   gene            complement(137347..137979)
FT                   /locus_tag="LS215_0170"
FT   CDS_pept        complement(137347..137979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0170"
FT                   /product="phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34325"
FT                   /db_xref="GOA:C3MK27"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK27"
FT                   /protein_id="ACP34325.1"
FT                   /translation="MPKIPVKVVTWDEIVSLSTKLAEKIKDDNYDVDVIIAIARGGLVP
FT                   ARLVADVLGVFDILSIKIEHWIVTASHTPEAKVKYPFKVDLSDKNVIIVDDITDTGDSI
FT                   ELARKYVMENFGPKEVKTATLQYIKPAAKIMPDYYAEEIVNWAWFMYPWNYWEDEINLV
FT                   NKILVERKTKDIDLNELKKNFVENYGINDPPISLDKILMEMKRRKII"
FT   gene            138063..138875
FT                   /locus_tag="LS215_0171"
FT   CDS_pept        138063..138875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0171"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34326"
FT                   /db_xref="GOA:C3MK28"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK28"
FT                   /protein_id="ACP34326.1"
FT                   /translation="MIEENEKASIGIIGGSGLYDPGIFSESKERKVYTPYGEPSDLITI
FT                   GKIGNKTVAFLPRHGRRHRIPPHKINYRANIWALKELGVRWVISVSAVGSLRIDYKPGD
FT                   FVIPDQFIDMTKKRDYTFFDGPVVAHVSMADPFCNSLRKLALETAKELNIRTHESGTYI
FT                   CIEGPRFSTRAESRTWREVYKADIIGMTLVPEVNLACEAQMCYATIAMVTDYDVFAEIP
FT                   VTAEEVTRVMAENTEKAKKLLYALIQRLPEKPEEGSCSCCNSLKTALV"
FT   gene            138836..139624
FT                   /locus_tag="LS215_0172"
FT   CDS_pept        138836..139624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34327"
FT                   /db_xref="InterPro:IPR009830"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK29"
FT                   /protein_id="ACP34327.1"
FT                   /translation="MFLLQQSEDSTSIRKLVKFLNINFPQIDLIVYGRGLELPSFTLAR
FT                   ALSSLKNKIISTLNIYDFLFIYNPYVEVSNVIAFTGDENELRELLDGLESLRVRGSIYH
FT                   CGVTDIKPRYNLISINSLDKTFCEINLSLSILKVLSNNKNTEREKRILDQLNDLSDLDD
FT                   YVKNYAKVFNLDLPILLSPVMVPAKSFLESLGINVSSYFDTKILDGAQIVYTGVDMYIT
FT                   RRMIFSLKSKGKKVTDVLIDVDPLLAPIYLSMIMFYLKKK"
FT   gene            139640..140485
FT                   /locus_tag="LS215_0173"
FT   CDS_pept        139640..140485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0173"
FT                   /product="Polyprenyl synthetase"
FT                   /EC_number="2.5.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34328"
FT                   /db_xref="GOA:C3MK30"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK30"
FT                   /protein_id="ACP34328.1"
FT                   /translation="MSIIEFWLEAKTTIDKLIEQFLNSNRDWDLVDISTYILKDGKRFR
FT                   GTLNMFFTVALGGDIKDSYGGALAIEILHSASLALDDIVDLDVTRRGDKAAWVIYGNRK
FT                   VIFITNYLIPTALRIIQTSYGDDALNTSIELWKDTSVGALRDMYDNNDYIRTIELKTGS
FT                   LFKLSTVLSAYASKHYNTKQQMLDVGKYLGIIYQVIDDFVDYKTKKLEEIDGSAKQLFK
FT                   YYREGKLEEYVRSVYLEYKQKYDELISNIPFQSKYISEIRSLPEFLANGLLKEANIDKI
FT                   "
FT   gene            140581..141408
FT                   /locus_tag="LS215_0174"
FT   CDS_pept        140581..141408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0174"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34329"
FT                   /db_xref="GOA:C3MK31"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK31"
FT                   /protein_id="ACP34329.1"
FT                   /translation="MEIKNRNHSAYYIRISKLNAEITEKGIEFTYSGKKVDIDGGLIRN
FT                   LGFISTTEQFIKRLDVLRELERSGVVLMNRPDSMLLARDKFASLMRMRRAGIPVPNTAL
FT                   VEDPFEVMRLVERWGEVVIKPVVGSLGLGSVKVSDPDIAFRVAKAILSVNQPVYVQKYV
FT                   KKPDRDIRVIVIGDRVLGSIYRISKSGWKTNIAQGATAQVLIPDAELEEISLKSVRVLG
FT                   LDYAGIDIIEDVENGGYKIIEVNAAPLWDGFEAATNINPAKYIAAHLIEKIRR"
FT   gene            complement(141456..141917)
FT                   /locus_tag="LS215_0175"
FT   CDS_pept        complement(141456..141917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0175"
FT                   /product="regulatory protein AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34330"
FT                   /db_xref="GOA:C3MK32"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK32"
FT                   /protein_id="ACP34330.1"
FT                   /translation="MNSSFYYLDDIDKKILNILQQDSRIPFSRLAKMLNLSEATIYVRI
FT                   KRLKENGVIRGFYTEIDFDKIGLSVVAFILIKADPKKYDNILKQLVEMKEIYEIYDVTG
FT                   EYYAVLKVRVPTREDLAKVLDKIGNMDGVTSTYTMLVLRSIKDKKELDL"
FT   gene            complement(141914..142912)
FT                   /locus_tag="LS215_0176"
FT   CDS_pept        complement(141914..142912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0176"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34331"
FT                   /db_xref="GOA:C3MK33"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK33"
FT                   /protein_id="ACP34331.1"
FT                   /translation="MTRIAIVGAGPAGLSLAYFLKGNRKVDATIYESMEEPGLKPCAWG
FT                   LITGIENIIPIPNETIISEIRGFRIYLDNKLVFDISTDNKLGYIIDKPLFLKRLSEEVN
FT                   VEFNSKVVKKDDKYYVNDKPIDHDKVIFATGHYSVSKSMSIPAIQYITDYEIDKEVVEF
FT                   YFYSGFLGYAWVFPDREGSKIGIGGYAEVPELKERLKQILKGRIKMFHGARVTDYGVIE
FT                   DRLDGNYTGEALGTVYAITGEGIRPSIISSKILADSILTGKDFKKEFKKSKLYWSLKWH
FT                   AKIIKMTKERDPTTVRLSKALLNNDPQLILKFAIGDFNRVDLIKIFGRSLI"
FT   gene            complement(142920..143432)
FT                   /locus_tag="LS215_0177"
FT   CDS_pept        complement(142920..143432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34332"
FT                   /db_xref="GOA:C3MK34"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK34"
FT                   /protein_id="ACP34332.1"
FT                   /translation="MKASYTLPLSILMIVLPIVPGLVDSFIAFLVGALIDFIVAVYVLI
FT                   SEKPWANDIKTAISTLYFTALSTFADVAGVFFVMAYQDEYKFAIVTLTLSIPFIYNLFL
FT                   VLKSVLPNIIKRDILYVGNGFFAFILVLIIGAIIGRAFITNFYALLPLYTGFLILAIIA
FT                   LFYFRKK"
FT   gene            143490..144317
FT                   /locus_tag="LS215_0178"
FT   CDS_pept        143490..144317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0178"
FT                   /product="peptidase T2 asparaginase 2"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34333"
FT                   /db_xref="GOA:C3MK35"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK35"
FT                   /protein_id="ACP34333.1"
FT                   /translation="MRYNLPVLVIHGGAGSWQIVDQDKAKLTISEALERGYYEFRKGSA
FT                   LEAVVEAIYYMEESGVFDAGKGSVRNSAGYIEMDAGIMIGNTLQVGGIMGLREGSAIKK
FT                   ALEILLQNRHVLMIGSGDNTSNNKNAISESKVSGDTVGAVALDQHGNLVAGTSTGGIKG
FT                   KLPGRVGDSPIPGAGYYATPNVAVSSTGIGEIILRMLPAKEVDILVSLGFIIDDALRAV
FT                   INKITKIFGKDNIGMIGLDKYGNASAYYNTKGMARGVISSDGVKKVYVFEGEI"
FT   gene            144318..144857
FT                   /locus_tag="LS215_0179"
FT   CDS_pept        144318..144857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK36"
FT                   /protein_id="ACP34334.1"
FT                   /translation="MKILVMSNIRFPEPHVESMLSSIIKKEEPEVIVLNGDTTQCYWDY
FT                   ECPRVIDVLYVIRSIAPWAQIIYVQGDMDPHAIKCITAEPRYREEIIGTTMYIAEAASV
FT                   KYHIIHGHQGEIDQLRKSIGAGPWDWLVIGQYKRLEIDKLARVLYSGGITREFPPEARG
FT                   YVVITDSNFYIRNLRT"
FT   gene            complement(144854..145090)
FT                   /locus_tag="LS215_0180"
FT   CDS_pept        complement(144854..145090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34335"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK37"
FT                   /protein_id="ACP34335.1"
FT                   /translation="MIVVVKYRIMDNNIRKIVNSLRKIPFIKEILFYSGEKNSIFANNY
FT                   KIWEEGSDLNPIEEVYDVKILELARRMYFPTCG"
FT   gene            145184..145567
FT                   /locus_tag="LS215_0181"
FT   CDS_pept        145184..145567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34336"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK38"
FT                   /protein_id="ACP34336.1"
FT                   /translation="MQLENKPIVVISSTNAEEIPNFIRAMFKDCKLNGSKKLIINFISL
FT                   ISYPEFIQNAREALLDNIDLGAYIYIWKPEEVDQMMKKILENRQDMKGIIIYCDDNNKH
FT                   TIEKILHKVPNSIKANIIKDYCK"
FT   gene            145607..146968
FT                   /locus_tag="LS215_0182"
FT   CDS_pept        145607..146968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0182"
FT                   /product="geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34337"
FT                   /db_xref="GOA:C3MK39"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK39"
FT                   /protein_id="ACP34337.1"
FT                   /translation="MKSAEYDVLIIGLGIAGASLAWKLSQSNLKVLAIDSKPWNRFGDK
FT                   PCGDAISKEHFDNLGMPYPQGKELEEKVEGIKLYSPDMKTVWTVKGEGFEIDSPSYVQR
FT                   LTKEARDRGVEILDLTTAMKPIIVGNKVEGAVLFNRRTNETIEAKAKITVDATGYSTSF
FT                   RSKLPFEFPVTESLDDKDADVAYREVLNTKDEIDEYPYLRIFITQKASPGGYWWYFPKG
FT                   PNKVNVGLGIQGGMGYPSIHEFYNKYVDYYAPDIDKKRLLVKGGALVPTRRPLATIVWD
FT                   GVAVIGDSAFTVNPVHGGGKGSAMISAYCVGKAILNAFENNDFSAKGLWNANECYIERY
FT                   GAKQASLDLFRRFLQKLSDDEINYGMSRKVIREEDLLEASANGDLQLSTAEKAMRAIMA
FT                   LGKPSLLFKLKTVAEYMKKVKDVYKRFPAEPNGLMKWKYSVDSIILEFNKALEK"
FT   gene            complement(146939..148555)
FT                   /locus_tag="LS215_0183"
FT   CDS_pept        complement(146939..148555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0183"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34338"
FT                   /db_xref="GOA:C3MK40"
FT                   /db_xref="InterPro:IPR019204"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK40"
FT                   /protein_id="ACP34338.1"
FT                   /translation="MGMDTENLTRKYYGYLKTLPNIKIFATTFSAESLFIMLRSFQLTF
FT                   DYLFSFALYSILLTIIFKNKIKLALFLMNLTAIPYLLLSLLPIAPFYAFGFFMPLMAYI
FT                   LLSSYKEIPSIVLSGITSYVPIIFYVKYSIIFLIYIIIIGLIFHFYIYTVNRKGVKILG
FT                   FKSTQVAVPFITAITEKNKVPLENFLNLVSVKTNLSVFMYKLDDFLFMIPQIHFGVFDS
FT                   VGSSRFVYDIEKTLRNNVVTVFHGPGSHELDLPSSAEVNKVMEEISKSTLERSNWYKAT
FT                   FYGISIEKRSTFDITSLEFDKFRVSFMERPEFGIDDLPSSLWKYMLSSNNYLIDCHNSF
FT                   LVKEYDNHEINSLKEFIMDQRGIKSTRKLLVGYAEGKLAKTCEGLCDSRIRVFTFDDRV
FT                   KRVSIVYIYANNSTKELNNAISSAVRQIVDKVILVTPDDHSCTGISLGITYSPATFCED
FT                   IVNKASELIKRSTENMKEINSIEYKVVKIKGVKILGKIISIMLKALEDVGSYTSKTFWI
FT                   PLVAPYVLLVVILLFQSLIKF"
FT   gene            148586..148876
FT                   /locus_tag="LS215_0184"
FT   CDS_pept        148586..148876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34339"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK41"
FT                   /protein_id="ACP34339.1"
FT                   /translation="MSINKEKLGVDKVIRNSLDYCDLYIIQKGDKVFLLYLFEREKYYY
FT                   FKIMPEIIGKWEDCENVLYTAIGLFGFVNKQDELEQKIREKMEALIKNVNT"
FT   gene            148863..149657
FT                   /locus_tag="LS215_0185"
FT   CDS_pept        148863..149657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0185"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /EC_number="3.1.3.41"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34340"
FT                   /db_xref="GOA:C3MK42"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK42"
FT                   /protein_id="ACP34340.1"
FT                   /translation="MSTLNDYQLIISDVDGVIVREGEPIWENIQALRNIQNNGVKVIFV
FT                   TNNSGFSRILLSRQLSYLGLKVTPDMIITSGLAAAIYMKEKLNVKSVFAVGEEGLIEEL
FT                   KNHGFLVFSSVESERNLPDAVVMGLDRLSTYDKLSLAMRCISKGSKFIVTNMDRLWPAK
FT                   DGLKLGAGALASSIIYALRRDPDFIAGKPNTWIIEIAMRISSVKKLDKILVIGDQIETD
FT                   IQMGYNIGADTALVLTGISTVDDVDRSSVKPKYIVNSLLDLL"
FT   gene            149705..151405
FT                   /locus_tag="LS215_0186"
FT   CDS_pept        149705..151405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0186"
FT                   /product="succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34341"
FT                   /db_xref="GOA:C3MK43"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK43"
FT                   /protein_id="ACP34341.1"
FT                   /translation="MEKIEYDAVVIGGGLAGLMSAHEIASAGFKVAVISKVFPTRSHSA
FT                   AAEGGIAAYIPGNSDPNDNPDYMTYDTVKGGDYLVDQDAAELLSNKSGEIVMLLERWGA
FT                   LFNRQPDGRVAVRYFGGQTYPRTRFVGDKTGMALLHTLFERTSGLNVDFYNEWFSLDLV
FT                   TDNKKVVGIVAMQMKTLTSFFFKTKAVVLATGGMGMLYRHTTNSYINTGDGFGIALRAG
FT                   AALKDPEFVQFHPTALYPSDVLISEAARGEGGILKNVKGERFMTKYAPKKLDLAPRDIV
FT                   SRAIITEIREGRGFPGGYVGLDLTHLGEEYIKERLALAVEAAKSFASVDAFTEPIPVRP
FT                   AQHYYMGGIDVDIDGRNPDIAGLFSAGEAACVSVHGANRLGSNSLLDTLVFGQVTGRTV
FT                   VQFLKSNPGNPTSNYEKEAEKVVDDAYKFVKSESGVHFGQILEKLRDTMWDYVGIYRDE
FT                   GGLLNAMSEINKLRGMISNMYVTDKSKVYNTEFFNALELRNMLDLALTITKSALERKES
FT                   RGAHYRTDYPDRDDNNWLKHTIAYLRGNTVEVTFKPVKITRWKPEPRVY"
FT   gene            151407..152357
FT                   /locus_tag="LS215_0187"
FT   CDS_pept        151407..152357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0187"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34342"
FT                   /db_xref="GOA:C3MK44"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK44"
FT                   /protein_id="ACP34342.1"
FT                   /translation="MTQSQEEEVILKVKRFNPERGFWWAEYKLKVDRFTQFTEALRRIK
FT                   SEQDPTLSYRASCHMAVCGSCGMKINGEPRLACKTLVLDVAKKYNSHVITIEPMDYFKP
FT                   IKDLIVDWDEFYERMFKVKPRLYQAKEVLEGKAEHRLKPEDQKELWKFAQCIWCGLCVS
FT                   ACPAVIIDQQFLGPAAHAKGYRFLADPRDTITEERMKILIDSSWRCTYCYQCFNVCPRD
FT                   IEPVTAIKKTRSFTRIYKAKSEVAERGENHVEAIRESIFKTGKLSEAPVYLKTYGVLQS
FT                   LIDLVYMSRAGKLKYILVQEKPVQNINEIKKIIGE"
FT   gene            152363..153235
FT                   /locus_tag="LS215_0188"
FT   CDS_pept        152363..153235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0188"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34343"
FT                   /db_xref="GOA:C3MK45"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK45"
FT                   /protein_id="ACP34343.1"
FT                   /translation="MKIAYYPGCATHGLSKDVDIATKKVAEVLGVELIEVPDWNCCGGG
FT                   FYDEYDEVGHVALNLRNLSQVEKMGLTKMVTPCSVCLHSHRLATYKYKEDRDIKRKTDK
FT                   RLEGTSVKYEGKVDAEHIVWVLLRDVGVENIKKHVKKTLTGLKVGTYYGCQMLRPEQIM
FT                   GFEKAYNPTSLSELVAVTGAIPVPFPTMTSCCGFPLVGSNPKGALKLAFNVLNGAKQAG
FT                   ADLVIHPCSLCHLQLDSLQLKVKAEFNVSWTMPAIYVTQLLGLSFGFSPEELGIGKIAI
FT                   DVLRNKGVI"
FT   gene            153236..153601
FT                   /locus_tag="LS215_0189"
FT   CDS_pept        153236..153601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0189"
FT                   /product="succinate dehydrogenase subunit D (SdhD)"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34344"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK46"
FT                   /protein_id="ACP34344.1"
FT                   /translation="MSEEIKKIIQDIGGKPEEWISVSERPGKEPFAKELNYIFNDYFWG
FT                   KVHVRNEGDIYVLVISKDVFNWKDRIKDLKLSGEVVDAAGGLMWIQEFDIQGLKRDFAS
FT                   LKTFIENIRKQKQQKTS"
FT   gene            complement(153686..155044)
FT                   /locus_tag="LS215_0190"
FT   CDS_pept        complement(153686..155044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0190"
FT                   /product="von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34345"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK47"
FT                   /protein_id="ACP34345.1"
FT                   /translation="MSEEEGVLRGIDYKDPLVKYRGERISYTLKKLLGRDVQLNETFLV
FT                   DTYYVHYLPLPITKGKSEIEKNKEIAYSLVNSTLSSDVVLKNREYSIVNSAVSLALTVS
FT                   YVQNLIEELERIKKTSQSMEEREAAEEILNGLMKGSSSKEGKEQKNTNQQSMEKVLRQA
FT                   HEKAMSKAIEDANSVRNMQKIVGGNGAGTGSVLTFEGEIHEVLRLARNTEIKKILEFLS
FT                   GIPKLGSITKRRTTRFSKGELYGYEEGSDIERIVYSELALPDMLFYLKLAEGQLLLYQK
FT                   QIKETLGPIYLLLDKSGSMDGEKILWAKAVALALYSRAKRENRDFYLRFFDNIPYPLIK
FT                   VQKNAKSKDIIKMVEYIGKIRGGGGTDISRSIISACEDIKEGHVKGVSEIILLTDGEDK
FT                   IAETTVRRSLKEANSQLISVMIRGDNADLRRVSDEYLITYKLDHEDLLKVVES"
FT   gene            complement(155041..156189)
FT                   /locus_tag="LS215_0191"
FT   CDS_pept        complement(155041..156189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0191"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34346"
FT                   /db_xref="GOA:C3MK48"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK48"
FT                   /protein_id="ACP34346.1"
FT                   /translation="MSEKTLLELPKKFMESLMAPFIGREEEAKVITLALLSKEHVILIG
FT                   EPGTAKSALARRAAELLNAKFFMYLLTKYTEPAELFGALDINALKEGQYKRITKDRLPE
FT                   SQIAFLDEIFNANSAILNALLSLLNERVIYDGYNVIKVPLRTLISASNRVPDEPELEAL
FT                   YDRLLLRHYARPVGEELWKQLLDATWEIEFTNRWAVKEPIMNIEHLDKLYSYLSQVDLS
FT                   GVKNKLLKLYAMLEEKGIHLSDRRKGKVLKVVSAHAILNSRLKATEEDLIVLKYIAPRE
FT                   IDDFEKVAALLSEELKTPIKYMKELNEIYNNIKEAAKYVEAANESDPRLIELIRSLRAT
FT                   RDRIVALGKESGDEKVEEFSKEVLSEIDKLIEKVARKLGIYP"
FT   gene            156625..157071
FT                   /locus_tag="LS215_0192"
FT   CDS_pept        156625..157071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0192"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34347"
FT                   /db_xref="GOA:C3MK49"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK49"
FT                   /protein_id="ACP34347.1"
FT                   /translation="MGEKVGNLKPNMESVDVTVRVLEASEARQIQTKNGVRTISEAIVG
FT                   DETGRVKLTLWGKHAGSIKEGQVVKIENAWTTAFKGQVQLNAGSKTKIAEASEDGFPDS
FT                   SQIPENTPTAPQQMRGGGRGFRGGGRRYGRRGGRRQENEEGEEE"
FT   gene            157068..157349
FT                   /locus_tag="LS215_0193"
FT   CDS_pept        157068..157349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34348"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK50"
FT                   /protein_id="ACP34348.1"
FT                   /translation="MNFEDVKDKKPKKIGELIDRSEENENYIVKVAEDKVYELAPIAYY
FT                   IWTMCDGNRSVDEIVNELSKEANLDISQVRDPVVMVLDELEKASLIAF"
FT   gene            157374..159014
FT                   /locus_tag="LS215_0194"
FT   CDS_pept        157374..159014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0194"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34349"
FT                   /db_xref="GOA:C3MK51"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK51"
FT                   /protein_id="ACP34349.1"
FT                   /translation="MRVFVGDESLYSIDEAIKVYLSSLNFTPKIVKVEVKDSFGYVSAE
FT                   DLMSPIDYPPFSRSNVDGYALKSSCTPGELKVIDKIGIGEFKEIHIKECVAVEVDTGAM
FT                   IPMGADAVIKVENVKVINGNSIKIDKKINFGQNIGWIGSDIPKNSIILRKGEVISHEKI
FT                   GLLASLGISSVKVYEKLKIYLIATGDELVEPGDSLSPGKIYESNLHYLYSKLKENYKIV
FT                   GLSLLSDDISSIKNEIKRAISVADVLILTGGTSAGEKDFVHRAVRELGNIIVHGIKIKP
FT                   GKPTILGIVDGKPVIGLPGNIVSSMVVLNMVILEILKSLYPSRKEILGLGKIKARLALR
FT                   VKADEHRNTLIPVYLFRSIDNSYYALPVKFDSYMVGTFSLTEGYIMLGPNEEIEEGKEV
FT                   EVDVKKFDDSISIIGEEDKRILNLDTKNVLLGSLPASKAIEYKFGDVAVISSLFTEPIE
FT                   NYDKVLCRQILVNGEGEEIGYDDWIGMSKIVKNPVVKLKSPSTIYSLVGKARVYAPEGY
FT                   IVGDKVAEECLYMIGISERGKRYLSAIKV"
FT   gene            159354..160289
FT                   /locus_tag="LS215_0195"
FT   CDS_pept        159354..160289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0195"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34350"
FT                   /db_xref="GOA:C3MK52"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MK52"
FT                   /protein_id="ACP34350.1"
FT                   /translation="MECKRARAYSSSANLGSGFDILSMAHTAFFDTVEICVETKNSENI
FT                   VIESNSKIPLEPNRNSATYPLVRIMEERGIKASLRVKVIKGIPEGLGLGSSGASATAAV
FT                   MAFSSLFNLNLSKEDLVRYAMYGEIASSGSPHPDNVAASVFGGVVSVVSVNPVKVVEIP
FT                   LNYSFNILLFVPLNVHIEEKTKKAREMVPKTVKLSDYINNSRYISSLLIGFVKGERDLI
FT                   RLGLNDEIVEKARLPLFPYYPKIKEIAIKYDAVGSCVSGAGPSILVLTDKMTDENKIAE
FT                   EGTKTCNEFNVECEVIKAKIAGGVEVERRN"
FT   gene            160273..161403
FT                   /locus_tag="LS215_0196"
FT   CDS_pept        160273..161403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0196"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34351"
FT                   /db_xref="GOA:C3MK53"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK53"
FT                   /protein_id="ACP34351.1"
FT                   /translation="MKDATRTVREDIDEATGAITTPIYQTTAYHYPEGEKYRYSREANP
FT                   TVLELTKKIVELENAEMGVAFSSGMGAISTSALALLKPGNSVLVHRDMFGRSYRFFTDY
FT                   LKNWGVNVDASNPGSDNIIEKAKSKRYDVIFVENITNPLLRVVDITELSKVAKERGSIL
FT                   IVDATFSTPINQKPLELGADIVVHSASKFLAGHNDVIAGLAAGYGKYLNVIDQMRRTLG
FT                   TSLDAHAAYLTLRGIKTLKIRMDVINRNAEQIAEFLEGHPKVVKVYYPGLKSHVDYEIA
FT                   RKVLKGFGGVLSFEVNGGQESALKVMKSLKLIIPAQTLGGVNSVISHPATMSHRTLSLE
FT                   ERKIVGITDSLLRLSVGIEDVNDLIEDLDRALGTLY"
FT   gene            complement(161400..161714)
FT                   /locus_tag="LS215_0197"
FT   CDS_pept        complement(161400..161714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34352"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK54"
FT                   /protein_id="ACP34352.1"
FT                   /translation="MDSGITIIAEKLIDPSVKKACKMVVKDDEIIKLVGISSKKLALNV
FT                   IDKVSFWLVYENNNLLYCKLCNRGPFTKKGLYLHLSRVHRREIREMLEEELRHEIRTII
FT                   "
FT   gene            complement(161693..162232)
FT                   /locus_tag="LS215_0198"
FT   CDS_pept        complement(161693..162232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34353"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK55"
FT                   /protein_id="ACP34353.1"
FT                   /translation="MSTEIDSKNVSMDMFTTYEEELRVGEALAHILAAASIVIELEGES
FT                   EEVRNTIMKYVDLWISKLSPIDYSPGMAEVIGSKVRKKITNIFDKISENELGDILDFII
FT                   DVKRKLDIGTLETEILELEVRVERVLRVLGIDINDIRQFFDFTNVEKRANRLIALATVS
FT                   IGIASVWDEKWTAELQ"
FT   gene            162370..163377
FT                   /locus_tag="LS215_0199"
FT   CDS_pept        162370..163377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0199"
FT                   /product="protein of unknown function DUF1152"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34354"
FT                   /db_xref="InterPro:IPR010581"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK56"
FT                   /protein_id="ACP34354.1"
FT                   /translation="MKAFVFGIGGGGDIVSAIVVYTYLRKLGYNVLLGAVVWERYVEDP
FT                   IPGPICFDDLRNAILVNQGLYKVNKDTYAIRGSRQVVPQLVRAIRALELEGAYGICNKS
FT                   GAMGLYSSLKEFANTEKIDLIVGVDAGGDVLAKGCEETLGSPLIDFISLASLVKLEEDG
FT                   YNVMLGVIGSGSDGELQYDYFLKRISEIASLNGLLDIKGYDRETATLVERVLNEVNTEA
FT                   SKIPFEAFKGLYGEIPIRNGTRNVFVTPVSAIMFFLDPIKVAETSPLYSLVKDSSSIDD
FT                   ANKNLNEVGIYTEYNFEIDLYSQFGLNASHASAYDVSKIRAEGRRKLGGVKIKC"
FT   gene            163408..163950
FT                   /locus_tag="LS215_0200"
FT   CDS_pept        163408..163950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34355"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK57"
FT                   /protein_id="ACP34355.1"
FT                   /translation="MDLIRELKSEYGFDEDEINYALSRARGIIFGFAMEYRARRILQEM
FT                   DFENIKSVDMPTHDIEAEKNGIKYYVEVKASKKSPTREYSAYKVAMIALLDGVHLTLSM
FT                   IPKPNLLLTEEILSEPKRILYRFFKLAYMKQSEELKVFLENEKNREVLDSYSNVIRTIS
FT                   NRYHLPIALDLVNPFSS"
FT   gene            complement(163909..164478)
FT                   /locus_tag="LS215_0201"
FT   CDS_pept        complement(163909..164478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0201"
FT                   /product="KH type 1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34356"
FT                   /db_xref="GOA:C3MK58"
FT                   /db_xref="InterPro:IPR019964"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR039912"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK58"
FT                   /protein_id="ACP34356.1"
FT                   /translation="MIILFTTVEDEKLEVVKKIIEKLEQFTDTKIMYDERTKTFNILPK
FT                   GQNQYEALKAVSVIRAIGLGFDEQSAFRLLSDEYILDVIDLKTLIGSNPDAIRRVKGRI
FT                   IGEGGKAKRIIQEYTGVDISIYGHYIGIIGPYDQVQIARKAIELLIDGKEHSSVYKFLD
FT                   KAEKDLIIYKTSKLGRKGINEIKSNR"
FT   gene            complement(164475..165239)
FT                   /locus_tag="LS215_0202"
FT   CDS_pept        complement(164475..165239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0202"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34357"
FT                   /db_xref="GOA:C3MK59"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK59"
FT                   /protein_id="ACP34357.1"
FT                   /translation="MTELPKKTKDEKRRKDEDLFKVVDSTIDYRTYLNLIQIARRLNIE
FT                   EYLGAISSGKEARIYPAKTFDNKYYAVKIYYTSTAQSKRAIKKYTVGDIRFEDVKVTNT
FT                   KQLINTWAKKEFKNLSRLYEAGTRVPKPILVYENILVMGFIGENGLRAPLLKELNDEEI
FT                   TQELYDDLIQQVEIMTKRAKLVHGDLSEYNVMVYDNKCYIIDVSQAIPIDYEDAIMLLK
FT                   RDLDNINRFFEDKGINIKPTEELLIEFGVSGD"
FT   gene            complement(165243..165569)
FT                   /locus_tag="LS215_0203"
FT   CDS_pept        complement(165243..165569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0203"
FT                   /product="translation initiation factor eIF-1A"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34358"
FT                   /db_xref="GOA:C3MK60"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MK60"
FT                   /protein_id="ACP34358.1"
FT                   /translation="MPKKDRAQEAPSRDVPKPEEGQTICVVKKMLGGDHLVVLCMDGKE
FT                   RLARIPGKIRKKMWMREGDVVLVGIWDFQPNRCDILYKYGNDEIKRLVNENIISREVID
FT                   QLRG"
FT   gene            complement(165617..166831)
FT                   /locus_tag="LS215_0204"
FT   CDS_pept        complement(165617..166831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0204"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34359"
FT                   /db_xref="GOA:C3MK61"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK61"
FT                   /protein_id="ACP34359.1"
FT                   /translation="MNECIFSMPESVYIASAVRTPIGKFGGTLKNLSPVDLGSIVIREA
FT                   LRRAYVEPSKVDIAIMGNVLRAGHGQDIARQCAIRAGIPYEIDGFSVDMVCSSGMMSII
FT                   TASQMIKSGDADIIVAGGTESMSQAMFTIKSDIRWGVKMLMNRSIELIDTMLYDGLTDP
FT                   FLQKVMGQEADMVAKAHNISRKELDEVAYQSHLRAHKATVNGYFKSEIVEIKTDGKVVN
FT                   VDEGIRADTSLDKLSTLPPAFTDGGPHTAGNSSQISDGATALVLMSEKAIKELKIEPIA
FT                   RILGYSWVGIESWRFTEAPIFAIKKLLNKLNIDINHFDYFENNEAFAVNNVLVNRYLGI
FT                   PYDRLNVFGGAIALGHPIGASGARIIVTLLNVLSKMRGARGIASICHGIGGSTAVAIEL
FT                   LREMK"
FT   gene            complement(166846..168111)
FT                   /locus_tag="LS215_0205"
FT   CDS_pept        complement(166846..168111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0205"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number="1.3.1.74"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34360"
FT                   /db_xref="GOA:C3MK62"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK62"
FT                   /protein_id="ACP34360.1"
FT                   /translation="MKTIYVETYGCALNRADTYVMMTLLKSEGYNFVENPENADIIILN
FT                   TCAVRLETEERMKQRIKELNTLSKKLVVAGCMSSAEPATVLSIAPNASLIGPQSVERII
FT                   DVIKSEERKIVLEGDRALITPRTFDGKIAIIPVADGCAGNCSFCITKLARRKLRSYPLR
FT                   EIVNAARDAVKAGAKEIELTGQDTAAYGLDLGGSISLVDVVNKVTEIDGDFMIRIGMMT
FT                   PEQAMRIIDNLIEVMRNPKVYKFIHLPVQSGDDRVLKLMNRKYTIDEYKELVSEIRSKI
FT                   PFANITTDIIIGHPGEDEDAFNNTLLLMKELRFERIHLAMYSIRPNTRSASMPQVPDSV
FT                   KKKRIQIANKLYEDIALSIHLEYVGSTSRVITTELGRKGSVVGRLMNYIPVVIRSENVE
FT                   LGKWYNVKITEASFYDLRGVFA"
FT   gene            168156..168575
FT                   /locus_tag="LS215_0206"
FT   CDS_pept        168156..168575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0206"
FT                   /product="Translation initiation factor IF2/IF5"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34361"
FT                   /db_xref="GOA:C3MK63"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR004458"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MK63"
FT                   /protein_id="ACP34361.1"
FT                   /translation="MSSEKEYVEMLDRLYSKLPEKGRKEGTQALPNLIIFNIGNTTMIR
FT                   NFAEYCDRIRREDKICMKYLLKELAAPGNVDDKGELIIQGKFSSQVINTLMERFLKAYV
FT                   ECSTCKSLDTVLKKEKKSWYIVCLACGAQTPVKPL"
FT   gene            168572..168868
FT                   /locus_tag="LS215_0207"
FT   CDS_pept        168572..168868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0207"
FT                   /product="Protein of unknown function DUF424"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34362"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK64"
FT                   /protein_id="ACP34362.1"
FT                   /translation="MKVFLNIIRAQGMTLVNICQEELLGKVFREGEIILNVSEKFYGGE
FT                   SVELDYALSLIDEATVMSIVGNYAVEEAIRRGLVHKDSVINVAGVKFAQVYNV"
FT   gene            168874..169587
FT                   /locus_tag="LS215_0208"
FT   CDS_pept        168874..169587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0208"
FT                   /product="NMD3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34363"
FT                   /db_xref="GOA:C3MK65"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK65"
FT                   /protein_id="ACP34363.1"
FT                   /translation="MSGKFCVLCGKQNVELIDSLCADCYVKSKKLIEVPKRITGKYCKI
FT                   CGAQWIKGKWIRTSAISLSSVVEDIIIRELGNKIDIDKNVEEFAFDIKSIWKDPSGNSF
FT                   ATIEFRGNVRGKPFSQEAIISLEMERTLCDSCFRKKTRYYEAIVQLRSKGKIGIDDKKR
FT                   VFFESFFSTSIVDNISDVIEGREGVDYYFMSKSVARKLVSMISSIVDVEVNESYQNEKM
FT                   KNGKREAKLVISLRI"
FT   gene            169584..170222
FT                   /locus_tag="LS215_0209"
FT   CDS_pept        169584..170222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0209"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34364"
FT                   /db_xref="GOA:C3MK66"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020787"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK66"
FT                   /protein_id="ACP34364.1"
FT                   /translation="MRIGIDEAGRGALIGPMIVAGVAISDSKLKFLKGIGVKDSKQLTR
FT                   ERREKLFDIIASTVDAFTVVKVFPYEIDNYNLNDLTYDAVSKIILSLSVFNPEIVTVDK
FT                   VGEEKPVIELIRKLGYKSNVVHKADVLFVEASAASIIAKVIRDNYIDELKKVYGDFGSG
FT                   YPADPRTIKWLKSFYEKNPNPPPIVRRSWKILRSTAPLYYISKEGRRLW"
FT   gene            170216..171271
FT                   /locus_tag="LS215_0210"
FT   CDS_pept        170216..171271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0210"
FT                   /product="TGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34365"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK67"
FT                   /protein_id="ACP34365.1"
FT                   /translation="MVTNLPAEAKAKWLKVMDAKTPEEKFQALQEFLKEVPKHKGTENL
FT                   VYWAKRRMAELREEMEVRKSKKSGGFSLFVEKEGAGQAILIGDLLLRSLIMKKLTNVKQ
FT                   EFNELPVPGMVKYEDVQIQLVNPPKSLPLTKTIGLIRNADEVIIVVNNKEELSFMRNIL
FT                   EENNILLRKPKGRVIIERTRYGISGIRIVNLGKLVDVDEKAVRDYIESFGIKSAIVKII
FT                   GEVALDDIEKSMFEAVSYKPTVVISKERFDTGELPILSIDHMDKLPKLLFEMLEVIRIY
FT                   TKEPGEESTKDPLILKKGSTVLDVARKLHSSLAENFRYARVWGRSVKFQGQKVGSSHVL
FT                   EDKDIVEIHAK"
FT   gene            171321..173171
FT                   /locus_tag="LS215_0211"
FT   CDS_pept        171321..173171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0211"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34366"
FT                   /db_xref="GOA:C3MK68"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK68"
FT                   /protein_id="ACP34366.1"
FT                   /translation="MSIFNRRNNKQSLNNQGPSKIELLFYNSSIINGLVKSVDMKIKKA
FT                   GISQDPRLFASRLFLALILSIAISALLIAFSIRFFELYRLTLLTKYLAGFLTLIIFGVI
FT                   IPPVVYLMQILQLSQSTENRRIGLDSEAPAFAAVFNVFLRSGLSARYVFDYLSKSTAMR
FT                   YASQIASYVNKRVKYLGEGVESAIVESLNYSPSKVFNEFLITYVTAVRTGAPVLDTMEA
FT                   KTKDILKNIETLASTAAENLSGIAEGFVIWLSSGFITFFLVLLLQAIFPSLFGSVPFPI
FT                   MAIFAIIMIPLINLLFIWVVDQTQFRFPERSLKAYKVFYITFPLGIVISFIVLYLIKDP
FT                   IPLLLYLLFLNGGVQQIPLSVSTFTIGLLIAVIPPAVIAIRELREGTGYDVYVVSFLRA
FT                   VAEGLRAGLNPATVVKNLKDSPEMGKFRDILNTIYAYSLLGVPIKDAFKIASERILDFS
FT                   SRVSLISLADMIEIGSLTPETVESLAEQVDAQIRIRRNYNAKIRVLLYAPYIGIILALV
FT                   ASILLGNAMFTLISHQSYSLSYGPLSNATVILPKSLYVISISALFNSFLAGLLVGKLGY
FT                   GKTAAGFIHSAILVVITAILVVISLHISLIPSISPSSTSL"
FT   gene            173195..174928
FT                   /locus_tag="LS215_0212"
FT   CDS_pept        173195..174928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0212"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34367"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK69"
FT                   /protein_id="ACP34367.1"
FT                   /translation="MSKIFKSLLPKGKPTVKQLPIAELPITLYPVSPFPEEVTTIVADY
FT                   EVNILSLAPEDVKSNIVRNNIELVLPNPHIFITFDERKGIYKYVLLEPPINDTIYTMYN
FT                   IFIEEVERELLSKTPSLDLAKIIFELNKKRSNLNIIQEKRGDIHILSTNARVTLYYLLR
FT                   NMFGYNVLTSLVADKNIEDISVSGLNNPVYVYHRSYEYVPTNIMFTKNMQISPQLNITI
FT                   DGEELLDQLVLRMLSTTGKSISVAEPIQDGMLPNGDRIAATFRREVSASGSSVVIRRFS
FT                   ERPITILDLINSSTLSPELAAYLWYGMDLRMSIMSIGVTGAGKTTLLNAVLNLVKESMK
FT                   IVSIEDIPEIRLAHTNWVQLYARPAYAGVGKEISLMDLLKLSLRYRPDIIVVGEIRGQE
FT                   AYVLFQAISTGHGGATTFHAYNTDSAIKRLMNEPLNIPQEWIPMMNIMMTIRRLPVYVG
FT                   EKIVLRRRVVAVDEIVSWNDYRRVSSWDPKSDTFTINLDSARVLKNRIEEAGLSIDDVK
FT                   REMERRALFLKLLASSREIIQSEESYKLVKNYIIKYSLKPEEALKEVQSMAKTKAIELK
FT                   E"
FT   gene            complement(174909..176189)
FT                   /locus_tag="LS215_0213"
FT   CDS_pept        complement(174909..176189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0213"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34368"
FT                   /db_xref="GOA:C3MK70"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK70"
FT                   /protein_id="ACP34368.1"
FT                   /translation="MIREIFEILLFISSSITSLWILLQAFYYKVSNENLVQVLGNDRNK
FT                   SNEKIDIIVAIKDENERTIKELIDNLSELDYRPYGVIIISDDSLENFEKIMKVVDRIPE
FT                   NFVIIRRPENMGRKAGALNFAFNLSDGELLVFLDAEARVEKNFLRKISKLNYDAAAFRL
FT                   KVRDPVTPVQKIYSHTNEFVMNALFKAREKLGLIIFANGSAFAIRRDILRKVGGWKENS
FT                   VAEDLELGIRLALNGIRVKYVDDIVVYTLAPYTLTDLYNQIKRWAYGSGELLAYSMRLF
FT                   KLGVKGVEGFIYSQQWGLYPLYLLVFLIVISLQFTLNINYLYVFSSLIPILVSNGIYIT
FT                   LIKPKNEYRSGIVTVIASLIGYVQGVFKVRFKWKVTPKNHIVKEEEILSIKILGVILAI
FT                   MAYVNSLFNNTISSLLLILVSIILLIL"
FT   gene            complement(176186..176704)
FT                   /locus_tag="LS215_0214"
FT   CDS_pept        complement(176186..176704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0214"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34369"
FT                   /db_xref="GOA:C3MK71"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK71"
FT                   /protein_id="ACP34369.1"
FT                   /translation="MKLGPGKKAPDEVNVFIEIPMGSNIKYEYDEEGEVIKVDRVLYTS
FT                   MVYPFNYGFIPETLEEDGDPLDVLVLGNYSLMPGTVIEARPIGMIYMRDEEGEDAKVIA
FT                   VPRNKTDPSFSNINDVKDLPEATRNKIVHFFEHYKELEPNKWVKISGWGGVAEAKERIK
FT                   KAIDRKKQG"
FT   gene            complement(176732..177268)
FT                   /locus_tag="LS215_0215"
FT   CDS_pept        complement(176732..177268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0215"
FT                   /product="metal-dependent phosphohydrolase HD sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34370"
FT                   /db_xref="GOA:C3MK72"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK72"
FT                   /protein_id="ACP34370.1"
FT                   /translation="MKLERLLEGAKNLVRTGWMQNGIPSAMGETVASHSFEASVLAYVL
FT                   STELKRKGVEIDPEHSAVIALFHDAGETLLGDLPKWATNRINKREAEVEAFDELGIGKD
FT                   FFLELRELKTNEAKVAKLSDRLSTYLQGLRYKRIGFNVDEIISSYAEEIDKLLSIEPLN
FT                   QIRELVIKIMNSLNS"
FT   gene            complement(177286..178656)
FT                   /locus_tag="LS215_0216"
FT   CDS_pept        complement(177286..178656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0216"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34371"
FT                   /db_xref="GOA:C3MK73"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK73"
FT                   /protein_id="ACP34371.1"
FT                   /translation="MGSSWKYESEKAMIKPVGMTVAGLDTGNGAGGETDLRVFEVLGIH
FT                   GVFAITAITAQSTKGIKDINVVSSEFLKKQIETLLDDFNVEAVKMGMIYTKEQFQVVNE
FT                   LLHDSFLVVDPVLYAKDGTPLIKDVEDYKKIILPIAKVITPNIIEASAISGIKVEKESD
FT                   VVIACKKIRETYNIAHVIIKGGHSKGDFSFDYMCNEEGVYKIGYHRIQAKDTHGTGSVF
FT                   ATAFTAEYIKTKDVKLAFRKARDFVQSPIEYGLNIGKGVGPVNVSIEIMKKSMKYEVVE
FT                   EMRRFADFAENNEKFWILIPEVQSNLAHSIKPEYVRDLNDIATFRGRIIRRWDKKVIVG
FT                   HPVVFGNPTHTARMLLSIILKGMNSTCLMNIRYDDKIVESFKEIGYETVEINRELEPSH
FT                   GEGKTMQWIIEYISGEYVRIPNVIYDKGTKGKEAMIRFWTKNMEEMIEALDNLLKML"
FT   sig_peptide     complement(178507..178620)
FT                   /locus_tag="LS215_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.952 at
FT                   residue 38"
FT   gene            complement(178617..179312)
FT                   /locus_tag="LS215_0217"
FT   CDS_pept        complement(178617..179312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0217"
FT                   /product="MoaD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34372"
FT                   /db_xref="GOA:C3MK74"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK74"
FT                   /protein_id="ACP34372.1"
FT                   /translation="MKKVKVLYFAFIKDITHKSNEVLETECEDVGCLIEQLGKMYGNEL
FT                   VNFLKNGINGIKVSILVNGSASTKNIKDGDEVALLPPPSGGDLIIGKRFDLLEEIRKFR
FT                   EKAPSEAGSLVVYVGFVKGIVDNHKVLELRYEAYEEYTRKRFLEIKEEMKRKYSDLIDL
FT                   EIIHVIESMKPGENVLLIMALGKGRKDAIDAVKETLELVKHSTGIWKLEIRDDGEYWVV
FT                   AGNTRVKKQ"
FT   sig_peptide     complement(179226..179312)
FT                   /locus_tag="LS215_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.913 at
FT                   residue 29"
FT   gene            179350..179805
FT                   /locus_tag="LS215_0218"
FT   CDS_pept        179350..179805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34373"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK75"
FT                   /protein_id="ACP34373.1"
FT                   /translation="MSEDEIIDLIFNNQRDIRQGTAIRKENNEVLNKLNEIEKLLQYLI
FT                   KSKERGVQQNGSLCEQILSSAYVILDESIGNISRNYYIVELDSSRKFITFRDTIELLNF
FT                   YFSQNINEQDLEDKLPKRLVPLFRFMRRNGLIYFGYDEKRYFIVDYK"
FT   gene            complement(179796..182048)
FT                   /locus_tag="LS215_0219"
FT   CDS_pept        complement(179796..182048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0219"
FT                   /product="iron-sulfur protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34374"
FT                   /db_xref="GOA:C3MK76"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK76"
FT                   /protein_id="ACP34374.1"
FT                   /translation="MILDASIFSRAVIGGYDVKKIESRDKNELVVGRLTGLYGNVLKYA
FT                   NPKIIRAPDRFDDGSVFREVEGKNIFKIFEVPAGITFDKLIDELSKINYFPAIFPLYLK
FT                   GTVGGFTVLNGSGFGSYKFGFTKGKKTINELVDYKVVRILAVKYPELLETESENNFAWS
FT                   ALIYKDSVRYYIPSFYNKIINENFKSVSTNNLIKSLSIEIHNIFKRNYVPIVLMANYDK
FT                   NVEFNFDFKIGYIINYNSPERYKVLIGSLEETRLTELFEYLRRNPDVVPFPYLKEYEEI
FT                   HKDILKNFKKYEIRVRSRRINKNIVIEASKCINCSLCLDSCLAYNTTNNIIYSPLGRFN
FT                   RLFTGETNFEFCFGCASCQEACPVGINISNLMETLPQFNENKETVELEIDEVPRGIYEL
FT                   ENSLLSKYRNRPVFLLFVGCAAKYDPLGLEGFLNYLLTNGDKLPQELSPRVKLVTGICC
FT                   GFNDYLAGNLEGVKNSVEKINRLRIEQNAADIYFLCPEGLYIYNKFSEQKGIFAYEVIK
FT                   NELKDKEIHLGCWAKKFGYNSPYNECAGLFLTSYKGSPLKSTRKAFLTVCPFSTWKFGT
FT                   TSVYSLFLKKKEVVVKEEKVMIDENIIFDLLVKAVVSGLMASEDEVAEKVVMWSLGGSQ
FT                   YFLLLTIPIISKHISSELIRKLGSKPEVKEFLSKLSQDRPLLKQKISTYTDYLSSYNFS
FT                   NEINILRDEIAKSNKLDYSVKDLVKTNDFLNVLKEALKRSINENLIESTINNIIYL"
FT   gene            182033..182845
FT                   /locus_tag="LS215_0220"
FT   CDS_pept        182033..182845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0220"
FT                   /product="GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34375"
FT                   /db_xref="GOA:C3MK77"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK77"
FT                   /protein_id="ACP34375.1"
FT                   /translation="MRLKSQLLLVKIINNNFIVLGVEIKVPVSISGMWYPVIDRENLFE
FT                   SGSIGLTLTLEPYITAEIRGGSGIEFNGIEIKLPNYDILKKKLGEYRLSVYSEVPLGYG
FT                   YGLSGAISLAYALGVKELAPISEKDAVNVAHLSDVIAGNGLGDVIAQYYGGGLVYRKKA
FT                   GGLGYGEVEIINMDWSQYPIFSQPISHLPTKSIIKRSEIALKLIDEFLKNPSPLKFIEV
FT                   AQKFTSSLGFNSEYPYSYRKKGIIVKIFDPEYGVWIKHKIASRGAYVT"
FT   gene            182800..183600
FT                   /locus_tag="LS215_0221"
FT   CDS_pept        182800..183600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0221"
FT                   /product="Protein of unknown function DUF137"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34376"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK78"
FT                   /protein_id="ACP34376.1"
FT                   /translation="MDKAQDSKSWSIRDIIPENHPRRESLLIREKLIEAMGKSILVPQG
FT                   LIAHGRGECFDYLIGEKTQNFAEKAIEAAAATLLLAKTPVISINGNMAALVPEGLVRLA
FT                   EETNAKLEVNLFYRDERREKVIAEVLYKANAKEVLGVGEDASTVIPELFSQRRRVSPKG
FT                   IYIADVVLLGLEDGDRTEALVKMGKKVIAIDINPLSRTSRTATITIVDNIIRAVPRLVE
FT                   KAKELKSKNKEELEQIVLNYNNKNVLAESLKFIANRLTQLSLSL"
FT   gene            complement(183579..184382)
FT                   /locus_tag="LS215_0222"
FT   CDS_pept        complement(183579..184382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0222"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34377"
FT                   /db_xref="GOA:C3MK79"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MK79"
FT                   /protein_id="ACP34377.1"
FT                   /translation="MKKVTIRDFIKKKSTKEKITMLTAYDYPTAKIISNTGLDSILVGD
FT                   SLGMVVLGYANTLNVTMRDMISHTRAVARANPPQLIVADMPFLSYEIDTKSAIKNAGLL
FT                   VKAGSDAIKLEGGEEMKDTVKAIVKAGIPVMGHIGLTPQRFLRLGGFRTIGKTKQEEDQ
FT                   LIKDSLELEDAGVFSLVIENTYVDIAKRITEKLNIPTICIGAGPYCDGQVLVINDLLGL
FT                   SEFTPYFAKSYVNLKEIISNAINQYIIDVKNNKFPEKQHYKERES"
FT   gene            complement(184279..185013)
FT                   /locus_tag="LS215_0223"
FT   CDS_pept        complement(184279..185013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34378"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK80"
FT                   /protein_id="ACP34378.1"
FT                   /translation="MLLWLRNLLYAFEIIYKMIGTVKDRTLEALLKYGDKAKYVLKAII
FT                   EITEENENRELGDFSYKQLVEKLGEFGVNYDPRMILRALEKDFGIIETTYKSANQHWWK
FT                   FIDIEQTKLALNGEINNSEEDPEISLIIIQYNSLNPKEVEKKLLFLLKKPKLLDLDKKN
FT                   FMKFSFEILPLIVKLYYKASRHEETFEIAEKLKKIINLAKRISSRINNEKGDNKGLHKE
FT                   EINEGENYNVNSIRLPNGEDNI"
FT   gene            184907..185758
FT                   /locus_tag="LS215_0224"
FT   CDS_pept        184907..185758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0224"
FT                   /product="ABC transporter related"
FT                   /EC_number="3.6.3.30"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34379"
FT                   /db_xref="GOA:C3MK81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK81"
FT                   /protein_id="ACP34379.1"
FT                   /translation="MSPYLSKASNVLSLTVPIILYIISKAYNKFLSHNSISMTEKQFAV
FT                   SVTNLRKRIGNKDILKGLSFNVENGEVFGIVGPNGAGKTTTLRILSGIIKNFEGYVKIF
FT                   GLTPVEAKQKGYISYMPEDAFPYEKLTGYENLDFYAELYAKGDKQLKEKYLKLGVEISN
FT                   LGKRIYDKTAEYSRGMKRRLIIARTLMVMPKLSVLDEPTSALDVESAVRIRNIILDMAR
FT                   RYNMTIILSSHNMLEVEYLCDRITLINDGRVVASGKPEEIVKNTNSKNLEEAFIKLVFG
FT                   DQ"
FT   gene            185758..186948
FT                   /locus_tag="LS215_0225"
FT   CDS_pept        185758..186948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34380"
FT                   /db_xref="GOA:C3MK82"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK82"
FT                   /protein_id="ACP34380.1"
FT                   /translation="MLKTMIKKEIMDLRRDRKLLLGAIILPLILLPLIGIILYASIAVS
FT                   PPVIEIVNHNQSNLPYVQAVSHYITQNGGTVIYNDSNASIIPDVVIIFPNDFNINASNI
FT                   SKQASVYVKILISSNQEASNLVNNALGYLSYSLVYSRTEFLINSSNLQRVVNPSDILRP
FT                   LLVKNYVVTITGKNAPQSQANLSEIARMITLVLFPSATPVIFYVTDGIVGEKERRTLES
FT                   LLASPISINSFIFSKVIIAIILGVLSSLGDILGVVLFSSLMSFTFGLPLSLSTSFILIV
FT                   VLAYLLAVLLTAALSVVLLLALGGSMRNMQVINFLILSFGLIASFSALFINVANLQFPL
FT                   NLILLIPYEQLSLSLLYFVSGSTFISLSLLSGVLIVSVIILLVSSRLFNSERLLLK"
FT   gene            186981..187214
FT                   /locus_tag="LS215_0226"
FT   CDS_pept        186981..187214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0226"
FT                   /product="regulatory protein AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34381"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK83"
FT                   /protein_id="ACP34381.1"
FT                   /translation="MAEVVRAYILVSTTVGKEMEVADMAKKVSGVIRADPVYGEYDVVV
FT                   EVEAKSSDDLKKVIYEIRRNPNIIRTVTLIVM"
FT   gene            187594..187764
FT                   /pseudo
FT                   /locus_tag="LS215_0227"
FT   gene            complement(187878..188195)
FT                   /locus_tag="LS215_0228"
FT   CDS_pept        complement(187878..188195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0228"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34382"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK84"
FT                   /protein_id="ACP34382.1"
FT                   /translation="MPTIHLSLPEWMYDELKQKADELGIQMTDLVKLFIKKGLEGDFER
FT                   NEENEEKKENAKYDESIAFLEAKVAQLDSLLVEVLKKLQILEEEKDEEEEQVEVVDSNQ
FT                   S"
FT   gene            188345..188521
FT                   /locus_tag="LS215_0229"
FT   CDS_pept        188345..188521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0229"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34383"
FT                   /db_xref="GOA:C3MK85"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK85"
FT                   /protein_id="ACP34383.1"
FT                   /translation="MRVVTFKVEEDLLELLDRYAIKYGLNRSEAIRKAIEKMVRDELSK
FT                   ERVPVARVEKIKL"
FT   gene            complement(188518..189153)
FT                   /locus_tag="LS215_0230"
FT   CDS_pept        complement(188518..189153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34384"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK86"
FT                   /protein_id="ACP34384.1"
FT                   /translation="MVLKYFGHSCVLIDDKILIDPHDGGSIGLPKPDIKKVDLILITHD
FT                   HYDHNAYQIFEYKDLKMNFYGSLNYVNYTIKGIKSYHDKYNGKLRGQNSIYVIQKNDGE
FT                   KIVHLGDIGHLPDESIYKELYGANVLLIPIGGVITINYKEALEIIDKVSPKIIIPIHYW
FT                   IKGHYMPLDPPEEFLSNIKYEVRGIDLKNNLIDEKIEENKKLVYILSY"
FT   gene            complement(189162..190280)
FT                   /pseudo
FT                   /locus_tag="LS215_0231"
FT   gene            complement(190354..190983)
FT                   /locus_tag="LS215_0232"
FT   CDS_pept        complement(190354..190983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0232"
FT                   /product="protein of unknown function DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34385"
FT                   /db_xref="GOA:C3MK87"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR027510"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK87"
FT                   /protein_id="ACP34385.1"
FT                   /translation="MNFYKIVRSWFGFKERDDYISASILNYLVTKEYDESELRDIIKGR
FT                   EIAVVGASPQLDKINKIEEDVIIAADGATNYLINIGVIPDIVVTDLDGLQTFHKNPIYL
FT                   VLAHGDNISLLPKVKEMDKVIPNSQVMPFGRLRLYGGFTDGDRAVVLAKYMGARKVRLY
FT                   AMDFESGIIGKYSKPYYKRDVPASMIKRKKLEIARMIIEQVLNYDE"
FT   gene            complement(190980..191180)
FT                   /locus_tag="LS215_0233"
FT   CDS_pept        complement(190980..191180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34386"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK88"
FT                   /protein_id="ACP34386.1"
FT                   /translation="MNITIDLDSYTCSNDPLEAIEYLLHNNVIFKINLKNPYFETIKGK
FT                   YNIDIIKEEGDIIYFIVRSDG"
FT   gene            complement(191164..191556)
FT                   /locus_tag="LS215_0234"
FT   CDS_pept        complement(191164..191556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34387"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK89"
FT                   /protein_id="ACP34387.1"
FT                   /translation="MDKSLVAAEYLLRARRTLKEAQIAFEDGDLYYTVVRSLDTIENLA
FT                   RVLLALKDIFRYELLWNTTIMLNDESNIEKKLRDLELKLIPITLINESSLKTPTVIIRN
FT                   KEAEMLVDEITKILEEVEGIYDEYHD"
FT   gene            complement(191549..191926)
FT                   /locus_tag="LS215_0235"
FT   CDS_pept        complement(191549..191926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34388"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK90"
FT                   /protein_id="ACP34388.1"
FT                   /translation="MKLLLSVIEDLSSLFIEWYGDYVKKIIVGGKSFEKFDETEEVIYL
FT                   LVLDKVSKISLYARGEIFSFFYNKVKNKESTKNFILSHGDLPKIYGLILSPKELEYEIP
FT                   IIEYLNNHGKVLYSSEDEKNG"
FT   gene            191959..192462
FT                   /locus_tag="LS215_0236"
FT   CDS_pept        191959..192462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34389"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK91"
FT                   /protein_id="ACP34389.1"
FT                   /translation="MNENAESYLKERISITLPILNISVPCNTTCIMTSKYKHLLSIENF
FT                   KAQLEILDSLINLIEDKIYTLRYEIEDKFSHYKANINIDNLVYAIYKMIEEGGNMVLGE
FT                   KIYFGNKEVAYGEYTVLIGFHSLVEKIVKTDSNIRSLCDEIRYLSESTWEHFDKNIRRS
FT                   LNES"
FT   gene            192452..192868
FT                   /locus_tag="LS215_0237"
FT   CDS_pept        192452..192868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0237"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34390"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK92"
FT                   /protein_id="ACP34390.1"
FT                   /translation="MKVKVGIEGITMDSAHYTLSSYADSQIHGHTYIINVEVEGEVNEK
FT                   SGFVVDFNLLKKMVREVIQEWDHKLIIPKVDLDKSRFEGPFRVDYKVIDAPFPTAEYIG
FT                   IEIAKDIYLKLNKKYRILLKIYEGKDSYAIIEYP"
FT   gene            complement(192888..193331)
FT                   /locus_tag="LS215_0238"
FT   CDS_pept        complement(192888..193331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34391"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK93"
FT                   /protein_id="ACP34391.1"
FT                   /translation="MIISIPSMIRKEIDNITFVFSVIPPIITLKNADEDVKDFLLKLSK
FT                   SFRIDIACGNRDKKLCYPAIFGGVFVFDNDLIIKRYEIYGYLCNGEEESVKNINQLFKQ
FT                   LEQGKEWCFRFDDNSILCFKKRKESKECRWIDNIGLRFLIFSS"
FT   gene            complement(193288..194787)
FT                   /locus_tag="LS215_0239"
FT   CDS_pept        complement(193288..194787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0239"
FT                   /product="dihydropteroate synthase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34392"
FT                   /db_xref="GOA:C3MK94"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR005236"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK94"
FT                   /protein_id="ACP34392.1"
FT                   /translation="MKVLVVTGTLAAPILSEVAKNIKDTKVEIKVLNYPVASLMSTKFI
FT                   AENLKQTKYDVDYILLPGMVYGDAKIVEEVTGVKTFKGTEEAWDLPRVIEALKNGVQLS
FT                   TTEPADKIIGKMDNIEEKLRKIEEEAKISFEINGVKITNYPPPFRIFLEIDNKQEFEKL
FT                   ERLRRNINVVVLGLPVGHYDLDEVKNKVRQLVDYGHVVGIDAESPRELKEGVRAGASFV
FT                   FNLNETNLEELEEIRREAAFVVAPFNTENRGEITVDLVRKAKQKGFDKLIADPVLSPPL
FT                   RGLVNSIIEYKYVREKLQDIPILMGILNVTELIDADSLGVNALLSAIAGELGISNLLIM
FT                   EKGKTKWSSWELSQATKMISIALKENRLPKDIGIDLLVLKDKRIFRENFGADVIVNEYI
FT                   EPEMDKSGFAKIFVSEDGFGVKWIGKNKVTIKGKNGLSIGRELIRRVKDISKEHAVYIG
FT                   YELAKAEIAYQLDKNYIQDKPLFKKIINDNFHTEHDKKRDR"
FT   gene            194880..195851
FT                   /locus_tag="LS215_0240"
FT   CDS_pept        194880..195851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0240"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34393"
FT                   /db_xref="GOA:C3MK95"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK95"
FT                   /protein_id="ACP34393.1"
FT                   /translation="MSLLPRTASVKPGERFDVIIVGLGPAAYGAALYTARYMLKTLVIG
FT                   ETPGGQLTEASIVDDYLGLIEIQASDMIKVFNKHIEKYEVPVLLDIVEKIENSGDGFVV
FT                   KTKRKGEFKADSVILGIGVKRRKLGVLGEQEFVGKGISYCSVCDAPLFKNRVVAVVGGG
FT                   DSALEGAEILSSYSTKVYLIHRRDSFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVV
FT                   RQLVVENLKTGEIKELNVNGVFVEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPG
FT                   IFAAGDCTSMWLGFRQVITSVAQGAVAATSAYRYVTEKKGKK"
FT   gene            195848..196642
FT                   /locus_tag="LS215_0241"
FT   CDS_pept        195848..196642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0241"
FT                   /product="inositol monophosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34394"
FT                   /db_xref="GOA:C3MK96"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK96"
FT                   /protein_id="ACP34394.1"
FT                   /translation="MIDLLNKIAISATKYLNEIKDEKDLDKVVGFHSGDTTRVIDKKSE
FT                   EYIFQLLNDTGLKFKFVSEESGVIIPSNGYDYVALIDPLDGSNNFVLGVPWYSISVSIY
FT                   SKSAKGLLDSLGGFVSHISIDKIYSYDISTAYVNGSPLKIEMIGNSPSNVVITYFDERG
FT                   IDKTLKILSVLKGYKVRSFGSASLDMILTCMGKAGLYFDIRGKLRNVDIAASANFCKRL
FT                   NSIPSTLNGKEISSGIDDIYKIEEIIMSRDQSLIKNVYSIFS"
FT   gene            complement(196590..198410)
FT                   /locus_tag="LS215_0242"
FT   CDS_pept        complement(196590..198410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0242"
FT                   /product="Microtubule-severing ATPase"
FT                   /EC_number="3.6.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34395"
FT                   /db_xref="GOA:C3MK97"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK97"
FT                   /protein_id="ACP34395.1"
FT                   /translation="MIEPVLNLAIIFISLAVLIIILMKIFGKSTAKFAYSDKALQLQNK
FT                   SQKKKVEVEDKKITWNDIGGYEDAKKEIKEYIELPLKNRDIAMKYGLKPPKGMLLFGPP
FT                   GCGKTMMMRALANESKLNFLYVNISDIMSKWYGESEARLRELFNNARKNSPCILFFDEI
FT                   DTIGVKRESHTGDSVTPRLLSLMLSEIDGLHSEDGVIVVGSTNVPQMLDKALLRAGRFD
FT                   KLIYIGPPNKEARKQILQIHCKGKPLAEDVDFDKLAEITERYSGADLANLCQEAARKVA
FT                   SEAIEKGADRKITMADFIELIKKYKPSITLQMIEDYEKFRLDFERRVRKGEEENELGEK
FT                   LTLNDIGGYNEIKTELKELLELQLYHYKLLEQLKVPPIRGILLYGPPGVGKTMMAKALA
FT                   KTLNVKLIALSGAEIMYKGYEGAIAAIKEVFNRARENKPAIVLLDELDAIASKRNYKSY
FT                   TDSSRIVNQLLTEMDGIRSLKEVVVIGTTNRLKAIDPALLRPGRFDKIIHMPLPNREER
FT                   LDILMKYIGKEECEKVDCGILAEQTEGYSGADLSALAREAKMKVLKSILRGESNRTLTK
FT                   EDLIDALNKIHPSVKKRLSKHSLSNSDRET"
FT   gene            complement(198492..200048)
FT                   /locus_tag="LS215_0243"
FT   CDS_pept        complement(198492..200048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0243"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34396"
FT                   /db_xref="GOA:C3MK98"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK98"
FT                   /protein_id="ACP34396.1"
FT                   /translation="MIDVAIIGGGHNGLVTAAYLAKAGLKVAVFERREIVGGASITEEL
FT                   WPGIKVSTGAYVLSLLRPKIIEELKLREFGLKVYLKDPGLFLPFENGKKLYIWLSLEKT
FT                   KKEIEKFSKKDAKNYEKWVKFWDVFAEIADFLMLNPPPHIDEAKNLLEMFKGNVNEELA
FT                   LSFLRTFMQDAKSLLDEYFETDEVKSALAEDSVVGTFASPSTPGTAYVLAHHVIGEVNG
FT                   VKGAWGYVEGGMGGVTQALKRSAEYLGAEIYTNAEVDEILVKNGKVEGIKLKNGKIINA
FT                   KIVVSNADPKTTFFKLLRNANLEEDFIRRVKALKNVGVSFKIVGYLEELPDFGNGKSLS
FT                   PEHVASELIMPNMKYIEKAYDDARTLGYSKEPWLSINIQSSVDPTVAPQGKFSFSIFGQ
FT                   YLVYDSKKNDEMKDRIAEITFEKIREFAPNFRPIRYEVLTPLDIERRFGISGGNIFHLD
FT                   MTPDQLYFFRPLIGYSDYTTPIKGLYLCGSGTHPGGGVTGAPGYNAHIKILEDLRKDIY
FT                   K"
FT   gene            200169..201344
FT                   /locus_tag="LS215_0244"
FT   CDS_pept        200169..201344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0244"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34397"
FT                   /db_xref="GOA:C3MK99"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C3MK99"
FT                   /protein_id="ACP34397.1"
FT                   /translation="MAVANTVMGNIDINLKINTYNLIANMDLILPDYYGENIYTLSCFI
FT                   AEYLGVQRQCLNKMNLNVNSKLVLALFDGLGWNIFNRTGINLQATKITSVFPSTTSTVL
FT                   TTLFTASTPGEHGVLGYNTFSKRLGGIVNTLRYTYPTVSDRDSIRDSVPFSSSFPYVKG
FT                   YLKEVQGKKAISLVPKGIENTEFSNATHGASGESKTYVNFWDAFYQLSQILQQDAYDFI
FT                   YFYVPDVDTLSHKYGPYTDPTIKSARDILISILEISEKHKKYSFIITADHGHVPVSETI
FT                   LFNNDQDLLNMLDVPPYGDSRAIFLRTRYDVSIYLSRKYGSLKIFGKSDLERLLGKIKD
FT                   ISAFPDYIAVPTDYRAFIFNFKEKDDYDKLKGHHGGLLQEEFEIPLVILNG"
FT   gene            201337..201876
FT                   /locus_tag="LS215_0245"
FT   CDS_pept        201337..201876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0245"
FT                   /product="phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34398"
FT                   /db_xref="GOA:C3MKA0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKA0"
FT                   /protein_id="ACP34398.1"
FT                   /translation="MVEYHIPSWDEIEDAVFSIGEALVKNNYIPDVLVAVLTGGIVPAK
FT                   LLSDLLDLKVIRYIDIKFYRSVGKTESRPVIRSVYTDSLEGKKVLVIDDVADTGETLEA
FT                   VSNVITMFNPAKVMTATLYLKPWSKRVPDFYYKQIDKWIIFPWDKWDVVRENNDVPVNK
FT                   KERFFDLYNQLLKIRK"
FT   gene            complement(201866..203527)
FT                   /locus_tag="LS215_0246"
FT   CDS_pept        complement(201866..203527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0246"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34399"
FT                   /db_xref="GOA:C3MKA1"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKA1"
FT                   /protein_id="ACP34399.1"
FT                   /translation="MDIEDRIKEWEETVYLSWVKKRGERKKEFKTFSGIHIKPVYTPLD
FT                   VKGNYMEKLGLPGEYPFTRGIYPNMYRGRIWTIRQYAGFGSAEETNSRFRKLLEAGQTG
FT                   LSMAFDLPTQLGLDPDHELAYTEVGVVGVSMFHWKEMDMVMSGIPLDKVSTSMTINATA
FT                   MELLSMLIATTESRNINKNVLDGTVQNDILKEYIARKNFIYPPSPSMRYAIDIIEYSAK
FT                   YLPKWHPISISGYHIREAGADAVLEVAFTLADGMEYVRKTMERGINVDEFAPHLSFFFA
FT                   AYSDIFEEVAKFRAARRMWAKIMKEMFNAKKLESMMLRFHTQTGGAELTAQQPEINIIR
FT                   TTLQALAAVLGGTQSLHVNSYDEALALPTEKAAKIAIRVQQIIANESGAADIVDPLGGS
FT                   YYIEWLTDEIEERAWKIIDQVEKMGGMIKAIENGYPQAQIAESAYRIQKRIEESDLGKV
FT                   GVNMYYEPEWIGTTEIFRVNPEVRERVISRLKKYKQERDGMKVRDSLNNLRKAAEKENE
FT                   NLFPYMIDALRVGATVGETSSVLRDIWGEYKEPSIF"
FT   gene            203607..204035
FT                   /locus_tag="LS215_0247"
FT   CDS_pept        203607..204035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0247"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /EC_number="5.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34400"
FT                   /db_xref="GOA:C3MKA2"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKA2"
FT                   /protein_id="ACP34400.1"
FT                   /translation="MLVENLDHIGIVVEDIDQAIKFYQNTFGMKLIHQELIPERGIKVA
FT                   FLVGEEENETSIELLEPIDHNDMNNTVAKFLKNRGQGLHHLAVKVSDINKALEELTAKG
FT                   LQLVDSAPRKGARGHLVAFVHPKSIMGVLLELVQPKEL"
FT   gene            204108..204638
FT                   /locus_tag="LS215_0248"
FT   CDS_pept        204108..204638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0248"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34401"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKA3"
FT                   /protein_id="ACP34401.1"
FT                   /translation="MPKKEEKDIFDLMDEWIREMEEEFEKIEREFMRGFRGKGEEVKQF
FT                   GPYVYGFRITVGPDGVPKIEEFGNVRKIRGKPMISEEREPLADVIEKGDEIKVVAEVPG
FT                   VNKEDIKVKVTNGGKKLVITAKSEGRQYYKEIDLPAEVDEKSAKANFKNGVLEITLKKK
FT                   SPSSDSGVEIKVE"
FT   gene            complement(204654..205172)
FT                   /locus_tag="LS215_0249"
FT   CDS_pept        complement(204654..205172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0249"
FT                   /product="ZPR1-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34402"
FT                   /db_xref="GOA:C3MKA4"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR004470"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKA4"
FT                   /protein_id="ACP34402.1"
FT                   /translation="MSEGPKVIFEETLLCPVCKSKTFKAIDYLYDTPHAGKLILSNWYC
FT                   ENCGYRFRDVKPYESREPKVIEMRIENENDLRTIIYRSAFAKITIPELGIEIEPAGMSQ
FT                   GYISTIEGVLEIILDKVGDFCDKECENKIRLAMEGKIKFTLVLEDELGLSFIKSEKATI
FT                   KPLILTNSD"
FT   gene            205241..206812
FT                   /locus_tag="LS215_0250"
FT   CDS_pept        205241..206812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0250"
FT                   /product="protein synthesis factor GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34403"
FT                   /db_xref="GOA:C3MKA5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035531"
FT                   /db_xref="InterPro:IPR039263"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKA5"
FT                   /protein_id="ACP34403.1"
FT                   /translation="MKLPRENEIGKVEYKLILSGVTPERLQELASQMKYRLEEGDGEAF
FT                   YVIGVSNEGEIIGLSKSELEESISTLDMIAKLVNAKIVYRRDVEVRKDKYVAELLVRRY
FT                   KENLPVEVNVAVMGHVNAGKSTVTGALVLGRLDDGNGGLRTAIARHLHEVLSGRTSSIT
FT                   LRLIGFDDSGKIVNWQLKDPLDEAETTIKSTKIVRLIDLGGHERYLRTTLKGLLGYEVN
FT                   YVMLVVGADDGLSIMGKEHLALASILKFPIFVVITKVEKYPEDRIKGIVNDIKNVLKIP
FT                   GINRLALEVEDEDDVVNSILAIKTKRVVPIFRISNVSGKGLDLLIKFLNLLPPEAKNLD
FT                   EKETPLVYIDEAYNVTGVGTVVLGSVVRGKLRSNESVLIGPNKLGEFKEVKIKSIQVNK
FT                   VFVDSVLAGNIATFAIQGIEKESLRKGMVMVKGIPKVVRRFKARVFILHHPTTIREGYV
FT                   ATLHSYTIRQAIKFERIQSGFLRTGDTSEIVLHFLYRPEYLERGQIFVFREGRTRGVGI
FT                   VLEPIG"
FT   gene            complement(206802..207209)
FT                   /locus_tag="LS215_0251"
FT   CDS_pept        complement(206802..207209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0251"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34404"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKA6"
FT                   /protein_id="ACP34404.1"
FT                   /translation="MTKTEGEIVIKDPNKAKQFFSDYKNLLTCIPGVKEINGNSFKAYV
FT                   KFSFLTIEINGTVKKHEINGDNIDTLITIEGPGIIANINTLLTILGNKIKWSSDYEVGG
FT                   PLANSLKKHIGSQAEEISKQIIECSVGKINQ"
FT   gene            complement(207206..207625)
FT                   /locus_tag="LS215_0252"
FT   CDS_pept        complement(207206..207625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0252"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34405"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKA7"
FT                   /protein_id="ACP34405.1"
FT                   /translation="MKYEGSISLNATKDQILKLLDNPDQVAQCFPGIKSFTKEGEEYKV
FT                   VGVTGIGFIKGEYKANVRFEKIDENKRKIIAKGTGMNSNVDIDAIAEALDGKINYSADV
FT                   KVAGVLASVGARLMGSALEKIINDLFNCIKERVIK"
FT   sig_peptide     complement(207548..207625)
FT                   /locus_tag="LS215_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.549 at
FT                   residue 26"
FT   gene            207652..208221
FT                   /locus_tag="LS215_0253"
FT   CDS_pept        207652..208221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0253"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34406"
FT                   /db_xref="GOA:C3MKA8"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKA8"
FT                   /protein_id="ACP34406.1"
FT                   /translation="MNIGVIILAAGEGKRFGGDKLFAKIDNIPIIMRTIGIYEDLEKVI
FT                   IVGKYVNELLPLLMDQIVIYNPFWKEGISTSIKLGLRFFKDYDAVLVALGDMPFVTKDD
FT                   VDKIINAFKPSCKAVIPTHKGEKGNPVLISKSLFGEIEKLRGDLGAKVILNKMGMEELC
FT                   FVECSEGVLIDIDKKEDLMRLGNFHP"
FT   gene            complement(208192..208698)
FT                   /locus_tag="LS215_0254"
FT   CDS_pept        complement(208192..208698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0254"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34407"
FT                   /db_xref="GOA:C3MKA9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKA9"
FT                   /protein_id="ACP34407.1"
FT                   /translation="MKVFEKDQKVKVHLKVNEQNYEVETEPRRLLVHVLRELGFTGVHV
FT                   GCDTSNCGACTVIMDGKSVKSCTILAVEADGSEILTIEGLAKDGKLHPIQEAFWEKHGL
FT                   QCGYCTPGMIMEAYWLLKENPNPTEEEIREGISGNLCRCTGYQNIVEAVKLASQKLRME
FT                   IPKAH"
FT   gene            complement(208704..209540)
FT                   /locus_tag="LS215_0255"
FT   CDS_pept        complement(208704..209540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0255"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34408"
FT                   /db_xref="GOA:C3MKB0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKB0"
FT                   /protein_id="ACP34408.1"
FT                   /translation="MYPPKFSYVIPDNVKEALEFLESHDDAKPLAGGHSLIPMLKLRIF
FT                   RPSYLVEIRRLPELKYIKTEGNVVKIGPVVTHYDIMKANIPLLSETASKIADPQVRNMG
FT                   TIGGSISHLDPSADYPAALIAMDAKVRIKSTKGERVESFSSFAKDMFTPDLNPGELVAE
FT                   IEVPLLKDYKFSYQKLERRAGDFAIVGVAVALKVNGDVIQDARIGLTAVNKTAVRASEA
FT                   EKILLSGKISEKLIEEAATKAMDYANPTSDIRGSAEYKKKMVKVMTKRAILAALNR"
FT   gene            complement(209630..209764)
FT                   /locus_tag="LS215_0256"
FT   CDS_pept        complement(209630..209764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0256"
FT                   /product="TRASH transcription regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34409"
FT                   /db_xref="GOA:C3MKB1"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKB1"
FT                   /protein_id="ACP34409.1"
FT                   /translation="MKCNVCGDEIRGKPYSFNYKGNMYYFCSPMCMAEFKKRSEKYVK"
FT   gene            complement(209770..210498)
FT                   /locus_tag="LS215_0257"
FT   CDS_pept        complement(209770..210498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0257"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34410"
FT                   /db_xref="GOA:C3MKB2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKB2"
FT                   /protein_id="ACP34410.1"
FT                   /translation="MSGKVYLVGAGPGDPELITVKGLKILQKADVVVYDRLIPKELLNF
FT                   CKVEAEKIYVGKNIGDYVIQDEINELLVKKAMESKIVVRLKGGDPYVLGRGEEECLFVI
FT                   SKGIECEVIPGITSATAVPAYAGIPVTSRIYSASGFTVISGTKAEDKVIDEDYIPRKGT
FT                   LVILMGLRKIENIVNIIIKLRNEREPVAVIENGTTENQRVFTGELKDLVGIIKNNNVTS
FT                   PVIIVIGEVVKFREYLWKFK"
FT   gene            complement(210498..211085)
FT                   /locus_tag="LS215_0258"
FT   CDS_pept        complement(210498..211085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34411"
FT                   /db_xref="GOA:C3MKB3"
FT                   /db_xref="InterPro:IPR009844"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKB3"
FT                   /protein_id="ACP34411.1"
FT                   /translation="MDLVQIAKYIGFSLLIVSIILYVFVDPVDRLLSYQGPILSGALLG
FT                   WYVLISNTPRDKFIETEGEKIPIVSILIRKRAPLFMAIGSLLIIPWLMPQIYPMVLEIQ
FT                   WLFVLSFLSEFLGGFMIGYIVPSLKFTEKLLLFSLGFAGDTIYLLLLYLASGIFHVPSQ
FT                   LLLNSVIVLVYGIKFPEGVVFAVYIMKKIGGI"
FT   gene            complement(211085..211324)
FT                   /locus_tag="LS215_0259"
FT   CDS_pept        complement(211085..211324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34412"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKB4"
FT                   /protein_id="ACP34412.1"
FT                   /translation="MEELDLTKAESGCGANSASVRLLKFWLEVGGNREIKVIAQKGSQE
FT                   EQVNMWIGLMSEKGVKLVDKKDEKDKIVYTIFLP"
FT   gene            complement(211326..212153)
FT                   /locus_tag="LS215_0260"
FT   CDS_pept        complement(211326..212153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0260"
FT                   /product="sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34413"
FT                   /db_xref="GOA:C3MKB5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKB5"
FT                   /protein_id="ACP34413.1"
FT                   /translation="MYADLIEREITQDYKVNVDLKLDNAYIVGAGDSYAVALTIESKTN
FT                   GRFKALDPFEGLFYENLDRPLVIVSVSGRPKSNILLARKFKGKTKLYVITANEESQLAK
FT                   FADYLILIPYKSSQPLPGTLSFLMSLSAIYSLAGEKGDDIKESDRSLNLTNNPFFIGYK
FT                   EGYGIAYYAMLKFAEIFGYTTNSERFEQFYHSPIFMTENRQIILFRIGNEREIELINSV
FT                   DYTDIQFTNCNGAFCNAIILIKSIVNKMRKEKWDKIYFLENKKILNVSSKMIY"
FT   gene            212199..213350
FT                   /locus_tag="LS215_0261"
FT   CDS_pept        212199..213350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0261"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34414"
FT                   /db_xref="GOA:C3MKB6"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKB6"
FT                   /protein_id="ACP34414.1"
FT                   /translation="MKVLIKSDLVLGAPKPLRDVYIGIDEGQIKVISKEQPEDYDYAEY
FT                   VIGGKNRVVAPGFVTTHSFLYLYPFRYRIFSGKANAFQLMSTLTPNDIYYFSLMGAYHL
FT                   LKTGVTTVVTSGPNLDMTARAISEVGLRPVLAVGVDCPDSKEDWEREFTTLYNRWSNKN
FT                   ENRVILRLCSNEYSKEVFELSQQYNFPVLLERFVSLENINGKPVNVIGLGGGARKDLDI
FT                   INQKGFHLASTPSYEVSQFPLSQYKPSISLDLSPTFDIRHEISTTITKLILTPEEALNA
FT                   MTVWGQLQLKYNDRGVLENGKVADLVVFEVKEPPTFPLDYESPYESIVFNLSTPETVLV
FT                   GGEAVLDGGVPLNIGIKHIEKAIERLEGIDKKVAKPARYMEKD"
FT   gene            213304..214083
FT                   /locus_tag="LS215_0262"
FT   CDS_pept        213304..214083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0262"
FT                   /product="protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34415"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKB7"
FT                   /protein_id="ACP34415.1"
FT                   /translation="MIKRLQNQQDIWKRIEIVGDIVIIGIPFNKRSEDLIEIANEILLT
FT                   FPYIKSVWGRYRDISGTYRLSTYVYLAGEKRSETIYKEHKCKYFLDFTKVFFSEKLSYE
FT                   HLRVARQVKRGEIIINMFSGFGPFSILSAVLGKPKVIYSIDANPYAYYYMMVNVELNRA
FT                   YEVLPMYGDAFKRVYDLEDADRIIAPLPELADKAYEVALQKVKKGGTIHLYTEVETNRG
FT                   EDPVGIAMNKYKGSYFGRIVRSVNPHKYHVVVDIKVT"
FT   gene            214412..215689
FT                   /locus_tag="LS215_0263"
FT   CDS_pept        214412..215689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0263"
FT                   /product="glutamine synthetase catalytic region"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34416"
FT                   /db_xref="GOA:C3MKB8"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKB8"
FT                   /protein_id="ACP34416.1"
FT                   /translation="MSKENIFDALKSGKIDYVRVEFVDILGNTKGRSLRRAEFENVINN
FT                   NKGVDYPESLALMDYKDRPIKSKYEDIIAIPDLNTFVAIPYLERTARVLSFLVQPEGLS
FT                   YPYCSRSILNKAIEKLKEAGYTLQVSFEPTFYLLNSSLNPADYSKAFSLEGLLEQQNFL
FT                   KLLIKYLEEIDIQVETINKHYGPGQYEVKLSQKSVLEAADSLISSREVIRDTAKMNNVI
FT                   ATFMPKPFKDYPSSSMDITLSLQTTDGKDIMYDPNDAKGIGLSKIAYNFISGILEHLPS
FT                   ILSIAAPTVNSYKRFKEVVTPNMPGIGTERHYIVRIPSYYKDTRQVEFRLADPLANPYI
FT                   LLASIIYAGLDGIERNLMVNINEYYGNLPQTLKESLSRLENDIYMKYNLGQDLITTYIN
FT                   IKNIEIEEYESEITEWEKEYYLKAGW"
FT   gene            215690..216676
FT                   /locus_tag="LS215_0264"
FT   CDS_pept        215690..216676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0264"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34417"
FT                   /db_xref="GOA:C3MKB9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKB9"
FT                   /protein_id="ACP34417.1"
FT                   /translation="MLAAILRSFGEELSLEDVREPSNGIILKVLATGLCHGDLHVMNGD
FT                   WKYEIKIELPKILGHEIVGEVVKGNHNFKEGDKVLVYNSVGCGKCKYCVSRKYQYCEKV
FT                   KIVGLNIDGGFAEYVSVPTDNILLRVDGNPVELAPLADAGITAYSSTKGIGEGDNVLII
FT                   GTGAVALLALQILKLKGARITVIGRNKNKLGKAKEIGADEVIDIQDGSTIASEIKESKF
FT                   DYIIDYVGSDYTLSDSMWLLNREGELRIVGEFGGTLTVPEQLLVLKGLKVRGILFGSFD
FT                   DLISVYKLYNEGKIRPIVNTYRLRDINKSIKGLREGKVIGRAVIVPP"
FT   gene            complement(216673..216912)
FT                   /locus_tag="LS215_0265"
FT   CDS_pept        complement(216673..216912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0265"
FT                   /product="50S ribosomal protein L13e"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34418"
FT                   /db_xref="GOA:C3MKC0"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MKC0"
FT                   /protein_id="ACP34418.1"
FT                   /translation="MEFPKALIKRPNYHFEYPHKRKDKRIGRGFSIGELEKAGLNINNA
FT                   RKLGIIVDIRRKSVHEENVEVLKKFLEQLPNQKS"
FT   gene            complement(216945..217958)
FT                   /locus_tag="LS215_0266"
FT   CDS_pept        complement(216945..217958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0266"
FT                   /product="RNA 3'-phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34419"
FT                   /db_xref="GOA:C3MKC1"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MKC1"
FT                   /protein_id="ACP34419.1"
FT                   /translation="MIEIDGSFGEGGGQILRTSLTLSVITGKPFRIFNIRANRPNPGLQ
FT                   RQHLWAVKAMKMISNAETKGDEVGSKELIFVPHEIKGNTNIDIDVGTAGSVTLIIQTVL
FT                   PAIINKNVRIRIKGGTDVPKSPTIDYIRLVYLEILRKIGIEAKLNLIKRGHYPEGGGEV
FT                   IIENVNGNPSAFSLLELGKLTIIKGISHVSSLPAHIAERQMNSAREILSKLGVPIEIET
FT                   DVRQGEVSKGSGIALAAIGEKSIIGADSLGERGKRAEIVGEEAARILINNLNTKASVDI
FT                   HMSDMLMIFASLYGGEYIGAELTSHAYTNMEIIKKFLDIKIDVSGKRPFRFKAKIF"
FT   gene            217972..218415
FT                   /locus_tag="LS215_0267"
FT   CDS_pept        217972..218415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34420"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKC2"
FT                   /protein_id="ACP34420.1"
FT                   /translation="MKIKLKSLAKVVGEEELAVIPLAENEYFIECLNFYEDVEGGRQAR
FT                   LVVIVDKYGIIRQDQVNFIKGKKTFVDAIGIEDDFRKIQSVLKLDRIARMFKVPLYFDV
FT                   EIIEKPDVSKRGIKGFYNYLSVHKEIDMSKLKGLVSLSIEELV"
FT   gene            complement(218392..219450)
FT                   /locus_tag="LS215_0268"
FT   CDS_pept        complement(218392..219450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0268"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34421"
FT                   /db_xref="GOA:C3MKC3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKC3"
FT                   /protein_id="ACP34421.1"
FT                   /translation="MIILFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVAT
FT                   ANYEARKFGIKAGIPIVEAKKILPNAVYLPMRKEVYQQVSNRIMKLLREYSEKIEIASI
FT                   DEAYLDISDKVKNYQDAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKPNGI
FT                   KVIDDEEVKRLIVELDIADIPGIGDITAEKLKKLGVNKLVDTLRIEFDELKGIIGEAKA
FT                   KYLFSLARDEYNEPIRARVRKSIGRIVTMKRNSRDLEEIKPYLFRAIEEAYYKLDKKIP
FT                   KAIHVVAVTEDLDIVSRGRTFTHGISKETAYREAVRLLQKILEEDERKIRRIGVRFSKF
FT                   IEAIGLDKFFDT"
FT   gene            complement(219447..220298)
FT                   /locus_tag="LS215_0269"
FT   CDS_pept        complement(219447..220298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0269"
FT                   /product="PfkB domain protein"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34422"
FT                   /db_xref="GOA:C3MKC4"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKC4"
FT                   /protein_id="ACP34422.1"
FT                   /translation="MIHLAVGRFNIDIIVKLDSIPPIDSSHMTDVLEIMPGGAATNYAV
FT                   AVTKLGHSAKLLAKVGKSEVVRSLMEKVVELGVGLEYVEELNEKPSATLIFLRSDGTLS
FT                   MVRRLGASILLTREDVKRRFGLFDVIHFASVSPNVVVRDPYAKLVSYDPGPQAKNIESI
FT                   DVDILYINEKEYEMIEGKNIKARFIVIKMGKKGAKIITETEECSVEPVQVEKVVDTTGA
FT                   GDTFDAAFNVTYSEEKDIIKSLQVASVASGLKVTKIGGISSPTLEEVREYLRKKKPNVI
FT                   CK"
FT   gene            220574..221932
FT                   /locus_tag="LS215_0270"
FT   CDS_pept        220574..221932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0270"
FT                   /product="TIP49 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34423"
FT                   /db_xref="GOA:C3MKC5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKC5"
FT                   /protein_id="ACP34423.1"
FT                   /translation="MSEIRELKKPIREKASIHSHIKGLGLDDNGKAKFIADGLVGQAEA
FT                   REAAGVVVQLIKQGKMSGKGILFVGPPGTGKTALAVAIARELGEDTPFTAINASEIYST
FT                   ELKKTEILTQLIRKSIGVRIREKRLVYEGVVKDRKIKVARSRLNPYSQAPVEAQITLTT
FT                   KDDERTLSVGEEIAQQLVSLGVKKGDVIMIDAQTGQVIVEGKAKGFEGAKTYDIETTKV
FT                   LEIPTGPVRKEKEITTTLTLNDLDLNLAARNLAVTAIFSFFTEREINEDVRKEVDRLVK
FT                   DWINQGRAELVVGVLFIDDAHTLDLEAFSFLTRALESELAPILILATNRGLTKIRGTDI
FT                   ESPHGIPLDLLDRLLIIPTRPYNADEIKEIIKIRADELEIELDPQALEELTKIGVENSL
FT                   RYSVQLLEPSLIIAQRNNRSIIKVEDVVIASKLFSDVKRSVKFVKEYENLLLK"
FT   gene            222016..222582
FT                   /locus_tag="LS215_0271"
FT   CDS_pept        222016..222582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0271"
FT                   /product="GMP synthase, small subunit"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34424"
FT                   /db_xref="GOA:C3MKC6"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR023686"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKC6"
FT                   /protein_id="ACP34424.1"
FT                   /translation="MKVGLVYYGGQYNHLILKNVKYLGADIEVIPPHKPVEELKKFDCV
FT                   IFSGGPYSVSEEIQKMGNSPLYIKELKVPMLGICLGHQLIAYVLGGVVRRALNPEYGLT
FT                   RINIFDEDTILKGFSQQLNVWESHNDEVVEPPSGFRVLAGSANARVQAMANSSNSIFGV
FT                   QFHPEVKHTERGIEIFKNFLGVCRK"
FT   gene            complement(222585..223373)
FT                   /locus_tag="LS215_0272"
FT   CDS_pept        complement(222585..223373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0272"
FT                   /product="Circadian clock protein KaiC central region"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34425"
FT                   /db_xref="GOA:C3MKC7"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022443"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKC7"
FT                   /protein_id="ACP34425.1"
FT                   /translation="MVSRLSTGILDFDKLIQGGIPQGFFIALTGEPGTGKTIFSLHFIA
FT                   KGLRDGDPCIYVTTEESRDSIIRQAKQFNWDFEEYIEKKLIIIDALMKEKEDQWSLVNL
FT                   TPEELVNKVIEAKQKLGYGKARLVIDSVSALFLDKPAMARKISYYLKRVLNKWNFTIYA
FT                   TSQYAITTSQAFGFGVEHVADGIIRFRRMIRNGELHRYILIEKMRQTDHDKHVWEIDIV
FT                   NGKGIVLKGRLEERREDYTLPEKVKRKIIESGKKTEEELK"
FT   gene            223452..223937
FT                   /locus_tag="LS215_0273"
FT   CDS_pept        223452..223937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0273"
FT                   /product="tyrosine specific protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34426"
FT                   /db_xref="GOA:C3MKC8"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKC8"
FT                   /protein_id="ACP34426.1"
FT                   /translation="MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESW
FT                   GDKDYYLSILKKNGLQPLHIPIPDGGVPSDSQFLTIMKWLLSEKEGNLVHCVGGIGRTG
FT                   TILASYLILTEGLEVESAIDEVRLVRPGAVQTYEQEMFLLRVEGMRKSWLKNIYSNS"
FT   gene            223907..224503
FT                   /locus_tag="LS215_0274"
FT   CDS_pept        223907..224503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0274"
FT                   /product="Deoxyribonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34427"
FT                   /db_xref="GOA:C3MKC9"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MKC9"
FT                   /protein_id="ACP34427.1"
FT                   /translation="MVEKHLLEFLEKLQFLISKNVKISHYGIENVKKICGVDIAYKGNL
FT                   GFSVGVSMDINSGDYNYKSYVGEVNFPYIPGFLFMREAPLMIKAIEGLDCHLLLVDGHG
FT                   IAHPRKSGIAAVIGVLLDFPTIGVAKSRLTGDLVNESEITYVYLNGEKVGVKFGRYFYS
FT                   PGNKVDLQDCIELGKRGYPKVLKIADMLTKKIKKE"
FT   gene            224508..225125
FT                   /locus_tag="LS215_0275"
FT   CDS_pept        224508..225125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0275"
FT                   /product="isochorismatase hydrolase"
FT                   /EC_number="3.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34428"
FT                   /db_xref="GOA:C3MKD0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKD0"
FT                   /protein_id="ACP34428.1"
FT                   /translation="MRAVNLIMKIEVPSIPEHKEVILDPTNTALIIVDMQNDFVRKNGK
FT                   LSVPTAEATIPFIKRLVDKARSSNALVIYTQDWHMKDDPEFKIWGEHALAGTWGAEIID
FT                   ELTPEKSDFIVKKYRYDAFFESSLDYILRVKNIKNTIITGTVANICVLHTAGSAALRWY
FT                   NVIMPKDSISAITEFDYYATLRQVDFLYKGIITTADGIKFER"
FT   gene            225134..226123
FT                   /locus_tag="LS215_0276"
FT   CDS_pept        225134..226123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0276"
FT                   /product="phosphoesterase DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34429"
FT                   /db_xref="GOA:C3MKD1"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKD1"
FT                   /protein_id="ACP34429.1"
FT                   /translation="MEYYAIVHNDFDGTASAAVYARAIKSLPKNVFFTEPNKLHSLLAS
FT                   LELRGVYNVMIADLGINASTFNEIIRNLKKLIDQGANVEWFDHHVWKDEWKEELKKIGV
FT                   SVYHDTSTCGAGVIYKYKNPNDEFSRRLSSADCSVDIWLHDDPMGEKLRRIVENNKDYS
FT                   WKNELMKMFYNGILWDDTFDKMLEEVVSRELEGYKKVMKSYKLIQINGHKVVVAVRWKG
FT                   PPDISYASQFLMTRTDASVFVSANGKSISFRSKEIDVRQFAVKLGGGGHPLAAGAQLKV
FT                   PIIYRFLNRIGIKGPMLNWVTKIVQNTIADVGFITYQESKKSSASSPY"
FT   gene            complement(226120..226806)
FT                   /locus_tag="LS215_0277"
FT   CDS_pept        complement(226120..226806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0277"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34430"
FT                   /db_xref="GOA:C3MKD2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKD2"
FT                   /protein_id="ACP34430.1"
FT                   /translation="MLIISTSDIHSPRYLTEFFLALRELGNIKADLALLAGDLVERGEY
FT                   LHFTPVYNALKNRVKQIVSIFGNEDFIENRKFYRENYSDIIWLEDEKVEIKIENRKLII
FT                   IGSEGVLEKPTLWQTSNGITEDLYMKRLEKITEMSCNSKADIKILLTHYASTFETVFGE
FT                   RKSVYPHLGYRVLEELSTKGKDCLPNIAIHGHAHYAKRTLSVVKSVRVYNVALPANKRI
FT                   ITIHTL"
FT   gene            226840..227979
FT                   /locus_tag="LS215_0278"
FT   CDS_pept        226840..227979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0278"
FT                   /product="protein of unknown function DUF763"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34431"
FT                   /db_xref="InterPro:IPR008482"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKD3"
FT                   /protein_id="ACP34431.1"
FT                   /translation="MEVEGIADLPLHTGHVPPWLVPIMKRLAKAIVEIMILELGPQKVV
FT                   ERFSNPLWFQGFNNIIGMDWDSSGSTTVTLGILKDITNPKVHGFAVLGGKGKNALKVPD
FT                   EVDMLIFDVDKNKIKNISKIVAKVDSTLVQDGHQLYHHTMLVTEDGKWSIIQQGMNLEI
FT                   KFARRYHWKETDNFVVEPHSAISGIKTNVVVNVIDRDKDRTRKLILDLLRENPNKIVSL
FT                   YTQAMAMLKGQSTLDMWIKGGSIAFVSKEARLIYMKPVDVNRIKQVLREMYESNPLTFE
FT                   EALINGLGPSTARALYLIADLIYNEPPSYKDPMNYPYDPFKYAFAIGGKDGIPYPVNRK
FT                   AAWEVIYTLEDFITRAKLEEGDKRLALRKLKELSKGIEK"
FT   gene            228089..228751
FT                   /locus_tag="LS215_0279"
FT   CDS_pept        228089..228751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0279"
FT                   /product="protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34432"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKD4"
FT                   /protein_id="ACP34432.1"
FT                   /translation="MFKLRLNNKEEEVFERISFTAELIGEAVKILQNEVNHVRKGENDQ
FT                   IPADLIKIKSIHERAGMLREEILSTLYGEAFLPDFKESMVMLTQALFNTLSSVKDAARA
FT                   LGSRKVDLKCVTILSDMLITYLALVNEASLKIHELTRHLGSDVEVSLKLSREIQAMERE
FT                   GDDIKDTLLQRLYEIEKEIDIISILQMKDVIIFIDDILDSLEDATLSVEVFYATLKS"
FT   gene            complement(228740..229726)
FT                   /locus_tag="LS215_0280"
FT   CDS_pept        complement(228740..229726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0280"
FT                   /product="phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34433"
FT                   /db_xref="GOA:C3MKD5"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKD5"
FT                   /protein_id="ACP34433.1"
FT                   /translation="MAITIIISMQNIIEYLLFIVGLISSYVIGANNNATSLGILFATNA
FT                   IKRRYAYILNMVSILVGVVLGSLTMLHSVYGVVYGNSLYVAIGIFTSLSSSIITFYYLN
FT                   KSGIPSSLSQTFYPSIAILTLISHGFIELDWVKFWVIVSSWVISPIVAIGFSLLLYLTL
FT                   NKVVSAETRIIKQITIYKNLILFSSAFTSFIVGANAIGIIVSSALLSAPAYLVIPLYGI
FT                   SAALGVLTSQRIAIRVGFRITKLGYLGASSALIGSNVINEIFTILGIPLSITQTIIGGI
FT                   VGLSFRSFTSDVRKQVIQIFRSWATSPIFAIILSLAIFGVIKSILGL"
FT   gene            complement(229686..229955)
FT                   /locus_tag="LS215_0281"
FT   CDS_pept        complement(229686..229955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0281"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34434"
FT                   /db_xref="GOA:C3MKD6"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKD6"
FT                   /protein_id="ACP34434.1"
FT                   /translation="MFMYLYHILFMIHMTTLKKVDDQTFELEITGTVTISFKLEDEFIK
FT                   EVDNVARNLGYTNRSDFIRDAIIYYLGYLKRNGNHNNNLNAEHY"
FT   gene            230084..232231
FT                   /locus_tag="LS215_0282"
FT   CDS_pept        230084..232231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0282"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34435"
FT                   /db_xref="GOA:C3MKR0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKR0"
FT                   /protein_id="ACP34435.1"
FT                   /translation="MSLELEWMSIDDLKLPSNVIDIIKNRGIKKLNPPQTEAVKKGLLD
FT                   GNRLLLTSPTGSGKTLIAEMGIISFLLKNGGKAIYVTPLRALTNEKYLTFKDWESIGFK
FT                   VAMTSGDYDTDDAWLKNYDIIITTYEKLDSLWRHRPDWLNEANYFVLDELHYLNDPERG
FT                   PVVESVTIRAKRRNLLALSATISNYKQIAKWLGAEPVATNWRPVPLMEGVMYPERKKKE
FT                   YTILFRDNTARKVHGDDAIIAYTLDSLSKNGQVLVFRNSRKMAESTALKIANYMNFVSL
FT                   DEKAISEILKQLDDIEEGGSDEKELLKSLISKGVAYHHAGLSKALRDIIEESFRKRKIK
FT                   VIVATPTLAAGVNLPARTVIIGDIYRFNRKIVGYYDEIPVMEYKQMSGRAGRPGFDQIG
FT                   ESIIVVRDKEDVDRVFKKYILSDVEPIESKLGSERAFYTFLLGILSAEGSLSEKQLEAF
FT                   AYESLLAKSVVDVYFDRAIRWLSEHSFIREENNMFTLTNFGKRVADLYINPFTADIIRK
FT                   GLEGYKASCEIAYLHLLAFTPDGPLVSVGRNEEEELIELLEDLECELLVEEPYEEDEYS
FT                   LYLNALKVALIMKDWIDEVDEDTILGKYNIGSGDLRNIVETMDWLTYSAYHLSKELRLD
FT                   DHSDKLRILNLRVTDGVKEELLELVQIGGVGRKRARLLYNNGIKGLGDVVMNPDRVRNL
FT                   LGQKLGERVVQEAARLLNRFH"
FT   gene            complement(232368..233939)
FT                   /locus_tag="LS215_0283"
FT   CDS_pept        complement(232368..233939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0283"
FT                   /product="carboxyl transferase"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34436"
FT                   /db_xref="GOA:C3MKR1"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKR1"
FT                   /protein_id="ACP34436.1"
FT                   /translation="MALYEKPSMDKLIEDLKILKEKVYKGGGEEKINFQHGKGKLTARE
FT                   RLNQLFDEGKFNEILTFATTRATEFGLDKNRFYGDGVIAGWGKIDGRQVFAYAQDFTIL
FT                   GGSLGETHANKIVRAYELALKVGAPVIGINDSGGARIQEGALSLEGYGAVFKMNVMASG
FT                   VIPQITIMAGPAAGGAVYSPALTDFLIMIKGDAYYMFVTGPEITKVSIGEEVSYQDLGG
FT                   AIIHATKSGVVHFVAENEQDAINITKRLLSYLPSNNMEEPPYVDTGDPADRAVQSAESI
FT                   VPTDSVKPFDIRDLIYNIVDNSEFLEVHKLWAQNITVGFGRINGNVVGIVANNSAYYGG
FT                   AIDIDAADKAARFIRFCDAFNIPVISLVDTPGYVPGTDQEYKGIIRHGAKMLYAFAEAT
FT                   VPKITVIVRRSYGGAHIAMSIKSLGADLVYAWPSAEIAVTGPEGAVRILYRREIQSAQN
FT                   PEELLKQKITEYKKLFANPYWAAEKGLIDDVIEPKDTRKVIARGLEMLRNKREFRYPKK
FT                   HGNIPL"
FT   gene            complement(233964..234473)
FT                   /locus_tag="LS215_0284"
FT   CDS_pept        complement(233964..234473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0284"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /EC_number="2.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34437"
FT                   /db_xref="GOA:C3MKR2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKR2"
FT                   /protein_id="ACP34437.1"
FT                   /translation="MRLFRLYSELGDMYLVSYEQSNNSLDKIKIGDKNYEVKYLGSGNR
FT                   ENEYLFEINGKKYYVFIESDGTLIFNHQDFLRLDKVTEIPIKGEERVEEIIRGKEGEIV
FT                   SPLFGRVVKIRVKEGDAVNKGQPLLSIEAMKAETVISSPIGGIVQKILIKEGQGVKKGD
FT                   ILIVIK"
FT   sig_peptide     complement(234405..234473)
FT                   /locus_tag="LS215_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.626) with cleavage site probability 0.429 at
FT                   residue 23"
FT   gene            complement(234473..236005)
FT                   /locus_tag="LS215_0285"
FT   CDS_pept        complement(234473..236005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0285"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /EC_number="6.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34438"
FT                   /db_xref="GOA:C3MKR3"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKR3"
FT                   /protein_id="ACP34438.1"
FT                   /translation="MPPFNKVLVANRGEIAIRVMKAVKEMGMKAVAVYSDADKYAPHVK
FT                   YADEAYWIGPPPALESYLNIERIIDAAEKAHADAVHPGYGFLSENASFVEAVEKAGMVF
FT                   IGPSASVMNRIKDKLEGKMIARKAGVPTSPGPLTPIENVDEALKIAGEIGYPIMLKAAG
FT                   GGAGVGIIKVDNPSELAEAFERSKRLAYSAFGSAEIYIEKAAIKPKHIETQLIGDKYGN
FT                   YVVAFERECTIQRRNQKLIEEAPSPSIKEEERKEIIEASIRFGKEINYFTLGTMEFVFS
FT                   PVTREFYFLEINKRVQVEHTVTEFITGIDLVKLQIRLAAGEYLPFSQEDLKKRGHAIQF
FT                   RINAEDPLNNFTPQSGYITYYKEPTGPGVRVDSGIELGSWVPPYYDPLVSKLIVYGQSR
FT                   DYAIRVGLRALNDYKIGGVKTTIPLYKLILQDPDFWEGNFTTAYISEKAEYFMTKLKEE
FT                   QEIQIAIAISIYNRGLMKKKKTEQKVPISTSNGKSNWKTYGIIFQSSPRVLW"
FT   gene            complement(236430..238037)
FT                   /locus_tag="LS215_0286"
FT   CDS_pept        complement(236430..238037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0286"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34439"
FT                   /db_xref="GOA:C3MKR4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKR4"
FT                   /protein_id="ACP34439.1"
FT                   /translation="MNEILLIFLASLASLGRVFLTIGLSIITGWFLGYIAIKSKAFENI
FT                   YISVVEIFESVPVISFFPVVLIFFVYRIGGYIGIELAVDFLVFTAVVWNIWIGIYQAFK
FT                   TVPSDLLEVSENYRLGFLGKMAKLYIPYSWPRIAANLIPSFADAIFYITVSEVFSIGSS
FT                   SYHVFGIGTLIGEFTASQEYTLALDGLGILAIPIIIFTYLLRRFANYTVSKYGLDTEIK
FT                   VTKRGRMRIRYATRMSNTIAPFVKLSKYVTRIGSRSASSEEETRRNLPWRYLGIGISVL
FT                   LLGLLVYGAFSTISSVPKSVWLYLISTTPNVLFNLLIDYIRVLFIAIVSLVFSIFLGYF
FT                   IATRERVEKVLIPAIQTYASFPAPAYFPLLFAATISFIHSVFGSWIDEFYVILLGFIST
FT                   FYYVFYSYWLGIKNMPNQYWEIMKNYNFSFWHKLRYVIIPSTFPYIISGLSSTINSAWG
FT                   GLAIGEYWEISNSYTLQVSHGIMKSIAVATANGNIPLAAWDSLIFGIVVMIYSIFFTRK
FT                   MMDLAREKYVAEEGIYLA"
FT   gene            complement(238030..238728)
FT                   /locus_tag="LS215_0287"
FT   CDS_pept        complement(238030..238728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0287"
FT                   /product="ABC transporter related"
FT                   /EC_number="3.6.3.36"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34440"
FT                   /db_xref="GOA:C3MKR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKR5"
FT                   /protein_id="ACP34440.1"
FT                   /translation="MYTKDRELIAIVGPSGIGKSTLLRVLGGFVKPLKGEIRLLGKKVT
FT                   SPTPKIALIHQSIATFPWLTALENVKLGLKYRKLPKEEEDRLAKHMLEVVGLQGFEDFY
FT                   PKQMSGGMRQRIAIARALAANPLVLLMDEPFSHLDELTAEGLRQEVHSMLFNESTTLHS
FT                   VVLVSHNLSEVVELADRVYVLNGRPATVIGEVEIKLERPRNPKDESFQEYLDILYALLT
FT                   PVKKGGNNNE"
FT   gene            complement(238873..239109)
FT                   /pseudo
FT                   /locus_tag="LS215_3011"
FT   gene            complement(239143..239640)
FT                   /locus_tag="LS215_0288"
FT   CDS_pept        complement(239143..239640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0288"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34441"
FT                   /db_xref="GOA:C3MKR6"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MKR6"
FT                   /protein_id="ACP34441.1"
FT                   /translation="MIIEGPVIKFGDKIDTDIIIPARYLKYTDPQYLAQHVMEPLDPEF
FT                   YKKASKGVIIVAGKVFGMGSSREQAAIALKAAGVKAVVAESFARIFYRNAINNGLPVIT
FT                   LPNSTKEIDENSYVKIDVETGEILVGNKVLKGKGITGMALEILQAGGIMEYLKKMQTVN
FT                   RN"
FT   gene            complement(239641..240888)
FT                   /locus_tag="LS215_0289"
FT   CDS_pept        complement(239641..240888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0289"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34442"
FT                   /db_xref="GOA:C3MKR7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKR7"
FT                   /protein_id="ACP34442.1"
FT                   /translation="MSAKTLTEKILSRASGKDVSPGDVIEAKVDLVAFHDLTGYHVIEV
FT                   MEKANMIKVFDKSKLVIAFDHLAPPPDVRSAEIQGYIRKFVKSEGIPNFYDINYGILHE
FT                   VMIEQYANPGQVILAADSHTTTSGAVGAFAQGMGASDIAAALITGKTWLVVPQPFKVVL
FT                   EGKPAKWITGKDVALKLLGDFKADYFNGMTLEIFVKDPLSFPMDYRATVSNMGIEMNAD
FT                   ALMFIPDQETKRYIKEMRGYEPELVTPDNGAKYVDEYTIQLDEMEPLVAAPHSVDNVKV
FT                   VNELGGTPVDQVYIGSCTNGRLSDFEIAAKIMKGKKVKSRCIAIPASYRMFKEALERGY
FT                   IQTLVDAGCIVTYGTCGPCLGGHFGIAGPGENIVSTSSRNFKGRMGSNEAKVYLSGPAV
FT                   AAISALEGKITDPRVI"
FT   sig_peptide     complement(240799..240888)
FT                   /locus_tag="LS215_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.575 at
FT                   residue 30"
FT   gene            complement(240972..242273)
FT                   /locus_tag="LS215_0290"
FT   CDS_pept        complement(240972..242273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0290"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34443"
FT                   /db_xref="GOA:C3MKR8"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKR8"
FT                   /protein_id="ACP34443.1"
FT                   /translation="MLCLFIFRRDLRLDDNTGLIKALEDCEKVIPAFILDPRQVGNENE
FT                   YKSEFAINFMINSLNELNDELRKRGSRLYVYFGLAEEVIKNLLKDVDAVYLNEDYTPFS
FT                   KMRDERIRKYCADTGKIMKSFEDYLLTSKNDFKNYRNFTTFYNVVKNKQIRKPVQNNYT
FT                   NYYKNSLGDEHELPPRQGERGGRKEGIKLIERARQINYDRKDFVAEDNRTFLSPHLKFG
FT                   TLSIREVYYSLLDSQAIIRQLYWRDFYTLLAYYNERVFHEPLKREYNCIEWENNERLFQ
FT                   AWLEGKTGYPIIDAGMRQLNRTGDMPNRVRMLTAFFLVKVLIIDWRIGEKYFASKLIDY
FT                   DPSVNNGNWQWIASVGTDYIFRVFDPWKQQVTYDPEAKYIKRWVDELESYDAEIIHNAY
FT                   KYTLKSYPKPIVDWRIRVNLAKRLYEVCRKSKIK"
FT   gene            242354..244192
FT                   /locus_tag="LS215_0291"
FT   CDS_pept        242354..244192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0291"
FT                   /product="glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34444"
FT                   /db_xref="GOA:C3MKR9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKR9"
FT                   /protein_id="ACP34444.1"
FT                   /translation="MTRYLILGNGSLTVLYDSNFTIREIYWPLTTTNNLHRGRFGVFVN
FT                   GKFSWLDNLNPKIGYLDDTLAAYSSFSFEGVNFYLEDVIDMAYDIWIRKVSVKDVKDRD
FT                   VRVFTAFDFHVGGTPDGNTALFDPYSESMIQYKGSRWFLLSSPIPFYQYATGIKEYKGL
FT                   LGTWKDCEDGELSGNPIAQGSVDFASSFKLYGEDLYIWLVAGKNYNEAKGLSDYVRKRI
FT                   PAILFKRVKDYWRAWLSKVNDYGEYDSILRRSLLILQSHVQNNGAIVASLDTDIMKFNR
FT                   DTYNYVWHRDAVFCILALELMGYFDRSRQFFEFTRRLFTINGALFHKYTVDGHFGSTWH
FT                   PWTLDYLPIQEDETALVLYALWFHFSKWKDVDFIKTYYRPMVKGIADFLVNYREKATGL
FT                   PLPSFDLWEERIGTHFYTTITVIAGLRAAADFARYFGEDELAQKYETVADQMRNSLDLF
FT                   WVGDHYARTIYMKEGQVHKIDETVDSSILLAPIFNVIPMSDSRFVKNLETVIEKLSVKR
FT                   GLVRYEGDQYLRGGNNSNIWFISTLWLSQVYSLMGEKDKAKEKIDWVLSKSLPTGVIPE
FT                   QIDDNDKYPSVSPLAWSHAELIRAIYALRNGTLDPK"
FT   gene            244283..244678
FT                   /locus_tag="LS215_0292"
FT   CDS_pept        244283..244678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0292"
FT                   /product="transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34445"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKS0"
FT                   /protein_id="ACP34445.1"
FT                   /translation="MQGKTEINMPDGRVADIFNVIKFLYGLSDRDIEILKLLLKSQNPL
FT                   TMEEISSKLNITKSVVNKSILNLEKKNIIIKEKIETSKKGRRAYTYKVDSNYLNKKLLV
FT                   DLDQLMKDLKVKIANVIGVEIEKTANI"
FT   gene            complement(244695..244982)
FT                   /locus_tag="LS215_0293"
FT   CDS_pept        complement(244695..244982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34446"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKS1"
FT                   /protein_id="ACP34446.1"
FT                   /translation="MAKKRSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKML
FT                   MDLEIIKQEGKQYMLTKKGEELLEDIRRFNDMRKNMDQLKEKINSVLSIK"
FT   sig_peptide     complement(244920..244982)
FT                   /locus_tag="LS215_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.683 at
FT                   residue 21"
FT   gene            245130..245864
FT                   /locus_tag="LS215_0294"
FT   CDS_pept        245130..245864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34447"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKS2"
FT                   /protein_id="ACP34447.1"
FT                   /translation="MERIDIASVKGGVGKSFIAYFLSKTLAASHKILLIDKDLTSTLSR
FT                   VYNIKGNLLSYLTVGQSSLAYFKEVDSGLTVVNVGCSRKIKNVEPKKIADIYSGFSDHD
FT                   LMIVDNPSIPSDVCLDTELQAYYTYLNEKRLDYNLILILPPNQLLLDESLAFMQLFKDY
FT                   IKNELSISLGNDLVNFDVISSVINMYNPRERIDISKIKDLTSKIVKIPFKKEAIYTPFN
FT                   QLNTPMEISELAKYVLEYLESR"
FT   gene            245991..246185
FT                   /locus_tag="LS215_0295"
FT   CDS_pept        245991..246185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34448"
FT                   /db_xref="GOA:C3MKS3"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKS3"
FT                   /protein_id="ACP34448.1"
FT                   /translation="MVSAKSILAGILLLIPFIVYFAIPTYNKVEPDLGSLPFFYWYQTV
FT                   WLAISAILFSIAALLLARR"
FT   gene            246191..247708
FT                   /locus_tag="LS215_0296"
FT   CDS_pept        246191..247708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0296"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34449"
FT                   /db_xref="GOA:C3MKS4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKS4"
FT                   /protein_id="ACP34449.1"
FT                   /translation="MLGLAGIIVFIALFIVFIFLGFYGAFWRKGNLDLLHEWGLAGRRL
FT                   GTVLVWFLMGADLYTAYTFIAVPSSLYAKGAIYFFAVPYVSLTFAIAMLTMPKLWIVSR
FT                   NRGYVTAADFVKDRFNSSILAALIALTGVVAELPYIALQIVGMKSVLQMMLLGIGNAAL
FT                   VSEISLIVSFIILAAFTYTSGLRGAALTGVFKDILIWITVISVIVIVPLQYGGFTHAFS
FT                   VINSANLSARYTTLPSNLQIAYWSLFLGSALALYLYPHSINGSLSADDKNRLMYSTALL
FT                   PIYGIGLAIIALFGILVYAVPNALSVVSKYGGALVVPALITSTMPDWAAGIMLLGIFVG
FT                   GLVPAAIMAIAASNLLVRNVIKEVNPSITPKGETTLAKWISAVIKFLALAFVFLVPSTY
FT                   AINLQLLGGILITQTLPAVFLGLYTKWFNPWALTAGWATGIISGTYMFFTFGLPRATSL
FT                   YPTLFGLMYAAVIALVLNLVVSVIGTLVANALGFKTKSNISAEDLKG"
FT   gene            247772..248515
FT                   /locus_tag="LS215_0297"
FT   CDS_pept        247772..248515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0297"
FT                   /product="Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34450"
FT                   /db_xref="GOA:C3MKS5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKS5"
FT                   /protein_id="ACP34450.1"
FT                   /translation="MIYEKVAEELISSSYNIAFTGAGISTASGIPDFRGPQGLWKKYSP
FT                   ELASIEYFEKDPKNFWGFYSLRMRGLFEAQPNKAHYSLAELEKMGIIKVIITQNIDGLH
FT                   QKAGSKNVIELHGTMRRSYCVLCLRTYDSLNVLSMIEKGNLPPRCDCGGIIRPDVVLFG
FT                   EPVKNIYEALSIAYESDLVISIGSSLTVYPANLIPQTVKERGGKLIILNMEETPLDSIA
FT                   DYVVREPVEISLPKIVENVRQKILS"
FT   gene            248550..248750
FT                   /locus_tag="LS215_2966"
FT   CDS_pept        248550..248750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2966"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2966"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34451"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKS6"
FT                   /protein_id="ACP34451.1"
FT                   /translation="MIEEEEELKLIKQIFLIINENVPDDCRDLVINRLMNRLMDDIKEL
FT                   GVKETIKKWLGEEDEELIIVD"
FT   gene            complement(248771..249484)
FT                   /locus_tag="LS215_0298"
FT   CDS_pept        complement(248771..249484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0298"
FT                   /product="Nucleotidyl transferase"
FT                   /EC_number="2.7.7.13"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34452"
FT                   /db_xref="GOA:C3MKS7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKS7"
FT                   /protein_id="ACP34452.1"
FT                   /translation="MYVMHAVILAGGYGKRLRPLTDDRPKPLIEVAGRPIIEWQISWLK
FT                   QFGITSFVILTGYKWEVLIKWLSENEKRLGISTYFSIEEEPLGTGGALRKVERLLSTEN
FT                   TFIVLNGDIITNLDISKLKISNENVMTMSLVPLKSPYGIVETKDDKIIDFKEKPILENY
FT                   WINAGVYLMRKEIFKYLPEKGDMEKLTFPKLAKESLLIGIKYYDVYWRSIDTIKDIEEV
FT                   SEDLIKMKNGLSSER"
FT   gene            249724..249849
FT                   /pseudo
FT                   /locus_tag="LS215_0299"
FT   gene            250180..250380
FT                   /locus_tag="LS215_0300"
FT   CDS_pept        250180..250380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34453"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKS8"
FT                   /protein_id="ACP34453.1"
FT                   /translation="MKEREVEAKRLVGKKNVRGKIYEYEYFTLPLNLYLPKSMVEKFGT
FT                   KYMLQVDEDSGTITIKPKSGQ"
FT   gene            complement(250364..250726)
FT                   /locus_tag="LS215_0301"
FT   CDS_pept        complement(250364..250726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34454"
FT                   /db_xref="GOA:C3MKS9"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKS9"
FT                   /protein_id="ACP34454.1"
FT                   /translation="MKKKAIGLSDDGYYVIFFISESEIGYKKTQINEMYYVSFIIVLLV
FT                   SILYVIFRYILVLTLFIIPILVYLFTIAISLHLYKPEIYEKITRVEIKDKIIKIHTSNK
FT                   TFIIHRGKILGFTDQI"
FT   gene            250958..252007
FT                   /locus_tag="LS215_0302"
FT   CDS_pept        250958..252007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34455"
FT                   /db_xref="GOA:C3MKT0"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKT0"
FT                   /protein_id="ACP34455.1"
FT                   /translation="MKRYLILFLVLTSIIFIPITYSSNQFSFLNIGNTISYNIYETSSR
FT                   LGTYLTFNISMNLVWNGTVFVINGKSVNKVFPAINTNNLTIENISGSYPYPLSVWINTA
FT                   AAGTPSGFLETGKEFTTYNGIPAVEFLDYNNYTYISLQYMIPLKSYYSINIDPASNLTY
FT                   SATATLTKGDLNFYTGPYNLYNVSFNYVYQNYTVNLFLLVASSNAEINLLNYSNHVALN
FT                   ITGLKFISLLVPITTFHDLLGVSKFIYNGSPYIIILTSTGSTGSAYYYNTSVPIIGSYI
FT                   PGTNYYMISIPYSGNIVIIFGNYYSNYVNGSINIKNNDVGHGFSLLYALSAVIVVAVVI
FT                   TATYMLRKK"
FT   gene            complement(251993..252775)
FT                   /locus_tag="LS215_0303"
FT   CDS_pept        complement(251993..252775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0303"
FT                   /product="ATP-citrate lyase/succinyl-CoA ligase"
FT                   /EC_number="6.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34456"
FT                   /db_xref="GOA:C3MKT1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKT1"
FT                   /protein_id="ACP34456.1"
FT                   /translation="MLKYGTKIVAGVTPGKGGTQVNSVPVYDTVKDAMKEHEADASIIF
FT                   VPARYAVDAIYEAVDAGIKLIVTITEHIPVLDMARAIKYARARGARIIGPNCPGIIAPE
FT                   ESLVGILPARAFKKGKIGIVSRSGTLTYEVSELLKNSGMGQSTVIGIGGDPIIGTSTLE
FT                   VAKMFDQDPETEKIVVIGEIGGTMEERLAEAYKRGEIKKPIIAYIAGMTAPREKRMGHA
FT                   GAVVYMGMGTFESKIRAFKEAGIPIANTPYDIPKLLLS"
FT   gene            complement(252841..253854)
FT                   /locus_tag="LS215_0304"
FT   CDS_pept        complement(252841..253854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0304"
FT                   /product="Succinate--CoA ligase (ADP-forming)"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34457"
FT                   /db_xref="GOA:C3MKT2"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKT2"
FT                   /protein_id="ACP34457.1"
FT                   /translation="MKLYEYEGKSLFKRVGIPVPNGVVTSEPIRWQGKAVVKSQLLEGA
FT                   RGKRGLVRVTEDIYNTILELKKLGVEKFLVEEFVPHEKEIYASVLLDRETAEPMLVLSR
FT                   EGGIDVEQAKDVKKMIIPLERGVRSYDIVEAEKYLGVKGLGQIIQGLYKLFVDYDAELV
FT                   EINPLALTNDGRILALDSKVILEDNALYRHEDLLKELGRQEVRDSYVELEGDIGIIGNG
FT                   AGLTMASMDLVKLNGGNPANFLDVGGGANREHVKESVLKVGSNPRVKKIVINIYGGITR
FT                   CDEVALGIIDALKEVKKPIFVRLLGTNEELGKKILRENGVNVYDDVLKMIGDAVRS"
FT   gene            complement(253939..254622)
FT                   /locus_tag="LS215_0305"
FT   CDS_pept        complement(253939..254622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0305"
FT                   /product="HhH-GPD family protein"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34458"
FT                   /db_xref="GOA:C3MKT3"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKT3"
FT                   /protein_id="ACP34458.1"
FT                   /translation="MVRKILDTLLKIFENNKSILKEKGWIVSSETSYEWWDGLKSAEEI
FT                   IISAILVQMSRWEIVKSKVEEMRSKGLTDFYKLCNTTEQELYDVLKGINFYKTKVKRLI
FT                   NLSKIIINLGSVEKFYNRNLLLSIDGIGEETADSILLFAGHKPNFPPSEYGKRVLSRVL
FT                   GISIKKKNEVKRLVEENLERNVYEYKLLHAGIVTVGRAFCFIENPKCEDCILKKVCKYY
FT                   RENSS"
FT   gene            complement(254622..255578)
FT                   /locus_tag="LS215_0306"
FT   CDS_pept        complement(254622..255578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0306"
FT                   /product="Oligosaccharide biosynthesis protein Alg14 like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34459"
FT                   /db_xref="GOA:C3MKT4"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKT4"
FT                   /protein_id="ACP34459.1"
FT                   /translation="MTRILIIASGGGHTGFARAIAQYLPEKVDFVIPTNDPYSRQMISQ
FT                   YANKIYEIPKGREPDESSLVLFKRLFSIIVKSASIKKYDLIIATGSNHSIFPSFFQFLK
FT                   GGKVYGIESQDRLITKGKAIGIISNYAKGVFLHWQEQRKLYEKKGIVVGPIVEKPKYES
FT                   KDEGYILVTTGSMGFKRLFDAIVKSVIGKRIVIQTGKIDPTIYRNQNVATFSFDPDLEK
FT                   WIANASLVITHQGKTAMEAVVMYRKPVIMVYNNDWKSATTLSDAKKYAEILGATFLSDP
FT                   ITWSDYNVLLEAIENANEPNVFDTGTPNLVKHVLSEL"
FT   gene            255630..257267
FT                   /locus_tag="LS215_0307"
FT   CDS_pept        255630..257267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0307"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34460"
FT                   /db_xref="GOA:C3MKT5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MKT5"
FT                   /protein_id="ACP34460.1"
FT                   /translation="MESYKPVWLKGAVILAINLIDKGYKPVAVGLGERDFYIDVKSDTS
FT                   ITLDEVKKAINENVLANVSIENNQIVYKGNKVSIIEDKVSISTNLNPKYFEILNISTHH
FT                   PNPNEQYVRIRGVAFETEEQLKDYLTWLEKAEETDHRLIGEKLDLFSFHEEAGSGLVLF
FT                   HPKGQTIRNELIAFMREINDSMGYQEVYTSHVFKTDIWKISGHYTLYRDKLIVFNMEGD
FT                   EYGVKPMNCPAHILIYKSKPRTYRDLPIRFSEFGHVYRWEKKGELYGLLRVRGFVQDDG
FT                   HIFLREDQLREEIKMLISKTVEVWHKFGFKDDDIKPYLSTRPDESIGSDELWEKATNAL
FT                   ISALQESGLKFGIKEKEGAFYGPKIDFEIRDSLGRWWQLSTIQVDFNLPERFKLEYIDK
FT                   DGIKKRPVMVHRAIYGSIDRFVAILLEHFKGKLPTWLSSVQVRVLPITDEVNEYAEKVL
FT                   NDMRKRRIRAEIDYAGETLSKRIKNAYDQGVPYILIVGKKEASEGTVTVRARGNIEVRN
FT                   VKFEKFLELLITEIAQRDVEQTTVKALK"
FT   gene            257305..257760
FT                   /locus_tag="LS215_0308"
FT   CDS_pept        257305..257760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0308"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34461"
FT                   /db_xref="GOA:C3MKT6"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MKT6"
FT                   /protein_id="ACP34461.1"
FT                   /translation="MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEF
FT                   FHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAV
FT                   GMALSKNPILLIIPCHRVIAENGIGGYSRGVKLKRALLELEGVKIPE"
FT   gene            258121..258864
FT                   /locus_tag="LS215_0309"
FT   CDS_pept        258121..258864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0309"
FT                   /product="sulfocyanin"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34462"
FT                   /db_xref="GOA:C3MKT7"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010532"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034246"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKT7"
FT                   /protein_id="ACP34462.1"
FT                   /translation="MNTSIIIAVIVILIIVVGIVAYLTLVHHPATISSTTSSVETTSTS
FT                   FTLTSTSTTISTSSTSTSSTTTTSSSTTSSTTITTTQSVTLPPGANMLPYNPNNKTVFI
FT                   YLAVTATGPAFNYNGTSNGQMKIYVPAGWNVMIILTNEQSIPHNANIVLNDTQIPNNPN
FT                   ISADGKILLYVGDSPSNFANNGILSGQTAVGILDNISAGYYWIACGITGHAENGMWADL
FT                   IVSNSVSVPYFIISSSSSSTSTTHS"
FT   gene            258910..259674
FT                   /locus_tag="LS215_0310"
FT   CDS_pept        258910..259674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34463"
FT                   /db_xref="GOA:C3MKT8"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKT8"
FT                   /protein_id="ACP34463.1"
FT                   /translation="MIKRLTISPLFLILSLIAYYLSRNDILLYSTLSTILFWTFIILIL
FT                   PTSFYNYIKDGIVKYCKKKIFWFTVGLYISYHVILYSFFFYLLLPGSIKNISFWFSFNA
FT                   GIGYSIPPPITYFLEWVSNSPAIWFFIGPYEGDVIPFSTFLGVVLALLIGLNVMKILEL
FT                   WGISNKLSKSIVLIPSLGVVSGSSCCVFLPSIVMYSIALSISSITATILSILSSFAYFI
FT                   LAYYALPIVSAIVLFHNLTMLNRLIKKLSFTM"
FT   gene            259718..260701
FT                   /locus_tag="LS215_0311"
FT   CDS_pept        259718..260701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0311"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /EC_number="1.3.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34464"
FT                   /db_xref="GOA:C3MKT9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKT9"
FT                   /protein_id="ACP34464.1"
FT                   /translation="MFKVEYPITQVIYGLNALDWLASVKGKRIALVTTRSLLKSKILEQ
FT                   ILSLINAEVIEGPRQHTPVGDVNNLTERLKGYDVVIGLGGGSVIDGIKLSFNGYYIAIP
FT                   TTFSGAEHTRSGGATIDGIKKSRIGKEADAIILDPRATLETPKWLLIASGVRAIDHAVE
FT                   ALYSKDSTPFTDSLAIEGYKKLVKCIRDLDSIENRALCQIGTWLSSLTMRYAKMGISHN
FT                   FGYVYGPRFNIPHGVTSCISLPSAIKLNYSVARNKLREIENEGEPLYEFMDKFLKDIGA
FT                   KRRLSEFTTLDEALKYVQTFIQIVNNSGNPVKIDIETAKRFIEEVF"
FT   gene            260703..261149
FT                   /locus_tag="LS215_0312"
FT   CDS_pept        260703..261149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34465"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKU0"
FT                   /protein_id="ACP34465.1"
FT                   /translation="MIEWKGFGKRWGKCEECWLAYERRIQHENSLNCYKLGIPIDALKI
FT                   PLDQFLNIVKDVPGKYAIFGFPLNLLSKGVIIFYFDTKEEMENFIENIMNYIKSEISFR
FT                   EKKFYDIFVNTEWIGSMNWRRGCPEYDKKFGDWRGWRNHSNEDY"
FT   gene            261283..261888
FT                   /locus_tag="LS215_0313"
FT   CDS_pept        261283..261888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34466"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKU1"
FT                   /protein_id="ACP34466.1"
FT                   /translation="MSISIFVLSLKGGIGKSRLSYELSRYISKRKFKKVLLIDNDSLST
FT                   LSNLLGHYGDGLLDGFDLRSSLKEIDDIFILKLRNKVYFLDNFYDNERLRQLKFVLSRN
FT                   WDYIIIDNYVGISETNPIIKIIYEFSQLKIGIFLSDDFSLNSTTEYSNSWNYLDSKCVL
FT                   LTNKPFDVHYIIDRTIIDAILNQCEENYDEKFNIEKTN"
FT   gene            262019..262936
FT                   /locus_tag="LS215_0314"
FT   CDS_pept        262019..262936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0314"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /EC_number="3.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34467"
FT                   /db_xref="GOA:C3MKU2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKU2"
FT                   /protein_id="ACP34467.1"
FT                   /translation="MPLDPRIKELLESGFIVPIGKASVDEVRKIFRQLASAAPKVEVGK
FT                   VEDIKIPGSEANINARVYLPKANGPYGVLIYLHGGGFVIGDVESYDPLCRAITNACNCV
FT                   VVSVDYRLAPEYKFPSAVIDSFDATNWVYNNLDKFDGKMGVAIAGDSAGGNLAAVVALL
FT                   SKGKLNLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRF
FT                   SPILVQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFP
FT                   LIEQGRDAIGLIGSVLRRAFYDKS"
FT   gene            263014..264024
FT                   /locus_tag="LS215_0315"
FT   CDS_pept        263014..264024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0315"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34468"
FT                   /db_xref="GOA:C3MKU3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKU3"
FT                   /protein_id="ACP34468.1"
FT                   /translation="MKAVILPAHKQGYRIEEVPDPKPGKDEAIIKVNKAALCYRDLLQI
FT                   KGFYPRSKYPLILGHEVVGTVEEVGEDVKDFKKGDRVTSMLFVPDWSCEYCKSGEEVYC
FT                   KNRVVYAQELDGFFAEKAKVKASSLVKVPESVSDEGAVIVPCVAAMVYRGLKKAGIKKG
FT                   EIVLVTGASGGVGIHAIQVAKALGAKVIGVTSGESKAKIVSKYADYVIVGEKFSEEAKK
FT                   IGDVSIVIENVGPYTLEESMKSLRSGGKIIQIGNLDPSVTFNLRLGYIILKDISLMGHI
FT                   GANKNDIIKTLNLVKEGKIKPVIGSEVSLENFGKALDLLNDSKNRYGKILISNSF"
FT   gene            complement(264010..265197)
FT                   /locus_tag="LS215_0316"
FT   CDS_pept        complement(264010..265197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0316"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34469"
FT                   /db_xref="GOA:C3MKU4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKU4"
FT                   /protein_id="ACP34469.1"
FT                   /translation="MLEDVYLVDYARTAFTRFSRKDYQKDPFYNIRPEELAGMVINRLI
FT                   EKNGIKAEEIDEIITGCALQVGEQWAFGGRHEIFAARLPYNIPTMAVDRQCASSLTTVS
FT                   IGAMEISTGMADIVLAGGVEKLSRTPMFDNPHIEVNTKFLTDSKYIEYDLTTGYVMGLT
FT                   AEKLAEEARIKREEMDRWSLRSHQLAWKAIQEGYFKDEILPIEVEVEGKKTVVNVDQSV
FT                   RPDTSIEKLGQLPPAFKPNGTITAGNSAPLNSGASYVLLMSKNALKKYGLTPMAKIRSF
FT                   GFAGVPPAVMGKGPVPASKKALEKANLSTRKIDLWEINEAFAVVVLYAIKQLELDESTV
FT                   NKKGGAIAIGHPLGATGARLVGTLARQLIIEGKDYGVATLCVGGGQGGAIVLERV"
FT   gene            complement(265236..266135)
FT                   /locus_tag="LS215_0317"
FT   CDS_pept        complement(265236..266135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0317"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34470"
FT                   /db_xref="GOA:C3MKU5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKU5"
FT                   /protein_id="ACP34470.1"
FT                   /translation="MLLDLNFEISEDLKLILSSLNELLESRWSTKKLRAVMEGNKDYIE
FT                   EIWKEIIKLDILPYLSTLSLRDNVIINEVIGRKLLPGIVVSSIVASRGIKNKDILNRVY
FT                   AGEIRIAISDSNLVPSADEADYIIIGNRLIKRSNCTIRTFNSLDNSMKISKVDNIGNHE
FT                   DIEVNNAEIALSLASQMVGSGEEVVSMSIKYSKERVAFGKPIGSYQAIKHRVVNDAIDV
FT                   ELARSLILEAAENIKYAWIAKDLANKKIPKAILSGIQVHGGIGFTDDLDIHLHLRRALT
FT                   LSKLYNSKVNISEFLQPI"
FT   gene            complement(266140..267066)
FT                   /locus_tag="LS215_0318"
FT   CDS_pept        complement(266140..267066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0318"
FT                   /product="ribonucleotide reductase"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34471"
FT                   /db_xref="GOA:C3MKU6"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKU6"
FT                   /protein_id="ACP34471.1"
FT                   /translation="MGMSFEEYKHEYFKSIRSGGLNWSLFPMKLYQLGKKLFWDPANID
FT                   LSKDAEDWKKLNDLEKMFIINVGSKFAAGEEAVALDLHPLIVTLVKEGRVEEVMYLEQF
FT                   VYEESKHVEAFRRFFDIVNVMEDLSAYTKDLSPNYKKIFYEELPKAMWNLSRDPSPENQ
FT                   VRAVVTYNLIVEGVAAEGGYNIFRQITNTRKILPGLAKMVNLIATDESRHIAFGIYLIT
FT                   RLVKEYGEGVYKAAMDHINYLAPYAIGIFSEPTMPQVESLPFNLTNIELVDYAKKLLNT
FT                   RIDAINRARRMKLEMLLPKDLDVIESW"
FT   gene            complement(267156..267914)
FT                   /locus_tag="LS215_0319"
FT   CDS_pept        complement(267156..267914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0319"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34472"
FT                   /db_xref="GOA:C3MKU7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKU7"
FT                   /protein_id="ACP34472.1"
FT                   /translation="MYSLKDKVVVVTGSGRGIGRAIAVRLAKEGSLVVVNAKKRADEMN
FT                   ETIKIIKENGGEAIGILADVSTREGCETLAKATIDRYRVADILINNAGLGLFSPFLNVD
FT                   DKLLDKHISTDFKSVVYCSQSLAKEMRDGGAIVNIASVAGVSPAYGLSIYGAMKAAVIA
FT                   LTKYLALELAPKIRVNAIAPGFVKTKLGESMFQVLGMSEKEFGEKFTLMGKILDPEEVA
FT                   EFTAAILKIESLTGQVFVLDSGESLKGGIK"
FT   gene            complement(267949..268995)
FT                   /locus_tag="LS215_0320"
FT   CDS_pept        complement(267949..268995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0320"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34473"
FT                   /db_xref="GOA:C3MKU8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKU8"
FT                   /protein_id="ACP34473.1"
FT                   /translation="MKAALYKGYGLPLEIEEVPNPAPKEGEVLVKVASTGICHSDLHLL
FT                   SGELVGPLPNGFIIGHEIAGWVEKIGENVKNPYGLKEGDPVLVSWIVPCGICRYCANGK
FT                   ENYCKDNAKRLVGLIGINGGHAEYLTVPEIAVIPLAKNLDPYYSSPIACAYGTAYNALK
FT                   SANATSGKSVVIVGAGGVGSAAIQLANSIGLNPIIAVDIDENKLKSAKLLGATHIINAN
FT                   ENDARAKVLEALEDGADIVYETKPYPDFKLSLEVVKSGGTIVVTGLGGFSTLAQIPVTL
FT                   FVSRGITLIGSLGYRPRIDLPDLVSLASSGKIDIKKLVSHIYTPDRINEAYENLKKGLH
FT                   IRAIIRWN"
FT   gene            complement(269279..269683)
FT                   /locus_tag="LS215_0321"
FT   CDS_pept        complement(269279..269683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34474"
FT                   /db_xref="InterPro:IPR021578"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKU9"
FT                   /protein_id="ACP34474.1"
FT                   /translation="MEITFPTQHDIQALAKILSDPIFTLYKILGAETVSVKGNEFDALI
FT                   SLGVTSLILHGTVYVGNNKVSYKFYSVGTQKGEGGVLEFDLFKEDEIRLIVEFEGRFAS
FT                   FIKFSLRRKIEKNIKRFDEEVRLERIKRKI"
FT   gene            complement(269746..271137)
FT                   /locus_tag="LS215_0322"
FT   CDS_pept        complement(269746..271137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0322"
FT                   /product="Vinylacetyl-CoA Delta-isomerase"
FT                   /EC_number="5.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34475"
FT                   /db_xref="GOA:C3MKV0"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKV0"
FT                   /protein_id="ACP34475.1"
FT                   /translation="MRSKEDFLKSLKDGRNLYYRGKLVEDITTHQILKTAALHAAKLYE
FT                   YADRVYEDNKMGKMSKFFKVPWTSQDLLDRHKLIYDLTMYCNGVFNISQAIGSDAIFAL
FT                   MITAKQVDRKYGTDYSKRVEKYFERVAKEDLTLATAQTDVKGDRSKRPSEQVDPDMYVR
FT                   VVDVKSDGIVVRGAKAHTTQSAVSDEIIVIPTRVMRDSDKDYAVAFAVPANTKGLKMYI
FT                   RPIDEIEGNSSSVLSRKDYELETLTVFNDVFVPWDRVFLFKEYDYAGTLAMLFATFHRF
FT                   TALSYRSATMNLYLGASKVASQVNGIENEKHVRDDIVDIILYKEIMRSSAIAAAVYPVN
FT                   MEGIAVPNPLFTNVGKLYSNMHFHDVVRDLIDIAGGIIATMPSQEDLESDEGKNIVKYL
FT                   RGSVDGEERAKVLKLAKELGASTFTGYLLTGMIHAEGSMEASKIELFRSYNFKEAENLV
FT                   KRVLS"
FT   gene            complement(271250..271769)
FT                   /pseudo
FT                   /locus_tag="LS215_0323"
FT   gene            complement(271931..273418)
FT                   /locus_tag="LS215_0324"
FT   CDS_pept        complement(271931..273418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0324"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34476"
FT                   /db_xref="GOA:C3MKV1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKV1"
FT                   /protein_id="ACP34476.1"
FT                   /translation="MYKSTKLTFIRYIYEVIDVSNHMSSKLDEYLARIDRLPTWGLSYA
FT                   LLWAIGFSYFITLYDAVGNIGAALPYIPFINASQASLIASLGLFGYIPGSLGLGYLADR
FT                   IGRRTVLIITVLLTAIGSLGMALSVNFPMLAVFRFIEGAGIGGDLNLAMVYISEFAPSA
FT                   KRGKYANWIYAAGWIAVGIGSTIAALLVTGLPSIGWRLAFGIAAIMAVAALVIRIRAPE
FT                   TVRFLVKKGRINEAESIVRIMEETAMKRARVQSLPEPKIINYSYQTTNPFSILAKRVFT
FT                   KRLVGLLLFWFFIYFVQYTFSTLWDYYGKFIGYSGTMLNQFVLLTGFSALGDTLMAFLL
FT                   LIIIERTDRRLITQIGSIGWLVGMIVASYFAVHFNLLGMALTLGLITNAIGGGMSYLAG
FT                   YLMSSESFPTAARSTGFAITDGLGHLGGAVGPLLLFPLVVATGPINAWAIEAFPVVIAA
FT                   VILWFTVPRTVGVRLEEINEIHLTPQQPQGGIIKSEK"
FT   sig_peptide     complement(273347..273418)
FT                   /locus_tag="LS215_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.949 at
FT                   residue 24"
FT   gene            273658..274257
FT                   /locus_tag="LS215_0325"
FT   CDS_pept        273658..274257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0325"
FT                   /product="regulatory protein TetR"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34477"
FT                   /db_xref="GOA:C3MKV2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKV2"
FT                   /protein_id="ACP34477.1"
FT                   /translation="MVIQMYRYPKTEKGKESLNKIITASLDLISEKGFLNTSISDITNK
FT                   AGVAYGLFYFYFKSKHDILDELIRKFNTDMRYYLKVNTMGIQNRIEMEKEGLAKFLEWM
FT                   SQNKKYYKVFVEAQVHRPEMYIWHFTKLAERYKIGLKEAMDRGEIVKVDPELLAYVLIG
FT                   IGEMIGRRYILWTNQGLNKKQYNDLAILIENMLRPK"
FT   gene            complement(274259..274702)
FT                   /locus_tag="LS215_0326"
FT   CDS_pept        complement(274259..274702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34478"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKV3"
FT                   /protein_id="ACP34478.1"
FT                   /translation="MAEFVYPSKEWAEEWCKLLNESKEYNDAGKGWVSPILFVATDIPI
FT                   QVLDYLGVKGTNAIAMKLYLNNGKCQGTEFFSDISKADAPYVLEASYNSWKDIISGKLQ
FT                   VVSALLSGTIKLKKGSLFDLARYTTASVVMANISNKINTKFLV"
FT   gene            274793..275935
FT                   /locus_tag="LS215_0327"
FT   CDS_pept        274793..275935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0327"
FT                   /product="acetyl-CoA C-acetyltransferase (acetoacetyl-CoA
FT                   thiolase) (AcaB-6)"
FT                   /EC_number="2.3.1.176"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34479"
FT                   /db_xref="GOA:C3MKV4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKV4"
FT                   /protein_id="ACP34479.1"
FT                   /translation="MIVGFAGKLSKNYEKDGIELLKEAIDEALEMAGLNYADIDGIMAN
FT                   IGRGSFHVNKTYLNPPAQISEYFGIKPKIIDHVQYGGPSVLSMIYRAYKAIKTGDAETI
FT                   LCIQGGKISHLKDNHFQKTDIIDSPFDDYIKIYDQMSPISDYAMVTYRHSKLFGTTDEQ
FT                   RAEIAVMQRYNASFNPKALFRNPITVEDVLQSRIVSYPLHLLEIVYPIDGFHVFVVSKR
FT                   SSKSALRNIDILAYGEAHWPNPPAEWDDIIYTPAIESAKRASFDLNRVDTFQLYDSFTI
FT                   TVMLQMEDIGLVEKGKVGQFVESHDLTFKGDVPINTGGGSLNTGQPAYMSGGVILEEAL
FT                   LQLNDMADGHQVKGTDVVFLNGIGWWSRRHSVTLVLGERK"
FT   gene            275932..276288
FT                   /locus_tag="LS215_0328"
FT   CDS_pept        275932..276288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0328"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34480"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKV5"
FT                   /protein_id="ACP34480.1"
FT                   /translation="MRDDEIRESYFKYFNEEKLPFIQCKNCGHRFYYPRAFCPKCGSSD
FT                   VEVRFSEGRGKIFAMTKIYRKDGSYVIYGIVELEEGFRMYSNIVEGSQADIAKRVEVIF
FT                   KEINGKKYPLFKVI"
FT   gene            276356..278026
FT                   /locus_tag="LS215_0329"
FT   CDS_pept        276356..278026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0329"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34481"
FT                   /db_xref="GOA:C3MKV6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKV6"
FT                   /protein_id="ACP34481.1"
FT                   /translation="MEIIKGFPSTMMDDYQLNVKQILEHAGKWYGEQEIVSRKKDNTIF
FT                   RYNYREAFRRVKKLASSLKSLGVKVGDRVGVLEWNTHRFYELYFAIPATGAVMLELNPR
FT                   LHPLQLAKIINHSKVSFLFLNEDFIPIVESISNNIPSVKKLILISDTEKMHRNSYYDYE
FT                   TLVEEGDEEYEISMFDERTSCYAAYTTGTTGDPKGIYYSHRSIVLNTLVISRNITIDDT
FT                   FMQLVPMFHVNGWLGFMATTLVGAKLVLPGRYTADNPRPLVDLMINEKVTVTAGVPEVF
FT                   SSILNYLRNMENKPLFVNSRILIGGSEPPLSLVIGLMEFGFQVGQGYGATETTPSVAGS
FT                   VVKPKIKERYSEKDMLDLLRKQGIPAFGIDIKVVDPSTGKEVPHDGKTIGELWIRGPWI
FT                   ASAYYNDPRTVESFVGDGVDRWWRSGDLAVVDELGYIKIVDRIKDVIKSGGEWISTVDL
FT                   ENHLMTHPAVAEATVIGIPHPKWGERPLAFVVLRQGFENQVSKQELLGYLSQRFAKWQL
FT                   PDDIIFVKEIPKTSVGKFDKKVLREKYRDFFTSDRKESI"
FT   gene            278050..279162
FT                   /locus_tag="LS215_0330"
FT   CDS_pept        278050..279162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0330"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /EC_number="1.3.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34482"
FT                   /db_xref="GOA:C3MKV7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKV7"
FT                   /protein_id="ACP34482.1"
FT                   /translation="MSKNEDELEEYRSKIREWIRNNVPEEISSKGDMAPPEILREWQRR
FT                   IYEAGYLGVSWPKEYGGWGENPIKEIIVREEFAKAGVPYATVGLGVSVVGPAIILNGTE
FT                   EQKKKYIRRILTAEDIWCQGFSEPQAGSDLAGIKTKAEDKGDHFLVNGQKIWSSYAHLA
FT                   NYCLLLTRTGDVSERHKGLTMLVVDMKSEGIRISPIKQITGRSEFNTLYFSNVKVPKEN
FT                   VVGNVGEGWKVAMSTLNYERLNIGTILFTVERLVRELSINNEQLFNTAEDIVALKSFYK
FT                   RVLERLKKGYVAGPEAAVIKLVASEAIQRVYENAVANAGIEGLVMENGAGFRPEIIYGL
FT                   LASRAITIAGGTSEILRNLLGEVVLGLPKG"
FT   gene            complement(279189..281180)
FT                   /locus_tag="LS215_0331"
FT   CDS_pept        complement(279189..281180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0331"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /EC_number="1.1.1.157"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34483"
FT                   /db_xref="GOA:C3MKV8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKV8"
FT                   /protein_id="ACP34483.1"
FT                   /translation="MKVEDIKKVLVVGAGTMGHGIAEIAAISGYKVYLSDISQDILNSA
FT                   LERIRWSLSKLQERGQIKESIDTIMSRITTILGLDKTVSDADFSIEASTERIDIKRQVF
FT                   SKLDELLPSHAILATNTSSLPITKIAEATKRPDKVVGMHFFNPPVLMQLVEVMKGDKTS
FT                   DETAKITYDLAKRFGKQPIMINKDVPGYVVNRILGQINVASCILVEKKVADYREVDAVA
FT                   RYKLGFPMGVYELIDYTGVDVAYYVSKSREELGIRDDIPICSLIEQKFKNNELGVKTGK
FT                   GFYTYPGPGKYVKPELPKELADKLNPVLILAGAVNEAARLLREGIASRDDIDLGVRLGL
FT                   GLPKGIFQYADELGIDSVVKALEDLKALSGYSVFSPDPLLTQMVGENKLGIKTGSGFYT
FT                   YGKVEEKKLNTLIIRIEPPLAWIILNRPERLNALNPELVSELDRSLDELEGRNDVRVVI
FT                   ITGNGRAFSAGADVSSFITLRPIDVIRLRTLRNVVNKIALYTKPIIAGINGFALGGGLE
FT                   LAMACDIRIASEVAQLGQPEINIGIIPGAGGTQRLPKLVGKGKAKLMIYTGDMVSAEDA
FT                   YKMGLVDLVAPANRFEEEVRRVALKIAEKSPISLLAAKLAIELGYESNIWIGQTLESTL
FT                   FGLLFTTKDVEEGVKAFLEKRKPQFKGE"
FT   gene            complement(281262..282194)
FT                   /locus_tag="LS215_0332"
FT   CDS_pept        complement(281262..282194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0332"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34484"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKV9"
FT                   /protein_id="ACP34484.1"
FT                   /translation="MTIFTLKLPMQGPLKYINTYLVKDNEEGILIDTGLPTQEDVITLT
FT                   NYLKVHGYPNLVVITHYHPDHMGLVRLFKDKSDILISDREFEYIAYLVSEEYEKEMRQY
FT                   LLANGFPEEFIQKMFKNRSRFNEIIDSVNFNTVKDGDVVKFGQGQMRVLLTPGHTMGHI
FT                   CLAYDKVVFCGDHILQDITPNVSLLRLEDNPLKAYLESLDRIERLSVEQLYPAHGEPFK
FT                   DVSKRVEEIKEHHKKRLEEIKNIISVLRRANGFDIASRISWYKKWDELSTFDKQLAMGE
FT                   TLAHIKYLVEEGVIREINNTNSIYYTMSS"
FT   gene            282403..283869
FT                   /locus_tag="LS215_0333"
FT   CDS_pept        282403..283869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0333"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34485"
FT                   /db_xref="GOA:C3MKW0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKW0"
FT                   /protein_id="ACP34485.1"
FT                   /translation="MYKSKKLTFIRYFYEFIDLSNLMSSKLDEYLARIDRLPTWGLSYA
FT                   LLWALGIGYFATLYDAVSNLGYALPFIPFINATQASIIVSVGLAGYIVGSMGFGIASDR
FT                   IGRRPILIVTFALLGIGSLGMGLATNYFTLFIFRVLEGIGIGAALNLAMVYVAEFSPST
FT                   KRGKYANWIFISGWTAVGAGTVVAAFIVTISPTIGWRIIFLLPGVLALITTVILAISSP
FT                   ESVRILVKKGKIQDVERIVNRMEEISMRRAKMESLPQPKIVHYEEIPSYSQLKILREPK
FT                   YLKRLISLTVFWFFIYFIQYTSTGLGPTFVKVVVGFSPAQYAEYIRLSGFAAIGATIIS
FT                   FLLLGIVERTDRRLLTQIGGIGFLVSSFVSTYLLLNKELITWFITYFLLEFILNPPYLA
FT                   GYLMSSEAFPTAVRSTSFAITDGIGHLGGVVGPLLLFPLIGIIGPLPAWIVLGFPVPFA
FT                   AALLWFTIPKTVGVRLEEVNEAYREGATQR"
FT   gene            284020..284361
FT                   /pseudo
FT                   /locus_tag="LS215_0334"
FT   gene            284514..284681
FT                   /pseudo
FT                   /locus_tag="LS215_0335"
FT   gene            complement(284752..285672)
FT                   /locus_tag="LS215_0336"
FT   CDS_pept        complement(284752..285672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0336"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34486"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKW1"
FT                   /protein_id="ACP34486.1"
FT                   /translation="MEVQYKFERISDNVYAFIQPNGDWFLSNTGVIIGKNYAIVVDSLT
FT                   NEKMTKQFISEIRKVTDKPIKYLINTHEHEDHLWTNHLFPNAITICHKNCREKVVEGMK
FT                   RGSNPYEKLFSTIDFSGYKYTPQEVVIDDEMRIFIDDDEVRIAYVGYAHTISDIYVYVP
FT                   NKKVVFTGDLLFSPPCTPFALMGYIQGYINTLENLANLNAEVYVPGHGEVSYDRKTLYE
FT                   SRDYLIFVRDEARKLMKNIDDPIRAAYEVNLGKYEEWISKERIIGNLARAYSELKGNPP
FT                   ASKLENIDKILVEMVKYREKKGGIK"
FT   gene            285714..286667
FT                   /locus_tag="LS215_0337"
FT   CDS_pept        285714..286667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0337"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /EC_number="4.1.1.68"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34487"
FT                   /db_xref="GOA:C3MKW2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKW2"
FT                   /protein_id="ACP34487.1"
FT                   /translation="MKLLSFVKDNRVRSGVLVNDEHVADLNTSCYLMLMEKGEDEQFVE
FT                   RYCQAIVPPDMLSVLQAGDRGLEMVKEILEWAKKRNEVLYNINHVKLKAPLLRANMLRD
FT                   FLAFKGHVEATYRRRGQPIPEEWFKIPIYYKGDPAIFYGHLEEVPWPKYSNHVDIELEI
FT                   AAIIYKKGKDIDKRKAKDYILGFAIFNDFSARDIQMAEMKGLLGPAKGKDFANGLGPWI
FT                   VTKDELSDIKGLGVYAKINDEIWCDTRAEDMQWTFEEMIEYVSQDEHIRPGDVFGSGTV
FT                   SGCTGLDIGKSLKPNSSIELYVEKIGILKNVIVKNQ"
FT   gene            complement(286661..287590)
FT                   /locus_tag="LS215_0338"
FT   CDS_pept        complement(286661..287590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0338"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /EC_number="3.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34488"
FT                   /db_xref="GOA:C3MKW3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKW3"
FT                   /protein_id="ACP34488.1"
FT                   /translation="MPLDPQVKDLLTKINSLLPTTPLTPQEFRKVRNELFVNLFNKEKV
FT                   ELNDIRNMTISGSNGDIKIRLYFPSLKENLPAVVYYHGGGFVYGNLDTHDSVCRLISKL
FT                   SNTIVVSVDYRLAPEHKFPTQVYEAYDVVKWLANNGGKLSIDTSKIAVAGDSAGGNLSA
FT                   VVSILDRDNKDNIVKYEVLIYPVVNMLDSSPSIYNYGDGYFLTYERILWYNKQYVKDDN
FT                   DYYNPLASPVFANPHNLPPALVITAEYDPLRDQGEIYAHKLKMSGVKAISLRYNGMIHG
FT                   FVSFYEYLDVGREAIHHIASSIKKIFNY"
FT   gene            complement(287624..288568)
FT                   /locus_tag="LS215_0339"
FT   CDS_pept        complement(287624..288568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0339"
FT                   /product="Aryldialkylphosphatase"
FT                   /EC_number="3.1.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34489"
FT                   /db_xref="GOA:C3MKW4"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKW4"
FT                   /protein_id="ACP34489.1"
FT                   /translation="MRIPLVGKEPIEAEDMGFTLIHEHLRVFSEAVRYQWPHLYNEDEE
FT                   LRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFMEKVVKDTGINLVAGTGIYIYVDLPF
FT                   YFLNRSIDEIADLFIHDIKEGIQATSNKAGFVKIAADEPGITKDVEKVIRAAAITHKEA
FT                   KVPIITHSNAHNNTGLEEQRILMEEGVDPGKILIGHLGDTDNTDYIKKIADKGSFIGLD
FT                   RYGLDLFLPVDKRNETTLKLIKDGYSDRIMISHDYCCTIDWGTARPELKPKLAPRWSMA
FT                   LIFEDTIPFLKKNGVSEEVIDIIFKENPKKFFS"
FT   gene            288648..290330
FT                   /locus_tag="LS215_0340"
FT   CDS_pept        288648..290330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0340"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.3"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34490"
FT                   /db_xref="GOA:C3MKW5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKW5"
FT                   /protein_id="ACP34490.1"
FT                   /translation="MNQSILSDRPWFKYWPPKLPKSLDYPEVPLFNIVEVSSQRYPNKT
FT                   AIIYYGNRITYRELWEIILRFSAFLHNELKVRKGDRIAVFMPNSIQWVIAYFGILRANA
FT                   ILIPINPLLAEDELNYILRDSGSVGVITLSSYLNKVLKAKENTHVKWVIAGKFKDYLPE
FT                   KPEIKVHPLMQKEPELSDDVIPWKETLRNNYTPPSVEVRAEDIAVIPYTSGTTGVPKGC
FT                   IHTHSTIWPTILGSVIWNTLAPSAVTLSSLPVFHVTGFVHSLNAPLYVGSTMVLLTIWD
FT                   REAALDAIEKYKVTHWTNISTMVVDLLATPGVEKRNLSSLMLVGGGGAPMPEAVARKLK
FT                   ELTGLDYIEGYGLTETMSQTHVNPPQRPKLQCLGIPHFGVDALIIDPSTGEVLPPNREG
FT                   EIIVRCPSLFKGYWNNEEETRKSFITVNGLEYFRTGDLGYMDEEGYFFILDRIKRMINR
FT                   AGYKVWPTKVENKLYQHPAVLEACVVATPDPRTNEEVKAYIVLKPEYKGKISAEEIREW
FT                   CKQHMSAYEYPRVIEFVDSLPKSGSGKILWRILQEKEKGISNK"
FT   gene            complement(290387..290830)
FT                   /locus_tag="LS215_0341"
FT   CDS_pept        complement(290387..290830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0341"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34491"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKW6"
FT                   /protein_id="ACP34491.1"
FT                   /translation="MDFKGIFEVKKKINAAKEFLTNPKQFAECLPGLQSYEVMNNAFKA
FT                   NFKLDVSQMKIPHMSTLTALITANILEKETSVEINGNGRSAGVGIKFNIVMGLEEGEEI
FT                   TRVSWFARVDLGMLSKLLGEDNIRRIAEPNISHIINCISSKLS"
FT   gene            complement(290834..292132)
FT                   /locus_tag="LS215_0342"
FT   CDS_pept        complement(290834..292132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0342"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number="1.1.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34492"
FT                   /db_xref="GOA:C3MKW7"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKW7"
FT                   /protein_id="ACP34492.1"
FT                   /translation="MEIKSTVTVIGGGISGLFTALDLALRGIDIILVERSDIGSGTSGK
FT                   FHGLLHSGARYAVSDPESAKECIQENKIISKIAPHAVKDTGGVFLGITNDDLQFSETFM
FT                   KALKEVGIEHKVVDVNELLQSEPFINRDTKLAIWVPDKVVYGYDLMASVAVTASLNGAK
FT                   ILTYNEVVEFIRDKDSVKGVKVFDKINNTTNVIKSDFIVNTAGPWSFKIIRMAGLEEIP
FT                   IMPTAGIMTVFAQRVNNMVINRLRPPSDGDIIVPYADSSILGTTATIIEDPDNFTMSDE
FT                   DINMLVSEGAYLIPKLKEMKVVRSYASIRPLIRIDVSAREATRDFRLIDHEKENGLRGL
FT                   VSVIGGKFTTGRLVGERVADLVSSKLGIKSVSKTAMTKLISPLDINLLDYAERIGIPKV
FT                   VVKSILDRKGSLDEERYLSSLYIFLSLISRGRI"
FT   gene            292315..292911
FT                   /locus_tag="LS215_0343"
FT   CDS_pept        292315..292911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0343"
FT                   /product="carbohydrate kinase FGGY"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34493"
FT                   /db_xref="GOA:C3MKW8"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKW8"
FT                   /protein_id="ACP34493.1"
FT                   /translation="MPNSFILAIDEGTTSARAIIYNQDLEIVGIGQHEFPQHYPQPGYV
FT                   EHNPHEIWNSQMLAIKEAMEKAKIEGKQITGIGVTNQRETIILWDVKSGKPIYNAIVWQ
FT                   DRRTSHTTDWLKANYFRMIKDKTGLVPDPYFSASKIKWILDNVPNAREKAERGEIKFGT
FT                   VDTYLIWKLTNGKVHITDYSNASRTVLFNESYLFR"
FT   sig_peptide     292315..292410
FT                   /locus_tag="LS215_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.881 at
FT                   residue 32"
FT   gene            complement(292882..293917)
FT                   /pseudo
FT                   /locus_tag="LS215_0344"
FT   gene            293392..293654
FT                   /pseudo
FT                   /locus_tag="LS215_0345"
FT   gene            complement(293969..294841)
FT                   /locus_tag="LS215_0346"
FT   CDS_pept        complement(293969..294841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0346"
FT                   /product="ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34494"
FT                   /db_xref="GOA:C3MKW9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKW9"
FT                   /protein_id="ACP34494.1"
FT                   /translation="MIEEEKNNYSVFHGLWTLASRELKKWYKAPVILLLSLIQPIFWIG
FT                   IFGKAMNLGSIFTGTSYNIPGLTIPKQVLDQIGLEILKQTFGTSDYFSFLAAGMLSFIV
FT                   LFTSMQSGMSIVWDRRLGVLDRILTTPVARGNIIIGKVLSAVIRSLVQATIVLVVAILL
FT                   GMTFYPGINPLDFLGVYAALFLMAFGLSSLFLMLALRATSWESQMAIMNLLNLPLLFTS
FT                   NAFYPVKSMPYWLKPVAYINPLTYSNGVARGLLLGISTNLGLDFLYLGLFALILSTIGI
FT                   VLSWKYLSK"
FT   gene            complement(294838..295836)
FT                   /locus_tag="LS215_0347"
FT   CDS_pept        complement(294838..295836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0347"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34495"
FT                   /db_xref="GOA:C3MKX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKX0"
FT                   /protein_id="ACP34495.1"
FT                   /translation="MRNLAIKAINLTKRFGKSVAVDHINFEVYEGEIFGFLGPNGAGKS
FT                   TTIKMLTTVLTPSEGTAIVNGYDVIKQPAHVRQSIGVVPQEYTADEDLTGWENMMMMAG
FT                   LYGIPKKVAEERSKELLEMVELTYAAKRKVETYSGGMRRRLEIAMSLISRPRILFLDEP
FT                   TLGLDAQTRAAIWQYIMKLKEEYKMTIFVTTHYLEEADMYGDRIAIIDKGKILAIGSPK
FT                   ELKEKIGGDLVSLQTNNDELAIKVVSSIDGILNVKKANDGIRIKVRNGEEKAPEILESL
FT                   VKNGIKVSRMSITEPTMDEVYMEFTGKRLRDEDASAQEMFAFRRTMRRART"
FT   gene            complement(295829..296236)
FT                   /locus_tag="LS215_0348"
FT   CDS_pept        complement(295829..296236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0348"
FT                   /product="transcriptional regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34496"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKX1"
FT                   /protein_id="ACP34496.1"
FT                   /translation="MSELIVRQKGRLRLMTLWLLWQSPKRGIDIIDDINKMSWGFWKPS
FT                   PGSIYPLLNKMVEEGTIERTSDGKYKITAKGIEEIKEILPIKQINSIEDSIQELEGLAQ
FT                   FFKEVEKNKLFEYKERILNAVKEIEEVVKGA"
FT   gene            296713..296859
FT                   /locus_tag="LS215_0349"
FT   CDS_pept        296713..296859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34497"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKX2"
FT                   /protein_id="ACP34497.1"
FT                   /translation="MANRRQPTAIIGVRRIGKTSVILKGLKMVETPKVYLSAVLCGLFQ
FT                   FIS"
FT   gene            complement(296923..297743)
FT                   /pseudo
FT                   /locus_tag="LS215_0350"
FT   gene            complement(297795..298289)
FT                   /locus_tag="LS215_0351"
FT   CDS_pept        complement(297795..298289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0351"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34498"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKX3"
FT                   /protein_id="ACP34498.1"
FT                   /translation="MVYSSSYRIILSANYLNRSPFFISMEDPKIIEEIFKNADHVFRYV
FT                   GAKVLLLEQGRAVVEIPFKEELTRRGNVLHGGIIMTAIDFTGGLAAFTVNDGVDQVTQE
FT                   LKVNFLEPMYKGPFRVEGKVLRKGSTVIVVEIEFRDAEGNLGAKALGSWYILRKKVQGA
FT                   L"
FT   gene            298492..299389
FT                   /pseudo
FT                   /locus_tag="LS215_0352"
FT   gene            complement(299822..300085)
FT                   /pseudo
FT                   /locus_tag="LS215_0353"
FT   gene            complement(300478..300849)
FT                   /locus_tag="LS215_0354"
FT   CDS_pept        complement(300478..300849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0354"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34499"
FT                   /db_xref="GOA:C3MKX4"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKX4"
FT                   /protein_id="ACP34499.1"
FT                   /translation="MLEELCKIYSKFNPKLVILFGSYARGDYTSESDIDVLVVSDIFSR
FT                   DPRESFGMAYNLKFPQVMPVAMNTQVFLKKLDEGSTFILEIIEDGKILCGEKEFEREVL
FT                   ERYKKIRKRFRRKGRLWEW"
FT   gene            complement(300830..301222)
FT                   /locus_tag="LS215_0355"
FT   CDS_pept        complement(300830..301222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0355"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34500"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKX5"
FT                   /protein_id="ACP34500.1"
FT                   /translation="MVSRVDDWLRQAERNLRSAEINYQNELYEEACYESQQTAEKAVKA
FT                   LLSYFHKELRGHSITFLLQSSSIQIPSEILKCAQELDKHYIPSRYPDAYDQGAPADYYN
FT                   KDDADRCLNCGKRILSWVEGIVRGTV"
FT   gene            301882..302196
FT                   /pseudo
FT                   /locus_tag="LS215_0356"
FT   gene            302351..302611
FT                   /locus_tag="LS215_0357"
FT   CDS_pept        302351..302611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34501"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKX6"
FT                   /protein_id="ACP34501.1"
FT                   /translation="MSWKLKDLKGLSAPTDVKMCTVDDVVRQLEDKYKIDVEILTKIAT
FT                   DVLVKHLTEKKITIEDIKKNYSNVKDIDNIIEDILRLSGKL"
FT   gene            complement(302588..302989)
FT                   /locus_tag="LS215_0358"
FT   CDS_pept        complement(302588..302989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34502"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKX7"
FT                   /protein_id="ACP34502.1"
FT                   /translation="MQDPVCKMEVENTTPYRINYRGITYYFCSKGCLDEFKKNLTKYVS
FT                   PADLNKKIDVKIVYCRPCKYMDRALNLARDILSYFEEVNVELVQGDRGILDIYVNDELV
FT                   FSRYIEKRFPESEEILKSIGQKLQLARQS"
FT   gene            303335..304558
FT                   /locus_tag="LS215_0359"
FT   CDS_pept        303335..304558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0359"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /EC_number="1.18.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34503"
FT                   /db_xref="GOA:C3MKX8"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKX8"
FT                   /protein_id="ACP34503.1"
FT                   /translation="MREKSCDYLIIGSGIAGYNALKELLELKPNSKIIMVSSDKYYPYD
FT                   TPPLSKYYLRGEMAREKLFFESEDFYKRGNLDVVLNRSVERIDTDSKEAVLNDGSVISF
FT                   DRALIASGGRPRRLSVPGGENALYLRTLDDCDGIREVASRSRNALIIGAGFIGVEVASS
FT                   LTTLGVRTTVVEVMPYIWNTFVDEKVSMVIRQYLEGKGISFILNESVREIQGKAAITSG
FT                   GKRLEADMFLIAVGIVPNVEVAQKSGIQVDNGIIVNEYLETSAKDIYSAGDIANIFDPR
FT                   EGRRKRIEHWNNAEYTGKLAARNMAGNREAYNFISSIWSDIFDIHIESAGETRNYDEYV
FT                   IRGRFNSDNPNFNVIYLKGGIVKGYVAINRDYGELEVLNKLIKEGKDVSNKKNSLADEG
FT                   FDLKELLK"
FT   gene            304669..304851
FT                   /locus_tag="LS215_0360"
FT   CDS_pept        304669..304851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34504"
FT                   /db_xref="GOA:C3MKX9"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKX9"
FT                   /protein_id="ACP34504.1"
FT                   /translation="MIPVAIVLGFHTLLTKLITVYSSPMIVSAVRVTIGSVFFILLGKG
FT                   LSIGVKQFINGLFNW"
FT   gene            complement(304852..304980)
FT                   /pseudo
FT                   /locus_tag="LS215_0361"
FT   gene            305099..306064
FT                   /locus_tag="LS215_0362"
FT   CDS_pept        305099..306064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0362"
FT                   /product="cellulase (endo 1,4 beta glucanase), putative
FT                   (CelB)"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34505"
FT                   /db_xref="GOA:C3MKY0"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKY0"
FT                   /protein_id="ACP34505.1"
FT                   /translation="MNKLIPILVVVIIILGIITFLEFGKFQQNTSLTKSTSIYALFPGR
FT                   NHSFNIVANYSGNYADALVIVNSSTNATLMASPFLWNIGYALGNVNMTFNNYLHVAINL
FT                   SQINKISLNVVDGYPGLMYGQELWWPFEYRTAQLKSLSLPMVVSQLPNFYSILNYSVYL
FT                   INGSIDDFSYDIWLSQNPNVTSLQYGDFEVMIWMYWSENLSHVPFFIYVGNMTIPTLIN
FT                   GKIENLSWEVYVLPRTGSANGWTGVYFLSPLKEREVECGVPIAYILKNMGQFIENAGMN
FT                   VYNPNTYYLDAIQVGMEFSDNHGTAIMGYYLYSWRIWLLS"
FT   gene            complement(306053..306466)
FT                   /locus_tag="LS215_0363"
FT   CDS_pept        complement(306053..306466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0363"
FT                   /product="protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34506"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKY1"
FT                   /protein_id="ACP34506.1"
FT                   /translation="MKVYFEDIRVSTTRQFELVDITDQVEEIVGKSGVKNGICLIFVAH
FT                   STAAIVANEHERGLMEDILTKIKEFTEPSRGWKHNLIDDNAHAHLGATFLGAERVFPVR
FT                   DGKLVRGTWQNIFLVELDGPRSERHITVEILGE"
FT   gene            306508..306645
FT                   /locus_tag="LS215_0364"
FT   CDS_pept        306508..306645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34507"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKY2"
FT                   /protein_id="ACP34507.1"
FT                   /translation="MREISIEWSGKILVLSDIHYPHCDIEEINKIMLSEKPSHTILLGV
FT                   "
FT   gene            307066..307929
FT                   /locus_tag="LS215_0365"
FT   CDS_pept        307066..307929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0365"
FT                   /product="transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34508"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKY3"
FT                   /protein_id="ACP34508.1"
FT                   /translation="MEYLEITDFGRASLSYPAGWHSHHGLYHFRWGKVFLFSFLFATTM
FT                   TRYKLSAEVSFSRPSEVMGKLYMIPYKDNGQKVLYFDIDYPSFCKVSVNQDRFRNEYLS
FT                   FDCNPSGYFSISINYEVEIYSFSKFENEENVFLSSSKYVNIDKFRRFNIPYSSLDDLLN
FT                   KITSFIRGSIKYDKNNSSVKSAFGSLIMGSGVCVNYSHVTLGILRALGIPARYVVGLIP
FT                   YSTKEAHAWVEVKVNDVWFPVDPTNATKGIQYLKWAIGRDDADVRSKIWYRKPTSFDFS
FT                   FNWYFR"
FT   gene            308283..308504
FT                   /pseudo
FT                   /locus_tag="LS215_0366"
FT   gene            308742..309206
FT                   /locus_tag="LS215_0367"
FT   CDS_pept        308742..309206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0367"
FT                   /product="regulatory protein AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34509"
FT                   /db_xref="GOA:C3MKY4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKY4"
FT                   /protein_id="ACP34509.1"
FT                   /translation="MGVNIIRLDDTDEKILEILRYNAKKSLKELSDELGIPISTVRYRI
FT                   KRLEDAQIIRGYVAIIDRVNLGLNVSLVMEIETVPYSIKKVAQELGEIPEVVRIYGLDN
FT                   GPRLHVHMIFKDDASAHQFIANKLYNIKGIKTVSISRIIERYKIDPSVLL"
FT   gene            complement(309260..310276)
FT                   /locus_tag="LS215_0368"
FT   CDS_pept        complement(309260..310276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0368"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /EC_number="1.2.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34510"
FT                   /db_xref="GOA:C3MKY5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKY5"
FT                   /protein_id="ACP34510.1"
FT                   /translation="MVEKEMEEKVYKSIIKTIKDTPLEEFYTSGHRTCQGCESALVMRF
FT                   LAKAAGQRTIVIGATGCMYVANTTYYSTSWIVPWVHTQLGGSGAAALGTAAALRALMRK
FT                   GKIKQEPINVIAFCGDLGCADMGLSGVSNAMTYDYNLLIVLYDNESSANTDIQETSMTP
FT                   YGAQTSFSRPGKQRRIMKKRWKKSVVPMIIAGHRNIRYAATMTPAYPLDSINKIKKALA
FT                   IGGPTFIHSLDPCPKGWDYDPRFSHELGVLAAETGLWPLYEYTDGEIAYNEPTKSIVEG
FT                   RMKRKPVKEYLEKQGRFSHFTEEDIEHIQRMVDEMYEEWEIPGVMPIKSLNVKISDK"
FT   gene            complement(310295..311542)
FT                   /locus_tag="LS215_0369"
FT   CDS_pept        complement(310295..311542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0369"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /EC_number="1.2.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34511"
FT                   /db_xref="GOA:C3MKY6"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKY6"
FT                   /protein_id="ACP34511.1"
FT                   /translation="MTEVKKLVEKEVLMNGTQAVAHAAMYADVDVVAAYPIRPYTEVMD
FT                   TISKLIADGELDAEFIVAEGEHGQFETVKHASLVGARTLVGSSGVGWLYGMEAIVVTAT
FT                   DRAPVVAIIGNRALDDPGAYGVEHNDALMVRDVGWLLVWVDTAQEAFDTTLIAYRVAED
FT                   QRVLLPLGISMDGGFLTHSEQIVRLPPKELVKNFLPPYNRGKYLVHPDNPITVAPQVNE
FT                   DWVMEIRRQHEEAMERARGVIVEAYEEFKKVFGRYPGSTNELQMPENPFVEPYMVDDAE
FT                   VVLIGMGTVSKPMKVAIKSMRRQGYKVGMLRIRWFRPFPTQDVIKYLANSRVVCVVDRD
FT                   YSMGSPNRGGVIYHEIRSSLYDLDQRPRVMSFIGGLGGREITIQDVKKIIKIGYEHRDT
FT                   PITKPVYWVGVRGDPW"
FT   gene            complement(311539..312630)
FT                   /locus_tag="LS215_0370"
FT   CDS_pept        complement(311539..312630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0370"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34512"
FT                   /db_xref="GOA:C3MKY7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKY7"
FT                   /protein_id="ACP34512.1"
FT                   /translation="MGVKDEVKYVEIVYRGIFQKRLAKYIAEGIVYTAREMGRPALSFG
FT                   RYGDSPERNGVPAKYYVGIGNGVNEEDLIGYSTRVEPDLVDTIIVLDDTLLKGVESWAW
FT                   QGVQPINLKLKSNGTMLVTSTKRINELLKMIPKKDFNWTLGVINTEPSFSGLWAFKDDL
FT                   TMEKVWGGLAKLRPDIIDLDHLIKYVSKKQDANKRISAVKEAYSSVDYRTVMKGEGIDF
FT                   VYNPPRLLTWHEMLEGTVIPAVPRGKRNELFKRGTTKFERPTVDFDTCIKCKLCWIYCP
FT                   DECFDETPDGYYDIAYDYCVGCGICADVCPVKDCIVMVDESMFTDYRRPYEMWKENKAK
FT                   YKEWLKNVRQARKERVYVPGLGR"
FT   gene            complement(312841..314133)
FT                   /locus_tag="LS215_0371"
FT   CDS_pept        complement(312841..314133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0371"
FT                   /product="Oxalate/Formate Antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34513"
FT                   /db_xref="GOA:C3MKY8"
FT                   /db_xref="InterPro:IPR004741"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKY8"
FT                   /protein_id="ACP34513.1"
FT                   /translation="MMSNKWLEKGWFRWFLVVAATISMALVSVYEYSWTLYTVPLGKVF
FT                   NVAPGSAALGLTFTIYIIVQALSMFVAGRIADRYGPRLISMLGGIVTGIGYVSSAFANS
FT                   LPLLYLTYGFGSIGVGIIYGTAISTAVRWFPDKRGLATGVIEIGFGGGSFALSPLIQYI
FT                   ITSISYRTALVYLGITQLVVITLLAYFFAYPPPQWLPKGFNAEEYERKRKMIKRSKSDF
FT                   SVSQMVKTWQWWVIYIAFFLIAGSGLSIIGHLIPYGRSLGFSIAAVIAVFLFPFANGLG
FT                   RFVMGTVSDYLGRPYTMTLSFGISGISMLSVAFIPKIAPLYLALIFLTAFTWGPLFSLF
FT                   PPLVGDYYGPKHSGANYGLTYTAKALAGIFAGYGASVLFTSYGIKETLVITGLMAIISS
FT                   ILALTLRPPKMPTAQIASAESQRDSIESKTK"
FT   gene            complement(314541..316133)
FT                   /locus_tag="LS215_0372"
FT   CDS_pept        complement(314541..316133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0372"
FT                   /product="L-lactate transport"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34514"
FT                   /db_xref="GOA:C3MKY9"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKY9"
FT                   /protein_id="ACP34514.1"
FT                   /translation="MYVQPLNPTGNVGLTILASLTPIIILLVLLAGLRITAWLATLIGS
FT                   IITILVATLVWGAPIVQVSYAWLIGALVGTWAISWIVFWGLTIYNTLVLTGKFDAFRDW
FT                   IVRNSTNDARVQAIVLAWSLGALFEGLVGFGYPWAFIAPLLIYLGFDDLKALQVSALAN
FT                   NAPVSYGALGTPIIILASVTGLPLLFVSSSVAKVVAILALLPPWILLYLVDKWRGIKEA
FT                   WPIAILGSLSYILGQYPVASFVGPYLPDITGSLISFVILLLFLRVWRPKRILSLRSIQP
FT                   NGGDSKKYSKRDVIEALSAFIVLIIVVTLWTGPWSPLTKFSLVTLSQSAYSSLLHKNVA
FT                   VSFAFNPFVAGTSILVSWIIISLVLRASPKVMGQAIKRSFHQYWGGILTGVFVVGLAYV
FT                   FNFSGMAYSLAWKTSDLGVAFIIVSPLFGWIGCALSGSNTSTNALFGAFQATTARLAGL
FT                   PVGLPPALNSVGAELAKPVAPQTASAGVSTTKYVRKEGIVIRKNLPWAIGILIYLILIG
FT                   VLYAFLAPSLFVH"
FT   gene            316356..316508
FT                   /locus_tag="LS215_0373"
FT   CDS_pept        316356..316508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0373"
FT                   /product="transposon ISC1078 Orf1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34515"
FT                   /db_xref="GOA:C3MKZ0"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKZ0"
FT                   /protein_id="ACP34515.1"
FT                   /translation="MPKSSMRGIRLNKNQEEERRLNAVNDVRNGMSIKDAAKKYDVPSS
FT                   PFTSG"
FT   gene            complement(316622..316936)
FT                   /locus_tag="LS215_0374"
FT   CDS_pept        complement(316622..316936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34516"
FT                   /db_xref="GOA:C3MKZ1"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKZ1"
FT                   /protein_id="ACP34516.1"
FT                   /translation="MVVFGLLTNNLLLLSTIALALAIVLITIVLTSYSYLNARITPERV
FT                   EIGKWKIHIDQVREIRVLRSNGPIADLIIVYEGGERTIEEVKNWKEVLEMFQRYKENMV
FT                   "
FT   gene            complement(316908..317060)
FT                   /pseudo
FT                   /locus_tag="LS215_0375"
FT   gene            317270..318070
FT                   /locus_tag="LS215_0376"
FT   CDS_pept        317270..318070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34517"
FT                   /db_xref="GOA:C3MKZ2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKZ2"
FT                   /protein_id="ACP34517.1"
FT                   /translation="MRVVIGKRMSKEELSTYFTITPLFSIVSPLISGFIAQESYTIDFV
FT                   VAFIFIIIVIPILFIIKSIVPLTEEKPITTTSHIPFKEYSKLMREDRSGLILPLLLAVN
FT                   RFIFGTSFLYIPLYFTEIIKGSLLELGIMLSTETIAISLASSLSKFISDRLGNVTTLAM
FT                   TRILAAITYPLIYFVKSPVIFILINWVGTLFIAMDNVPEVSVISKMKTANLSMSLIDSV
FT                   STLLSISSPIIALYIWVNISPATVFLLSLLVIIPSILMFKYKVD"
FT   gene            318313..319827
FT                   /locus_tag="LS215_0377"
FT   CDS_pept        318313..319827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0377"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34518"
FT                   /db_xref="GOA:C3MKZ3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKZ3"
FT                   /protein_id="ACP34518.1"
FT                   /translation="MGIKLPTLEDLREISRQFNLDLEDEELKSFLSLVKLQLESYERLD
FT                   SLPDYTPRVKYQRTLGRSPVKEENPYGALVWVTSIKGKEEGKLKGKRICIKDNVMVAGI
FT                   PMLNGSKMLEGFVPNMDATVVSRILDEAGEIVAKTTCEDLCFSGGSHTSYPWPVLNPRN
FT                   PEYMAGGSSSGSAVAVASGYCDMAVGGDQGGSIRIPSSWVGIYGLKPTYGLVPYTGAFS
FT                   IEPTLDHLGPMANTVKDIALLLEVIAGRDGLDPRQPDSLPQPPVKPYLNLIDGEIKGIK
FT                   VGIVKEGFNWPNSEKDVDELVLDSAKKLEDYGIKVEEVSIPLHRMGLDIWTPIGIEGAT
FT                   ATMILGSGLGWGRKGLFETQIADLFGNSLKSKARDLPNTVKGVLMLGYFMIRKYNNRYY
FT                   AKARNLSIMLKEAYDEALRKYDALIMPTTPMKAMRYRSEPSFDEYFIMALGMINNTAPY
FT                   DVTGHPAMNVPVGYSNGLPVGLMIVGSYFEEDKILKIANMFERMKK"
FT   gene            complement(319849..320496)
FT                   /locus_tag="LS215_0378"
FT   CDS_pept        complement(319849..320496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0378"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34519"
FT                   /db_xref="GOA:C3MKZ4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKZ4"
FT                   /protein_id="ACP34519.1"
FT                   /translation="MSEGRIPLIGEKFPEMEVITTHGKIKLPDDYKGRWFVLFSHPGDF
FT                   TPVCTTEFYSFSKKYEEFKKLNTELIGLSVDSNISHIEWVMWIEKNLKVEVPFPIIADP
FT                   MGNVAKRLGMIHAESSTATVRAVFIIDDKGTVRLILYYPMEIGRNIDEILRAIRALQLV
FT                   DKAGVVTPANWPNNELIGDKVINPAPRTIKDAKMRLGQPFDWWFTYKEVKTT"
FT   gene            320781..321146
FT                   /locus_tag="LS215_0379"
FT   CDS_pept        320781..321146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0379"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34520"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKZ5"
FT                   /protein_id="ACP34520.1"
FT                   /translation="MKVAIAVTNGYVSGPGEGLAVQIYEINGNEYKIIEEYENPALNAT
FT                   AARGVHMLKSAIDKGVNAVVVAEMGPPGFRFLQRYNVKAYLGMGLDAKTALEKLIKNEL
FT                   LEITQPTHGERHGEHYH"
FT   gene            complement(321143..321966)
FT                   /pseudo
FT                   /locus_tag="LS215_0380"
FT   gene            complement(321252..321521)
FT                   /locus_tag="LS215_2967"
FT   CDS_pept        complement(321252..321521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2967"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2967"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34521"
FT                   /db_xref="GOA:C3MKZ6"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKZ6"
FT                   /protein_id="ACP34521.1"
FT                   /translation="MILGSLFFISFSTLLAILTIKFKEMRMQNLISFIPLILGFIFYSL
FT                   FTSSEYPNILDYTSLYLSMMLLLYYGYTGNTTNKLSECTRKSIS"
FT   gene            complement(321691..321858)
FT                   /locus_tag="LS215_2968"
FT   CDS_pept        complement(321691..321858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2968"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2968"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34522"
FT                   /db_xref="GOA:C3MKZ7"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKZ7"
FT                   /protein_id="ACP34522.1"
FT                   /translation="MEPGFLKEIPFTNAKIIYQNYVAVWYSDLVILSLSALAVSIAFIL
FT                   FVKLELYHIC"
FT   gene            322321..322512
FT                   /locus_tag="LS215_0381"
FT   CDS_pept        322321..322512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34523"
FT                   /db_xref="GOA:C3MKZ8"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKZ8"
FT                   /protein_id="ACP34523.1"
FT                   /translation="MAGKFYVIVGILALLFIILYSLLPFYSKNDPTLLGLPLFYWYQII
FT                   LMPIGALVFYAVVMIIRD"
FT   gene            322517..324097
FT                   /locus_tag="LS215_0382"
FT   CDS_pept        322517..324097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0382"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34524"
FT                   /db_xref="GOA:C3MKZ9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C3MKZ9"
FT                   /protein_id="ACP34524.1"
FT                   /translation="MDGLHVSILSIVLFIFLFVIFVYLGFYGSRWRRGDLSKLHEWALA
FT                   GRRLGPYLMWFLLTADLYTAYTFIAVPSLVLASGPVGFFAVFYSAVTPFIALLFMPRLW
FT                   TIAKNRGYITAADFIKDRFNNKILAGLVAITGVVAELPYIALQIVGMQVALLILLLGLG
FT                   VSNISLASDLSLLVAFIILAAFVFTSGLRGAALTAVYKDIIILGTVISIAIYVPLAFGG
FT                   FSGAFHNAQTLSSQINLALNNVNKPIFYNYLPNTLAAHTAYISLAIGSAFALYLYPHAV
FT                   NASVSSDSKKSLKLSLALQPFYSIILAIIALFGILAYANPNVISFIAKTHSGAVTVPAL
FT                   IGYSMPDWFVGIALLGIFIGGLVPAAIMAIGAANLLTRNIIKEFKPNMSPSTESALAKW
FT                   ISTAFKFLALALVFATPSTYAIQLQLLGGIIILQTLPSVFLGLYTNKLHGYALVGGWVG
FT                   GMFSGIYLTLLANHFGPLKTSSFLTPLGPMYIGVISTLINLAIGLIGTAIAYGVGWRPV
FT                   SNIRAEEIG"
FT   gene            complement(324138..324947)
FT                   /locus_tag="LS215_0383"
FT   CDS_pept        complement(324138..324947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0383"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34525"
FT                   /db_xref="GOA:C3ML00"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML00"
FT                   /protein_id="ACP34525.1"
FT                   /translation="MIDFHFHAPVKEFLDFLGEYAEPAIKYFNAKVEVKGLKETLDYYE
FT                   SFGIKRFVVLPIDSMTFLGRRIPNQVVNLDDRIVKFISVDPLKPNAIEELKKAIKEFEP
FT                   IGVKLHPQLQGFNPLDERALKLYEIIDSHGLVVVFHTGTSGIGAGVKSSIRLDYGRPIY
FT                   FDEIAVRYHNMKIVLAHFGWPWTEEAIAIALHKPNIYLDLSGWAPRYIPQTIWNNAKRL
FT                   SDKLLFGSDFPLIRPERWIEEFKRINLSQDIKDKILKHNAERLINRC"
FT   gene            complement(325073..326044)
FT                   /locus_tag="LS215_0384"
FT   CDS_pept        complement(325073..326044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0384"
FT                   /product="Protein of unknown function DUF973"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34526"
FT                   /db_xref="GOA:C3ML01"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML01"
FT                   /protein_id="ACP34526.1"
FT                   /translation="MMSYSEVEYKGLSYLKRGNIEIIIIILIELLAILVTYVMEYLGLP
FT                   TPLQDFLVLLPSSAISTLLIILTYLDIQRGFYTLGKAEVNIGIGNIISSLFLVLSILAI
FT                   VGVVTYTLSLIFNGITSSILNPIQTLVELFAFITFIMLGFSYRLIGNHYGSNHLSIGGI
FT                   VLILGVIIFIFKLEYGGLLAFIGLIITYIGLGNLSAMKKLVTAPPPTQASSTPSETTSS
FT                   TNVSSSSPTPNIITHGGILRSNGEAFVAVSSDIEEEILSSIILNTDYSTNEITPKKLSK
FT                   GYNSIKINFNTNLQQLTLGNTYTIRLISANGRNIDINVVFQL"
FT   gene            complement(326093..326902)
FT                   /locus_tag="LS215_0385"
FT   CDS_pept        complement(326093..326902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34527"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML02"
FT                   /protein_id="ACP34527.1"
FT                   /translation="MKKPKILLSVIKSLLENNGHITSRELPKSKKVSSNQLYKAILILN
FT                   KLGLIQIEGELNNNRFELHLVRDSQFLNLEQRVKVTFYEDRSKTKSFKFHTVALKNGVS
FT                   YIEDNSYWSVDDKVKTKLKVYKPKREFGKIIVEKIELGVQKAYIKLTLNPPTRVGEKII
FT                   HGFKVIQSNYFTFTQKETIERYGDPEMMDGLSVIQPTLFSTLEIKFPEGYRFIDVKAER
FT                   YDLVVIDGPQIPSPIPNHRLVIERNRIILKLVYPSFGYYFISWKAAQ"
FT   gene            complement(327000..327092)
FT                   /pseudo
FT                   /locus_tag="LS215_3012"
FT   gene            328470..329759
FT                   /locus_tag="LS215_0386"
FT   CDS_pept        328470..329759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0386"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34528"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML03"
FT                   /protein_id="ACP34528.1"
FT                   /translation="MKYDVIIIGAGHNGLVSSIYLAQKGLKVLVIEARNRPGGMSDTEE
FT                   YKGVKYSRASYVLGLFPKRIQEELGVVFPTVDSDVADVFVTEDGKVVNIWRNKEKRLEE
FT                   FKRLGQTKYPKMEELLFKIKEKIEKEIQYVTKPPSFEDFMKAVERTELEIFTQPSRKFL
FT                   NEYLDKEFQPYFSYGFMYDLPAYVLAYYFSLDWKIVRGGMGKVGEILMNRAKQLGVDFI
FT                   FNTKANEIIIKDNVATGVRTNADKIIESKIVINAVSPVLLNKLTNGLLKVYHPEFRPGW
FT                   KRDTLILRELPNLPDYVRNHPDTLFTLPIGEVTIPSTVDNSLGGHVMTIMGSYEEAKEF
FT                   FPDLEKKVVHVDRLDAYKLEREYNAPFGDMNHMPMYTEYLFDGRPVKGWGYTTPVKNLY
FT                   VTGSGTYPGGQVTGVPGRNAAMKIITDLGI"
FT   gene            329762..330277
FT                   /locus_tag="LS215_0387"
FT   CDS_pept        329762..330277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0387"
FT                   /product="protein of unknown function DUF1130"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34529"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML04"
FT                   /protein_id="ACP34529.1"
FT                   /translation="MLFTIGHSNRSLEDFMEILRKYNVEILIDVRRWPKSSRYPHFNKE
FT                   NLKKALEQSGIEYLWKEQLGGYRKIGKDVEDIDIGKCFKSEGFRAYAIYILTNERVMEA
FT                   LEDIRRINKIKMIMCSEKFPWNCHRKIISDWFLARGDEVVHLIEKESTIKHKLTTCAEI
FT                   VKNNLNYK"
FT   gene            complement(330289..331098)
FT                   /locus_tag="LS215_0388"
FT   CDS_pept        complement(330289..331098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0388"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34530"
FT                   /db_xref="GOA:C3ML05"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML05"
FT                   /protein_id="ACP34530.1"
FT                   /translation="MIKVIDAHVHYHIYARKIPEHCKEFLENVEETSITLKNEFVEIEK
FT                   ILLVPSHPCHSDDCYDGFYIDYEERKRNPDLYLQWGEVNPWRCDVRRELDKQYSLGIIG
FT                   IKLHPVHHAFKPNAYREEEGGLKQLLYVYEFAEDHDLPILIHTGTSIGVESRNKYADPI
FT                   YADDVAKDFPKLRIILAHAGRPLWYNTAFHMARFTRNVFLEISSIPPKNILKVLPRLHE
FT                   ISDKIIYGSDFPAFKGQDLAEYAYQVYDVLKDEKIMRDNAKRILKIS"
FT   sig_peptide     complement(331027..331098)
FT                   /locus_tag="LS215_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.784) with cleavage site probability 0.362 at
FT                   residue 24"
FT   gene            complement(331126..331761)
FT                   /locus_tag="LS215_0389"
FT   CDS_pept        complement(331126..331761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34531"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML06"
FT                   /protein_id="ACP34531.1"
FT                   /translation="MSVSRVENYLNLQLKKALQINGIGVEEIHDIRVAVRKYFDVLYAL
FT                   YPVYENVECLFLAKEVISKLGKVRDMDICEIINEERNRLAIRAVKEVRGLKICFVNNKI
FT                   YGARLVIYNRILTSLHQIQDVTDFHELRKSVRVTRNLVEALGYDTTEIKAFAKKMGDIR
FT                   DEILKMRCRGVTPADINVNQFKEEAKRVILKIIASQDEFHHFKLKDRY"
FT   gene            complement(331742..332359)
FT                   /locus_tag="LS215_0390"
FT   CDS_pept        complement(331742..332359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0390"
FT                   /product="thymidylate kinase related protein"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34532"
FT                   /db_xref="GOA:C3ML07"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML07"
FT                   /protein_id="ACP34532.1"
FT                   /translation="MIIAFEGIEGSGKTSHLEATKKYLEKQGYGVITFGLQKSKLLGER
FT                   ITQVKRNIVFERRTLFLAYVTDLADQIENYVNPSIDSGFIALADGYTLTLTSWGLTRGL
FT                   EKEWIDDVLSILPKPSVSLPLISTPDEIVRRIIKKRGYLDPLETGIDICIKEDTFEAYI
FT                   DYINRFQEVLMSISSKENMIYTDKEFDEVQKEIVRRIVSITS"
FT   gene            complement(332343..332984)
FT                   /locus_tag="LS215_0391"
FT   CDS_pept        complement(332343..332984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0391"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34533"
FT                   /db_xref="GOA:C3ML08"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML08"
FT                   /protein_id="ACP34533.1"
FT                   /translation="MKGLLIAFEGIDGSGKSSQAVLLKDWIEMRRDVYLTEWNSSDWIH
FT                   DIIKEAKKKNTLTPTTFSLIHATDFSDRYERFILPMLKSGFVVICDRYIYTAYARDVVR
FT                   NVDFNWVKKLYSFAIKPNFTFYIRVTPEVALERIKKAKRKIKPQEAGIDILGELPLEEG
FT                   FLKYQGMVVEIYDKIAKEESNFITIDGNRPLKDVQMDIRKILGEYIDNSL"
FT   gene            complement(332981..334237)
FT                   /locus_tag="LS215_0392"
FT   CDS_pept        complement(332981..334237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0392"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34534"
FT                   /db_xref="GOA:C3ML09"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML09"
FT                   /protein_id="ACP34534.1"
FT                   /translation="MISAVIDCGYNSFRMVIYQVFRNGTFRMIGSSKSYVRIGEGLKEG
FT                   DIISEEKVAKAERAFMIFKRILNGVNVNEVKIVATSAFRYASNGNEVRYRLSKIIENEV
FT                   RVISGEEEGRYAALGILNTLPISEGVFFELGGGSLEIAEVSSGNIIRVHQLPIGALKLV
FT                   NLPEREIRKKVSDELSTTNIKKANVIVGSGGNVRALAKLDLKLSSFPIKSIHGYSLSSK
FT                   QISKYASLLPSLDIDSRQSLPGISKERALTMHSASVIIDELVKYFTGSYIVVSLFGMRE
FT                   GVLTEGKSLDKMSWLEEISYSNAIDPPPIEIFKEVISEVDSKYSFYVASSALLSLIFKM
FT                   VGYFNPFRACYRFIKESVLPGFTLNEALLVGLICEAAGGKVKKKQAKLLKEDITKKEIL
FT                   SFGNIVKNSIDKYVAGVRL"
FT   gene            complement(334238..334723)
FT                   /locus_tag="LS215_0393"
FT   CDS_pept        complement(334238..334723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0393"
FT                   /product="phosphohistidine phosphatase SixA"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34535"
FT                   /db_xref="GOA:C3ML10"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML10"
FT                   /protein_id="ACP34535.1"
FT                   /translation="MITLILVRHGDAEPQVDGKDDKDRRLVKKGVKQMRRVANFLEELG
FT                   FNVDRIISSPYLRAYQSAEVILEELYDNDSEKKVETLDDLTPDKEPSLFLEKLKDFADN
FT                   STILVVGHEPYLSNFVKAISGGNVEIKKGGVVIVDYDLKEGRGVLKTLLSQKVLKLI"
FT   gene            335095..335567
FT                   /pseudo
FT                   /locus_tag="LS215_0394"
FT   gene            complement(335666..336559)
FT                   /locus_tag="LS215_0395"
FT   CDS_pept        complement(335666..336559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0395"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /EC_number="1.2.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34536"
FT                   /db_xref="GOA:C3ML11"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML11"
FT                   /protein_id="ACP34536.1"
FT                   /translation="MSSLVTPKRIPKFYRGNAACPGCPIPKELDVLLEVLGNKTVLVVP
FT                   ASCTTIIMGDTSGMPSTVPVIHSAFGAPAAIASGIVRALRTRGDKDVIVTVWAGDGSTG
FT                   DIGFASLSGAAERNEDILYVCYDNEAYMNTGIQRSSLTPKGAWTTTTPEGKREYKKPLP
FT                   FIIAEHKVPYVATASIAYIYDYEAKVRKAKQIRGFRYLHLLSPCPPGWRFDSKLTIDTA
FT                   KLAVETGVWPLFEIENGEFRLTSVSKTLLDKKNRKPVAEYLKLQGRFKQLTEEEIKGIQ
FT                   EEIDEMWEEIKKLVKK"
FT   gene            complement(336556..337713)
FT                   /locus_tag="LS215_0396"
FT   CDS_pept        complement(336556..337713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0396"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /EC_number="1.2.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34537"
FT                   /db_xref="GOA:C3ML12"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML12"
FT                   /protein_id="ACP34537.1"
FT                   /translation="MQVLKRKTLALVGNHAVAYAVKQSKPQVLAVFPITPQTTMLEKIS
FT                   EYIASEELNAELIKVESEHSALASIYGAALAGARVFTATSSQGLLYMTEMIYWAGGQRV
FT                   PMVAAVATRAIAEPWSIWDDHQDFLSKRDAIWIQMMAENVQEAYDMTIQAFRISEDERV
FT                   ILPVMMGFDGFILTHTMERIEVLEDGEVDNFLPPRQFNLIDFSDPIGVGPIATPEDYIK
FT                   YRYEAMKAMERAKGVIEEVMNEYERISGRKQNGLVECYKCEDAKYVFVTMGAWSGDCKV
FT                   AVDRLRDAGVEAGLLKIRVFRPFPKEKIEEYLRSMKGVIVLDRAYSYGSGGILANEIKA
FT                   TLYGYRVPVYSVIAGIGGKDVRPRHFQKVIEDLINDNLEEERWLL"
FT   gene            complement(337717..337986)
FT                   /locus_tag="LS215_0397"
FT   CDS_pept        complement(337717..337986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0397"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34538"
FT                   /db_xref="GOA:C3ML13"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML13"
FT                   /protein_id="ACP34538.1"
FT                   /translation="MLIKVPMGVPVARPRIGSAGKTGLWRVEKPVIDYNKCTKCRLCVI
FT                   YCPENTIDLLENLYPQIDYDYCKGCGVCAQVCPPKAIDMVREVK"
FT   sig_peptide     complement(337912..337986)
FT                   /locus_tag="LS215_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.370 at
FT                   residue 25"
FT   gene            complement(337976..338524)
FT                   /locus_tag="LS215_0398"
FT   CDS_pept        complement(337976..338524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0398"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34539"
FT                   /db_xref="GOA:C3ML14"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML14"
FT                   /protein_id="ACP34539.1"
FT                   /translation="MTLIELALRGRGGQGIVTAGELVTKAMVLEDKYAQSIPFFGGERR
FT                   GAPVVSFLRLSDKPILLHREVYNPDGVAIFDTSLIQIINVTEGLKENGFLLLNTNTPNR
FT                   IWKSEYIVDATSIAKELGLVVAGWAVVNTAMIGALVKILGQPSLHSLEEAVKEEFPGKI
FT                   GELNAEAVEMGYKGVKSVD"
FT   gene            338701..338877
FT                   /locus_tag="LS215_0399"
FT   CDS_pept        338701..338877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0399"
FT                   /product="carbon monoxide dehydrogenase, large chain
FT                   (CutA-1)"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34540"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML15"
FT                   /protein_id="ACP34540.1"
FT                   /translation="MIQEHLPLITVKESYIDDISPKNVVYLSVVRSPIARDIIKNISKP
FT                   SLGQISLMGSKFI"
FT   gene            complement(338891..339052)
FT                   /pseudo
FT                   /locus_tag="LS215_0400"
FT   gene            complement(339107..340328)
FT                   /pseudo
FT                   /locus_tag="LS215_0401"
FT                   /note="transposase"
FT   gene            complement(340354..340749)
FT                   /locus_tag="LS215_0403"
FT   CDS_pept        complement(340354..340749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0403"
FT                   /product="Transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34541"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML16"
FT                   /protein_id="ACP34541.1"
FT                   /translation="MKIKEEQGRKSKLTPQEKAYILIIKEYLGLSNRETAELASLLNLT
FT                   KEEISYKTVERLYSDPDVFVILYNLLSKTVGGLKVDAVIDGTSYSLVVTKHYRSEREKS
FT                   GEEMKEGKDFVYSFFIFDLGSNWGYQL"
FT   gene            complement(340805..340948)
FT                   /pseudo
FT                   /locus_tag="LS215_2989"
FT   gene            complement(340991..341452)
FT                   /locus_tag="LS215_0404"
FT   CDS_pept        complement(340991..341452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34542"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML17"
FT                   /protein_id="ACP34542.1"
FT                   /translation="MPNEGIKLIFSLQTNLSFLIRTTEGKLTVLIRNAKNKYKSSTTFI
FT                   IMLEEWIKQLADALDKFVAGEQLTEDERIMVASLIYATLKHLKDFDECNEKLKEVEEKC
FT                   NKNLDELEKKLDELQKELDKKEVEVKEKLKTLDNLIKIMEVNPRLLPKN"
FT   gene            341388..341858
FT                   /locus_tag="LS215_0405"
FT   CDS_pept        341388..341858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34543"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML18"
FT                   /protein_id="ACP34543.1"
FT                   /translation="MRMRKLKLVCNEKINLMPSFGIMTDIVTEKLKEELRKKLGREIPN
FT                   VLVEFVNYLPPQVLAYVRANDYTIYVNYEQYMRAKRMGYEYEYLYVILLHEYLHVVGIA
FT                   DEREVRRIDLEMVRDKFGENSTAYKIALNLADPRDIYLNESQRLGGKPNTFM"
FT   gene            342026..342372
FT                   /pseudo
FT                   /locus_tag="LS215_0406"
FT   gene            342493..343847
FT                   /pseudo
FT                   /locus_tag="LS215_2990"
FT   gene            343855..343995
FT                   /pseudo
FT                   /locus_tag="LS215_0408"
FT   gene            complement(343999..345126)
FT                   /locus_tag="LS215_0409"
FT   CDS_pept        complement(343999..345126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34544"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML19"
FT                   /protein_id="ACP34544.1"
FT                   /translation="MYNMAVAIFNMIVDGEINVKNVQKFFDNLMIAAETLSKTHTIEPL
FT                   KSLYEKYRDEVKELEELKGKDDIFYFSYLVHKVFDDYFNNGKLKGLLDEISKIKIDKKE
FT                   LLKKFEENVGEIKEDENLKFPVLWTFKTYDLLSLMKKFNSIQDREFEAEYMGLKVYVTI
FT                   KPFEGEIGLYDPFVFFTKNRPRLGIRFGEIAIDPYEVRILQLYESREHFILPIVEKTCG
FT                   KLTLKTKTALTITDPLKFKNTAYLTRALRYSHWTLRTSKLSLSEVINYLPFILNSVNKP
FT                   KSFIKSVMDLHDRMEEEGVDLDYIKKEIETLGWYGIKLPNKPIRREDRGLNKLKELYDL
FT                   STKLEDPIVLLTHLLMTIIYVYKVNGYEYKQLFVR"
FT   gene            345753..346414
FT                   /pseudo
FT                   /locus_tag="LS215_0410"
FT   gene            346411..346770
FT                   /pseudo
FT                   /locus_tag="LS215_0411"
FT   gene            347020..348543
FT                   /locus_tag="LS215_0412"
FT   CDS_pept        347020..348543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0412"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34545"
FT                   /db_xref="GOA:C3ML20"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML20"
FT                   /protein_id="ACP34545.1"
FT                   /translation="MFERDILTTHHFELPMGRVLEEVKENYGRLKLYINGELVDSKTDT
FT                   IGKAYNPAKDEVIAEVPFSAKDEVREAIQSAQEAFEKWREVPITTRIQYLFALKNKLEE
FT                   YSETIARIIVQNHGKTIQEARGDMRRTIENVEAAISVAYTLYKGEHLDQVSQDIDETVV
FT                   REPLGVFGIITPFNFPTMVPFWYLPFAIVLGNTVVIKPSEITPVPMDFIIKIFDEVKLP
FT                   RGVVNVVHGAKDVVDEFLTNKLIQGVTFVGSTRVGKYIYENAGKSGKKAIVQAGAKNFV
FT                   VVMPDADLNKTIPSVISAFFGNAGQRCLAAANLVAVGNIYDDVKRKFIEASKQLKIGYG
FT                   LDESVDMGPVVTKDAKKRIIGYIDKGIEEGAKLLLDGREAKVLDYPNGYFLGPTIFDEV
FT                   TPEMTIAREEIFGPVASIIHLRSLDEAIDIINKSNYGNASSIFTTSGYYARKFRRGVNA
FT                   GNIGINIGVAAPMAFFPFGGRKESFFGVLHGQIDSVDFFTDKKVVITRW"
FT   gene            complement(348569..349255)
FT                   /locus_tag="LS215_0413"
FT   CDS_pept        complement(348569..349255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0413"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34546"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML21"
FT                   /protein_id="ACP34546.1"
FT                   /translation="MNDRLLEITFSVEHENCWTNLVGKYIVKTLRFSVDTERNSIRSLI
FT                   VVDKKYKDLMNKIKRNNSFIGYSSISLTNDNKKILFDFRKRYKNSVMDIINSVDGIILD
FT                   GFKYDGKEYWRILLYESYINELREKLRSKGNVEFIGFHELNVTEDELTPYELKTLILAY
FT                   KNGYFDFPRRIKSDKVSKLINISKSTFTYHLRSAESRIIKRYIDDLKFYNVINNISQQE
FT                   EERKDS"
FT   gene            349486..350574
FT                   /pseudo
FT                   /locus_tag="LS215_2969"
FT                   /note="alcohol dehydrogenase (Zn containing)"
FT   gene            350644..351444
FT                   /pseudo
FT                   /locus_tag="LS215_0415"
FT   gene            351455..352354
FT                   /locus_tag="LS215_0416"
FT   CDS_pept        351455..352354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0416"
FT                   /product="Acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34547"
FT                   /db_xref="GOA:C3ML22"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML22"
FT                   /protein_id="ACP34547.1"
FT                   /translation="MFLSEIGKHETSLMECLFTRLEVEVTMTKNNNSNFTLPPTNNGKS
FT                   QIVFQPPWYYGVTYIGAHVKFTKESAEKVIPRFLSTDGEGWVYIAEFISTSEDNWDYMY
FT                   QDPDLVQYMEGAIGLKVNFEGKNYLYFPFMWVDKDWALVRGWLDGYPKKIAKIAMTKLH
FT                   HLLPKYNKPERGLKMGGYAVRGGGVMFRMQVELEERTDSLPLKNFGPFLNIRRFPSRGE
FT                   GEVDLYEIVSRVRDETKYGEIWKGKANVELGGYVNDEVNLLEIERTIGGYHYTLYFKVT
FT                   TTQLISKKIEEAISLNLK"
FT   gene            complement(352422..353429)
FT                   /locus_tag="LS215_0417"
FT   CDS_pept        complement(352422..353429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0417"
FT                   /product="catechol 2,3 dioxygenase"
FT                   /EC_number="1.13.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34548"
FT                   /db_xref="GOA:C3ML23"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML23"
FT                   /protein_id="ACP34548.1"
FT                   /translation="MVNKLLSQLASVEILTPKIDDTLWFFKDILGLYEVGRKGKSVYLR
FT                   GWEDWYTYSLKVTESDTAGVKEIVWRTCSEKDLIDAINIVNSNGLGLGWDEGEPDMGIG
FT                   RGYKFILPSGQIGKLVWEMKTWRASGELRSGYKARPMKKPTKGVQAKDLSHIFIFAYND
FT                   GALAKTVELLKKLTFKVNEILKEGDKKIAYWMAVNGTAHDLAIGLDPSGVPARLNHVTF
FT                   NVDYADDILRAADFYTDYGLEIVGGPLRHGITDSNSLYVKEPGGNLIEVLHGGYLNVVP
FT                   DWEPVVWDTNEDGDRWLYYWGHVKEAFWHGSPIPATRISDELKEIVRQKLGAKI"
FT   gene            353534..353953
FT                   /locus_tag="LS215_0418"
FT   CDS_pept        353534..353953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0418"
FT                   /product="protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34549"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML24"
FT                   /protein_id="ACP34549.1"
FT                   /translation="MNVLNKLGISDELADMLISEAVKKAKELGVKVSIAIVDEGGELKA
FT                   FKRMDGAPILTIEIAIDKAWTAVSFGIPTHAWYNMLRDNPPLAMGFPKIPRLIIFGGGF
FT                   PIVYKGQVIGGIGISGGSAEQDMEIAKNALKKLES"
FT   gene            354130..355400
FT                   /pseudo
FT                   /locus_tag="LS215_0419"
FT   gene            355477..356283
FT                   /locus_tag="LS215_0420"
FT   CDS_pept        355477..356283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0420"
FT                   /product="methane/phenol/toluene hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34550"
FT                   /db_xref="GOA:C3ML25"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML25"
FT                   /protein_id="ACP34550.1"
FT                   /translation="MKPVPAEPKLPSRDEYYDLANKLEWAPKYVKEEELFPVDMSGIPN
FT                   LPIDVWAELYDAPYKVTYREYVKNQKEKDQRLFSVREAGVRAELVKKLDKTYHQGSFCF
FT                   HITAVPIPEYTASIAEARMARFGKAGEWRNLSTFGSMDEVRHAQVQILLSHDSIQASPK
FT                   FAYAHKMFWVDGWLPIAARSFFDDTITGTNAIEFALMTTFAFETGFTNLQFVAYAAMAN
FT                   KTNDFVFSSTTQSVQTDESRHAQIGHPVLKTFVDVTKLNEEMKKKI"
FT   gene            356422..357360
FT                   /locus_tag="LS215_0421"
FT   CDS_pept        356422..357360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0421"
FT                   /product="YHS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34551"
FT                   /db_xref="GOA:C3ML26"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML26"
FT                   /protein_id="ACP34551.1"
FT                   /translation="MTMSREGGLGQTRGEVKQALSNVSEGLMKNYRNTVEFAVRMREKG
FT                   PAYKEAGEYLIAKGFWLSLRLIGALTGVSMDYLTPLDARIMSYKEFITEWVGAQFKRLL
FT                   EDYGIRLPWYWQWFELELDHWHHNFIIGLYTWRRTLNVAFRGPTPDERKWLNEKYPHWE
FT                   KFFGRVWDLYIKKIIDGQIPLPLTAVHLCTVCQVPIQAPVNGKYLRIYLKEYKGKIYTF
FT                   DSPACLWIFDQEPDRYAGRRTYTQRVLEGMIQFTEEAYKDPKRLLEEVIWNMGQTEEGE
FT                   AGLDPTDGAYALLYKEKDQDFLNRIKKYTEG"
FT   gene            357366..357800
FT                   /locus_tag="LS215_0422"
FT   CDS_pept        357366..357800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34552"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML27"
FT                   /protein_id="ACP34552.1"
FT                   /translation="MSMEAVPIVFVPEEGTVWLPAVLPTNITVEEAIEMLKSLTVNVLV
FT                   WEKKDKDLRLVNYFTGQVLDLNAKVRDVIKPYDVFWLVWWPPKEEFWKPENQNDDIFKI
FT                   IKETEEAIKLAPRSPSVLFTDEIEKYSIVRRLEREGKLRA"
FT   gene            357805..358209
FT                   /locus_tag="LS215_0423"
FT   CDS_pept        357805..358209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0423"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34553"
FT                   /db_xref="GOA:C3ML28"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C3ML28"
FT                   /protein_id="ACP34553.1"
FT                   /translation="MSYPGEFHKVLTLDDIYEGEAKLVEVNRYEILVVNINGEIKAYYA
FT                   RCAHALGLIEPNSFDGEEKIICPVHLWEYNARTGESINPEGSSLFPLDVKVEGNDIFVK
FT                   VPSVPVSEFKVKWFGMYRQRGVINEFGVNS"
FT   gene            358187..358534
FT                   /locus_tag="LS215_0424"
FT   CDS_pept        358187..358534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0424"
FT                   /product="monooxygenase component MmoB/DmpM"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34554"
FT                   /db_xref="GOA:C3MLF6"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="InterPro:IPR036889"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLF6"
FT                   /protein_id="ACP34554.1"
FT                   /translation="MSLELTLESILDKYQITDLSKLSQNIVGPVLTKDEFSYGVVEAIA
FT                   DDNPNTFKGVIDRGSYIRIVGERELVLNKSTLEEVLGREVRFPGEVEVRMSAFAGKIIV
FT                   RGDYLKWYLEL"
FT   gene            358536..359678
FT                   /locus_tag="LS215_0425"
FT   CDS_pept        358536..359678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0425"
FT                   /product="methane/phenol/toluene hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34555"
FT                   /db_xref="GOA:C3MLF7"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLF7"
FT                   /protein_id="ACP34555.1"
FT                   /translation="MKKVMTRLEDLEWYRRYKQMFGAFKSGVEGDRFFRDYEYRGYKRV
FT                   WSTWPMLEKKLGRKKPSEYQIVTYALSYWADPRSPTYIYDKGPFELGTEHITQKWYKHF
FT                   RDNSPFIKPLFERGEWHDYEDPYKLTYWTYNSMADDNETFLDKIYEEIVNTKYDWNLSE
FT                   EVLELYKNVYDPLRYVFHIMQMESMYLASTAPTSSITNVFIFMGMDHMRRVQRIAQRVK
FT                   MLDIIYPSLGFGKEARKIFEESPLFQLTREVLEKMLATYDVGESLVAFNLAVKFVLDEL
FT                   TLQHLTQQFSKMGDEMIRHIHMSFYNDTLRHRHQAQELFKYAFSKEPSLKDVIKPWLKD
FT                   WQEMAFNATEGFRDVLKGEYDNTIKQIKKAHSEYLGGIGL"
FT   gene            359675..360148
FT                   /locus_tag="LS215_0426"
FT   CDS_pept        359675..360148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0426"
FT                   /product="protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34556"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLF8"
FT                   /protein_id="ACP34556.1"
FT                   /translation="MKDKIVEILRQIYDPEIPINIYDLGLVREIKVEDNRVFVRLIFTA
FT                   NKGCTLADLMAVQVKYKLMKAFPDYNVEVKSDFNEEWNIGYATETGRLMLEEIYGKEAV
FT                   DALANKTKIEEIVSINKVRLEDFDPREYMKKAVEERYKRFKEWYDKHDILISH"
FT   gene            360214..361887
FT                   /locus_tag="LS215_0427"
FT   CDS_pept        360214..361887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0427"
FT                   /product="thiamine pyrophosphate protein central region"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34557"
FT                   /db_xref="GOA:C3MLF9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLF9"
FT                   /protein_id="ACP34557.1"
FT                   /translation="MRVKSLIFMNGSKLLLTLLKDYDVKHIFGLPGESSISLYDQLKEG
FT                   EVLHIITRDERNAVYMADTYAKLTYKPGVVEGPSVGSIYMLPGVAEAYKSSTPLIVITT
FT                   DTPLYGEKENYLTALDQASLFRPITKETITVYNVEELPHAIRRAFRLSTSGKPGPVHIR
FT                   IPLDVLEDELEGNVELKAQKEFSKYPSQRPLADREMIRKAVDLILKSEFPVIICGQGAL
FT                   YSMAWDEVTELAELLGILVGTTITGKGCIPETHPLSIGVVGGRGGANFSNSIVDKSDLV
FT                   ILIGSNTDSANTYNWTIPSRGKTVIHIDISETETGNNYDSINLIGDAKVTLRELIKEIK
FT                   GSGKIGKKNIILDRSAFEDRLSKERREAVNPLRFIRELWSLSPEEAVLIADPGVSAIYT
FT                   AAFYKAKKVGRYFIFNYGLGGLGYSIPASVGAYFARPNSLIFSLSGDGSFGFSVGELET
FT                   IRRVNANVVIIIFNNGSYGWIRAEMKARGKDIVGTDFSSPDYVKIAEGYGLSAYGITND
FT                   EEISDTLKRAIKNTPSLVEVIVEPEDKFVPPVMPWSKRFL"
FT   gene            complement(362642..363520)
FT                   /locus_tag="LS215_0428"
FT   CDS_pept        complement(362642..363520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0428"
FT                   /product="Pirin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34558"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLG0"
FT                   /protein_id="ACP34558.1"
FT                   /translation="MIRGIDGVIKGRNTMDGAGVKLYRVFGGPDTVDLTDPFLLLDFFG
FT                   SNKVEEYINGFPWHPHRGIETVTLLFEGKVEHQDSLGNKGTIYPGQVQWMTAGSGIFHQ
FT                   EMPKPLEGTEIPKYNQDPFLVRGLQLWINLPSYKKMTQPVYRDVKSVPKEKFDFGEVSV
FT                   LAGEFAGIEGPVKVKSDVDPSYIHVKLNGDMKLKVKEGYTVLAYVVDGSARFAPNSPDI
FT                   GKGNLVIFTREGDEIKISGNASFIVLSGRPLNEPVAWYGPIVMNTEDQIIEAFDDLRKG
FT                   TFIRHKEILYE"
FT   gene            complement(364124..364387)
FT                   /pseudo
FT                   /locus_tag="LS215_0429"
FT   gene            364433..365569
FT                   /locus_tag="LS215_0430"
FT   CDS_pept        364433..365569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0430"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34559"
FT                   /db_xref="GOA:C3MLG1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLG1"
FT                   /protein_id="ACP34559.1"
FT                   /translation="MNWKLVVLVIGMSLTFWDIFNVPYIINYARKQFEVSTVIANLPLS
FT                   AEMIGYAIGGVINGLLSSFKGRKIGLLTSMGLVSLGSLIGFLSQTFSWIIIAEFIIGLG
FT                   IEGEISVVPTYISETVSAERRGRAVGLVTASGFLTTLIVGPIAVVLGGEWRLLFLAGLL
FT                   VSLIALITRVWLPESPMWIAKKEMKLSWDFGILMMTIVWFLSYFTGYALFSDPIFTFIR
FT                   SHGFTNPALYFTYILYGDPLGVVIGTLLNDNFERKYSVSLVNILAGLVIVAWFFSSGSL
FT                   MLIMGFMEMFLQGFKFPTMYTYTAEIFRTRIRTLGYGVADGIGHLGGAIGPIIFSLAYV
FT                   NMRLLSFIVLAVVAGIAGAIVGIWGIKTTGKPLESIKG"
FT   gene            365769..366512
FT                   /locus_tag="LS215_0431"
FT   CDS_pept        365769..366512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0431"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34560"
FT                   /db_xref="GOA:C3MLG2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLG2"
FT                   /protein_id="ACP34560.1"
FT                   /translation="MVKILSERRKDVCWITLNRPEKLNALDKESWSLLAKHLRDCNDDQ
FT                   SISAIVLTGNGRAFSAGDDINAMLELKDQRDALDFFNALYSAIESLVDLKKPLLCAVNG
FT                   LAYGGGCEILLFCDVIISVDDATFSIPEGKLGLIPPMAISVGYSILGRSITRLALTGDS
FT                   ITAEEAKTIGLVDMVVKREDLYTEVEKQLEKIKSIDMNSIMTMKYWLKNDKEKIRNAVM
FT                   ELALMSLGDSAKKRMNEFINRKRTR"
FT   gene            366645..367688
FT                   /locus_tag="LS215_0432"
FT   CDS_pept        366645..367688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0432"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34561"
FT                   /db_xref="GOA:C3MLG3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLG3"
FT                   /protein_id="ACP34561.1"
FT                   /translation="MRAVRLVEIGKPLVLKDIDIPKPKGAQVLIKVEAAGVCHSDVHMR
FT                   QGRFGNLRIVEDLGVKLPVTLGHEIAGKIEEMGDEVVGYSKGDLVAVNPWQGEGNCYYC
FT                   RIGEEHLCDSPRWLGINFDGAYAEYVLIPHYKYMFKLRRLNAVEASPLTCSGITTYRAV
FT                   RKASLDPTKTLVVVGAGGGLGTMAVQIAKAVGGATIIGVDVREEAVETAKRAGADYVIN
FT                   ASVQDPLAEIRRITEGKGIDAVIDLNNSEKTLSVYPKALAKQGKYIMVGLFGADLHFHA
FT                   PLITLSEIQFVGSLVGNQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAV
FT                   GRQVLIP"
FT   gene            complement(367734..369548)
FT                   /locus_tag="LS215_0433"
FT   CDS_pept        complement(367734..369548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0433"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34562"
FT                   /db_xref="GOA:C3MLG4"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLG4"
FT                   /protein_id="ACP34562.1"
FT                   /translation="MKVSLDFLNDLVHGDSVKKLESLNNYRLIEFLSNIIKLCEPDSVY
FT                   LITGRNEEKEYIRKKALERGEEIKLKTSGHTIHFDHPLDQARAREDTFILTDSKIPYVN
FT                   TIPRNEGLNEILGLLKGSMRGREMYVGFYSLGPRNSPFQILAVQVTDSPYVIHSENILY
FT                   RNAFGDFNNNKQFLRFVHSKGELDIRKRRIMIDLADNTVYSINTTYAGNSMGLKKLALR
FT                   LTITKAAEEGWLSEHMAIIGFNGDKGIHYFTASFPSGSGKTSTSMIGSLISDDLAFIRE
FT                   FDGFPKAVNPEIGVFGIIQGINARDDPIIWEVLHKSGEVIFSNVLMTEDGDVYWEGSEL
FT                   PKPERGYNYEGKWIRESGKPASHPNARFTVPLTSFKNLDGNWDNPNGVVIDGIIFGVRD
FT                   YSTLIPVVEAFSWSHGVATIGASMESARTSAVIGKSDELEFNPMAILDFMPISLSRYLR
FT                   NYLNFGKRLRRSPKIFGFNYFLKDENNKFLNSKEDKRIWVSWAVKRVEETTDAIYTPIG
FT                   FIPFYEDLKALYKRVLGREYSKEEYEKQFKIKLKRYLEKTDRIIGIYLKFDDIPSEIIS
FT                   ELEMQRKRIIDYISKYGDSVSPFRLEKT"
FT   gene            complement(369720..371117)
FT                   /locus_tag="LS215_0434"
FT   CDS_pept        complement(369720..371117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0434"
FT                   /product="glycosyl transferase group 1"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34563"
FT                   /db_xref="GOA:C3MLG5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLG5"
FT                   /protein_id="ACP34563.1"
FT                   /translation="MIVSVTAELGLDIGQNFAGGLGILEGDKFYAASRLSINYTVITLF
FT                   YRRGYVNGEEKQKELLSNLNKEWESEITLGGQRIKVEYLAYTLNTAKAIFANPLNTKFN
FT                   DQLYVENSDEERFYKCLLLARVAENYINEKIGWDKVKYVDMQEACPAFLPLIRYFPSYR
FT                   IIIHTPAPWGHPIFPSYLFKKEFGYEFPLDHVVMTDIGLSSSIEGIVVSKKMLKHVGRT
FT                   FPQHMYKIRAVTNGVEIPRWRHPLLNDVKDLDDFIKKRKEVKRDIIKKLGKDTDKPTIA
FT                   WLRRITAYKRPDFILRLIDDLKDDVFFIIGGLAHPKDYSAVEMERRLKEISEMKNNVIF
FT                   VRGADANLMKLAIWASDIWTFTPFSGWEASGTSFMKAGINGVPSIASRDGAVPEIINDG
FT                   YNGWLFGEDRETLLPLNVYDDKKEYEEFLKKIKLALSQFYEVGYNAYKTFPTYCAMDRL
FT                   MKEYGYP"
FT   gene            complement(371162..371755)
FT                   /locus_tag="LS215_0435"
FT   CDS_pept        complement(371162..371755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34564"
FT                   /db_xref="GOA:C3MLG6"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLG6"
FT                   /protein_id="ACP34564.1"
FT                   /translation="MKKAELLFNAYKSRKEIEPFPLTEDEAKKVKEEFIEILINSEGLG
FT                   GYKLSGFGEGVLTKPMITRENTVELWFRNHKLEVEIVTLVENGEVKRTFLGLEIPAPRF
FT                   TTWDLPSHYIVADNIFAARLYVGPEIDPPFGSFKLYINDKFVGEGEPKYKPEEKVKEYM
FT                   KGYVSLGVFIGPTSVKKGDKIRVEGKKSIRVSLI"
FT   gene            371847..373400
FT                   /locus_tag="LS215_0436"
FT   CDS_pept        371847..373400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0436"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34565"
FT                   /db_xref="GOA:C3MLG7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLG7"
FT                   /protein_id="ACP34565.1"
FT                   /translation="MVFVNEKTYQRYVEERREEEFHKEYERALDHIELGKEYPILIGKD
FT                   EIKLSSKYIVKTPVDTSLTFAITQKDDGNNLRNAIKIARESFDYWQYSDWKDRVEFAYK
FT                   AAEELRRRKFELAAIVTYENGKNRYEAIAEVDETIDYFLYYAKLLEDNRGYIRQMEGRI
FT                   YKNEKAFSVMRPYGTWLIISPFNFPLAITATMTLGALLTGNTVVVKPSSDTPVSAYMLV
FT                   TIMRRAGFPLEAVNYVTIPGELITPALDEVDGFAFTGSRDVGHKLLKTFINRKPRPAVL
FT                   ELGGKNATIITAKADLNKAIEGTFKGAFGYGGQKCSATSRVFVESPIYDEFLKRLKEKV
FT                   EKTVIGDPRKRETFLGPIINKGAIEKFRRYVKQAVEEGGKILVGGRVIDDEKIYLVEPT
FT                   IIVELPYSSPLWKTELFVPILLVKEVKSLEQAVKLANDVDYGLTAGIFSDDPKEIQYLF
FT                   DHIEAGVVYANRTAGSTTGAMPGVQPFGGWKDSGWTGRNAGGPYYLLSFIREQARTVYD
FT                   "
FT   gene            complement(373537..375190)
FT                   /pseudo
FT                   /locus_tag="LS215_0437"
FT   gene            373683..374755
FT                   /pseudo
FT                   /locus_tag="LS215_0438"
FT   gene            complement(375361..375996)
FT                   /locus_tag="LS215_0439"
FT   CDS_pept        complement(375361..375996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0439"
FT                   /product="2,
FT                   5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine
FT                   1-reductase"
FT                   /EC_number="1.1.1.193"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34566"
FT                   /db_xref="GOA:C3MLG8"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR006401"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLG8"
FT                   /protein_id="ACP34566.1"
FT                   /translation="MRPYVIIFSTLSIDGRLATKTGYSELSCPYDKQRQHEIRSEVDAV
FT                   MVGANTVRVDNPSLTVKYSKNRRNPIRVVVTRSFNLDPSYKIFTTPPSTIVYTSNYESE
FT                   KVEEFNRKGVIVRKFLHLDDLLEDLYNSFNVKRLMVEGGGHLIWWFIRDNLYDEIRITI
FT                   SPRIFGNGVSFAQGDGFIGEDSPRLTLIDAKICECRNEVHLTYQKYMA"
FT   gene            376206..379232
FT                   /locus_tag="LS215_0440"
FT   CDS_pept        376206..379232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0440"
FT                   /product="peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34567"
FT                   /db_xref="GOA:C3MLG9"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR012393"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028204"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR029414"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLG9"
FT                   /protein_id="ACP34567.1"
FT                   /translation="MKAYYMYPDIRGDLISFTSDDDVWLLSLKDMKPLRITSGLGVSIR
FT                   PKISPSGRKVAFTVVWLKSGKQGGDIYVVEDGQARRVTYFGSRNSRVANWLSEDEIIVI
FT                   TDFHTPFGQWNEAYKVDVNNGETEKLPFGMLSNIVKRDNVIVIVRGYQDLPNWKGYKGG
FT                   TKGELWISRDGGKTFEKFVSLDGNASWPMIVKERVYFLSNHEGVGNLYSVDLNGKDLRR
FT                   HTNFTDFYCRNANSDGKRIVFQNAGDIYLYDPEKDSLSKLDIDLPTDRKKRQPKFVSVI
FT                   EYMNEAVVNGNYIALTSRGKAFLMRPWDGPAVQLGKKQGVKYRQIQALPNGDVIGVNDD
FT                   DKLVILGKDGNEKVINRDFARIERVKVSPDGKKILLSNNKLELWVYEIDSDNARLIDKS
FT                   EYDLILEFDWHPNGEWFAYAFPEGYYTQSIKLARIDGKIVRITTPYGYDFSPSFDPDGR
FT                   YLYFLAARHLDPTNDKVIFNLSFQRVVKPYLVVLGNYYSPFNQPLDESSSNDKNVVIEG
FT                   IEDRVIPFPIEEENYVQIAGAKNNKIFLFSYPIRGLRTQTGDVFGRLEVYDLENKAKEL
FT                   YADNVSSFSLSSDKSKILLMLKDNLRLFDVNAKPDFNSAGRKGGVIDLSRVKVYVEPEK
FT                   EWRQMLKETWKLMKQNYWNEERLKNWDSVLPKYERLLDRVSTRFELSDIIQEMQGETRT
FT                   SHSYETAYDYDTPEPLSVGGLGGEFEYNENNKCYKITKIYVGDSTNENERSPLRDPGVQ
FT                   LNVGDCIKAIDGEEANGNIYSHLVNKDQVILDVITNDGKNKRVTVKVLKDERFLIYRYW
FT                   VEKNREYVHEKSKGRLGYIHIPDMMYQGFAEFYRLFMSEFHREGLVVDVRFNRGGFISG
FT                   LLLEKLLLKRVGYVHPRNGKPIPMPYFSSPKVLVGITNEHAGSDGDIFSFLFKKYKLGV
FT                   LIGRRTWGGVVGIRPRYRLVDKTYISQPEFAVNFEDVGFGIENYGVDPDIVVEIKPEDY
FT                   ASNSDTQLDTAIELALKQL"
FT   gene            complement(380032..380375)
FT                   /pseudo
FT                   /locus_tag="LS215_0441"
FT   gene            complement(380375..380602)
FT                   /locus_tag="LS215_0442"
FT   CDS_pept        complement(380375..380602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34568"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLH0"
FT                   /protein_id="ACP34568.1"
FT                   /translation="MKSTIAVSKKVKEVLERKKREMEIKLNKPLSWDEFFQNIFREEEE
FT                   RIPKLTEEEAEILKDLTKEDRKNWRIREFV"
FT   gene            complement(380703..382889)
FT                   /locus_tag="LS215_0443"
FT   CDS_pept        complement(380703..382889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0443"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /EC_number="5.4.99.15"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34569"
FT                   /db_xref="GOA:C3MLH1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLH1"
FT                   /protein_id="ACP34569.1"
FT                   /translation="MITGTYRLQLNNGFTFYDVIENLDYFKELGVSHLYLSPILKARPR
FT                   STHGYDVVDHSEINEELGGEEGYFRLVKEAKSRGLGIIQDIVPNHMAVHHTNWRLMDLL
FT                   KSWKNSKYYNYFDHYDEDKIVLPILEDELNIVIDKGLIKVQKDKIEYRGLILPINDEGV
FT                   EFLKKINCFDNSCLKKDDIKRLLLMQYYQLTYWKKGYPNYRRFFAVNDLIAVRVELDEV
FT                   FRESHEIIGKLLVDGLRIDHIDGLYDPKEYLDKLRQLVGNNKIIYVEKILSINEKLRDD
FT                   WKVDGTTGYDFLNYVNMLLVDGNSEEELTEFYESFIGIEINIDELITQSKRLVANQLFK
FT                   GDIERLSKLLNVDYEYLVDFLACIKKYRTYLPYEDISTIKQCDKEGRLRDEKGIMRLQQ
FT                   YMPAIFAKGYEDTTLFIYNRLISLNEVGSDLRRFSISIEDFHNFNLSRVNSISMNTLST
FT                   HDSKFSEDVRARISVLSEIPKEWKERVAYWHDLLKPNIDKNDEYRFYQTLVGSYEGFDN
FT                   RERIKNHMIKVIREAKVHTTWENPNSEYENKVLDFIDGAFESSSFRNDFENFEKRIVYF
FT                   GYMKSLVATTLKFLSPGVPDIYQGTEVWRFLLTDPDNRMPVNFKKLRELLNNLTEKNLE
FT                   LSDPRVKMLYVKKLLQLRREYLLNDYKPLPFGFQRGKVTVLFSPIVTREIKEKINIRQK
FT                   SVNWIRNEEISSGEYNLSELIGEHKVVILTEKSG"
FT   gene            complement(382886..385042)
FT                   /locus_tag="LS215_0444"
FT   CDS_pept        complement(382886..385042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0444"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /EC_number="3.2.1.68"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34570"
FT                   /db_xref="GOA:C3MLH2"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLH2"
FT                   /protein_id="ACP34570.1"
FT                   /translation="MSVFFRTRDRPLRPGDPYPLGSNWIEDEDGVNFSLFSENAEKVEL
FT                   LLYSQTNQKYPKEIIEVKNRTGDLWHILVPGLRPGQLYAYKVYGPYKPALGLRFNPNKV
FT                   LIDPYAKAINGNVIWNDAVFGYKIGDQNQDLSYDERDSSEYVPKSVVINPYFEWDDEDF
FT                   IKRNKVPLKDTVIYEVHVKGFTKLRLDLPENIRGSYEGLTSEQMISYLKDLGITTVELM
FT                   PVFHFIDQRFLIDKGLTNYWGYDPINFFSPECRYSSSGCLGEQVFSFKKMVNELHNAGI
FT                   EVIIDVVYNHTAEGNHLGPTLSFRGIDNIAYYMLQPDNKRYYLDFTGTGNTLNLSHPRV
FT                   IQMVLDSLRYWVTDMHVDGFRFDLAAALARELYSVNMLNTFFIALQQDPILSRVKLIAE
FT                   PWDVGQGGYQVGNFPHQWAEWNGKYRDSIRRFWRGEALPYSEIANRLLGSPDIYLGNNK
FT                   TPFASINYVTSHDGFTLEDLVSYNQKHNEANGFNNQDGMNENYSWNCGAEGTINDQNVI
FT                   MCREKQKRNFMITLLISQGTPMILGGDELSRTQRGNNNAFCQDNEITWFDWNLDERKSK
FT                   FLGFVKKMIQFYKAHPVFRRERYFQGKKLFGMPLKDVTFYTPDGKEVDEKTWNSPTQTV
FT                   IFVLEGSVMDEINIYGERIADDSFLIILNANPNNVKVKFQKGKWELVVCSYLREIKPEE
FT                   RIVEGEKELEIEGRTALVYRRIEL"
FT   gene            complement(385211..386896)
FT                   /locus_tag="LS215_0445"
FT   CDS_pept        complement(385211..386896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0445"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34571"
FT                   /db_xref="GOA:C3MLH3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015156"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLH3"
FT                   /protein_id="ACP34571.1"
FT                   /translation="MAFGYRLDRNAATFNLWAPYQRNVKLKILNKGIYEMERDEKGYFT
FT                   ITLNNVKVGDRYKYILDDGSEVPDPASRYQPEGVHGHSEIISLDFKGDDENGVKVKRED
FT                   LIIYELHTSTFTSEGTFEGVIKKLDYLKELGVTAIEIMPIAQFPGKKDWGYDGVYLYAV
FT                   QNSYGGPIGFRNLVNEAHKLGLAIILDVVYNHVGPEGNYMAKLGPYFSEKYKTPWGLAF
FT                   NFDDAGSDEVRKFILENVEYWINEFHVDGFRLDAVHAIIDNSPKHILEDIADVVHKYGK
FT                   IVITESDLNDPRVVNPKEKCGYNTDAQWVDDFHHAIHAFLTGERQGYYSDFGSLDDIVK
FT                   SYKEVFVYDGKYSNFRRKTHGKPIGDLDGCKFVVYIQNHDQVGNRGGGERLIKLVDKES
FT                   YKIAAALYMLSPYIPMIFMGEEYGEENPFYYFSDFSDPKLIQGVREGRKRDNGQETDPQ
FT                   SDSTFNASKLSWKVNDDIFSFYKTLIKIRKEYGLACNRKLTVENGNHWLTVKGNGYLVV
FT                   YVFSQSIIEMKYRGTLVLSSNNSFPSQIAENKYKLEKGFALYKL"
FT   gene            complement(386916..387401)
FT                   /locus_tag="LS215_0446"
FT   CDS_pept        complement(386916..387401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34572"
FT                   /db_xref="GOA:C3MLH4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLH4"
FT                   /protein_id="ACP34572.1"
FT                   /translation="MNVIFDVLNEIHGFFGALWAGAALLNFLIRPQEKRQFERIGKFFL
FT                   ITSIITIITGIVIFAYIYLAPYQGNLFLVAAILRSSLDIRIRVFLNLVGGAFGLLAFGA
FT                   GIVISNRIRLMIRFKEGDTRVLELRKSVSNLSKISLIFLLLSLAMMILAGSIAQVIT"
FT   gene            complement(387451..389547)
FT                   /locus_tag="LS215_0447"
FT   CDS_pept        complement(387451..389547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0447"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34573"
FT                   /db_xref="GOA:C3MLH5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLH5"
FT                   /protein_id="ACP34573.1"
FT                   /translation="MRRIDVYDLLIGKGNYVDDISYKGRYAVFIRSPYPHARIVNINKE
FT                   DAERRGALVLTGKDLVSRRVESGEREGASLTIPLMAINKALYVGQPVALVIANDPYEAT
FT                   DLAELVQVHYEPLEGIGSIEKALQNKVVVFEDLKTNVVREQTFEFGKINTQGRHLELDL
FT                   YWSRSSGNPIEPYGAIIIPTDDGLTIISNQQAGNVVSNEIQKALGVKVIHKNARQGGSF
FT                   GEKFSLVRYLTVLGFAALKFNVPIKWIETRTEHLMASNGSGPERKFKIHAYYSSDGRVN
FT                   SLDIHIWEDIGASRDAGQPFKPLGFLTGPYKIGGIRYTGTLVATNKNPAGAFRGAGTPP
FT                   HTWALERTMDAIADDLGISKAEVRKINAIDIFPYDTGFAYYDSGNPKGLLDLALSRNDI
FT                   FALRNKNTGVGLALSTDPSTPSGSERVKIKVKNNKVVIGLGFGPEGQGNEHSAVVMASR
FT                   LLGISPDDVTYEILDNTELPTSFGPGGSRMAIYTFGAVSGAVEELKARLRRKAEVILND
FT                   KVVDYRDGYFIGENGGKVRITSLEGEEVDFTYTLQGKYRFNAYPFACDLAVVRIEDGKI
FT                   KPIKHVVYIDPGTPIDEDLVKEQVIGGTAIGISLALYERYAYDDNANLLTTNLADYGMP
FT                   TAADLPEIEVNIVPTPSPSTPYGAKGIGEIPVGIAAAAVTSAIEDVIKRRINRVPVSLE
FT                   GLFE"
FT   gene            389669..390295
FT                   /locus_tag="LS215_0448"
FT   CDS_pept        389669..390295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0448"
FT                   /product="TENA/THI-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34574"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLH6"
FT                   /protein_id="ACP34574.1"
FT                   /translation="MNILEQIRKELEGLNGQIINHPLLKEKVLRKEVVNSFVINQWYIV
FT                   NHDLRSLAIGLSKSTNMEELDIFKILVDGDYAALKELVKLMNELGIEVKDPLLYNVSPQ
FT                   AISYTHYLSWLANYAKPSEFLFAGIVNLPVWANVVTRFGDMIKERFGIRETGFFDAFRG
FT                   SYKELEDRIVKLVEDYQVDRLRRIAYTIQYYEKSFWDSIYVVHQQ"
FT   gene            390342..392159
FT                   /locus_tag="LS215_0449"
FT   CDS_pept        390342..392159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0449"
FT                   /product="Peptidase S53 propeptide"
FT                   /EC_number="3.4.14.9"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34575"
FT                   /db_xref="GOA:C3MLH7"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLH7"
FT                   /protein_id="ACP34575.1"
FT                   /translation="MESENVMLKRLLMLLLILVLSTTTFLATIAQSQEQYYYIQTSSPQ
FT                   YSIVPGSEFVEPLNTSQPLYIAVLLNFTNLPSLQSYLNETYLQASHFHKWLTPSQFREY
FT                   YYPSKSYVNSLISYLKSYNLEFLGNYGLILVFNGTVGSVENAFHTYINVYYYPFKNLYW
FT                   FGLLGIKDIGPFYYYSNNVTPSLPYNVGKYVLGVVGIDSLDPKVVNVIKQAWHLDMVKA
FT                   QSGLVSKAIISPMTIGKYFNFTMAYEHDYNGNGSNIAIEGVPESFINVSDIYLFWQLYG
FT                   IPRTGHLNVIYFGNVTTGGQSGENELDAEWSGAFAPAADITIVFSNGYVSGPQLVGNLL
FT                   NYYYEYYYMVNYINPNVISISVTVPESFLAAYYPAMLYMIHNIMMQAAAEGISVLAASG
FT                   DWGFESDHPPPNFHIGTYNTIWYPESDPYVTSVGGVFLNASSNGSIVEISGWDYSTGGN
FT                   SVVYPAQSYEITSLIPFTPTVVRTYPDIAFVSAGGYNIPEFGFGLPLVFNGQLFVWYGT
FT                   SGAAPMTAAMVSLAGTRLGALNFALYHISYQGIIESPLGNFVGKVAWIPITSGNNPFPA
FT                   HYGWNYVTGPGTYNAYAMVYDLLLYSGLI"
FT   gene            392230..393003
FT                   /locus_tag="LS215_0450"
FT   CDS_pept        392230..393003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0450"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34576"
FT                   /db_xref="GOA:C3MLH8"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLH8"
FT                   /protein_id="ACP34576.1"
FT                   /translation="MEKEISYDSEGAKIRAFLASPENPKLAVIVIHEIWGLNDNIKDIS
FT                   RRLANEGYMALAPQLYTRNEDVLNQENIQNVMMKVWNIPPEKRNDPNSYQQIMSALDEK
FT                   GKRVAELLVLNRQKTEEQMIKDAIKAYEYVSSQGVKKIVSMGFCMGGGLAFQLATEVPL
FT                   DGTIVFYGRNPQPLETIQKIKGPILGLYAGEDPPIDAGLPDLISAVIKYKKDLELKIYP
FT                   GAYHAFFNDRGRSYNKEASEDAWERVKNFLRRVSK"
FT   gene            393133..394062
FT                   /locus_tag="LS215_0451"
FT   CDS_pept        393133..394062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34577"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR029461"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLH9"
FT                   /protein_id="ACP34577.1"
FT                   /translation="MVFKFKIGFFTDVHGSEYSFKRSLNIAKARKVDFLIVSGGLMAKE
FT                   IMFVEDVGGKYFLNGKKVNLNNLNEDALRSGKYIVIDKKEVIEDIKSDKSKLEKVISEK
FT                   VTEQMSRWVKIADEVFRLERVFWSSAHGDILQLESILKNYGGKPINENVINLEEIQIVS
FT                   LGYGSPIGNSYREIPDSELYIKGKSLLKDADKERLIMNFHMPPLNTKLDNAKVGLRKSH
FT                   VGSKAVLDLITEFQPLISLHGHVHESTSMDKIGDTIAINPGSLYQLGDPSIVIFEVHKE
FT                   LKSFGSVSASKYVIKNIEFVSTNPLDVV"
FT   gene            394104..394607
FT                   /locus_tag="LS215_0452"
FT   CDS_pept        394104..394607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0452"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34578"
FT                   /db_xref="GOA:C3MLI0"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLI0"
FT                   /protein_id="ACP34578.1"
FT                   /translation="MAIGKTVLIVGVIILIVGIALFFIGGYLASSGLIKVINSISKATP
FT                   TTLQPGTSQDLGVPTKLSILLYNTSSGQVLKILQEINGTNQSVPQIAEKGYVIALLSPK
FT                   YDTIMVNNLTTPISVKYVLSQELASSLVNVALYTGLGFFLAIIGVIVLLVGLVLFLRGR
FT                   GKKQ"
FT   gene            394734..394895
FT                   /locus_tag="LS215_0453"
FT   CDS_pept        394734..394895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34579"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLI1"
FT                   /protein_id="ACP34579.1"
FT                   /translation="MRLVTTSNAEAKKAWKMLRLMFVCCIQDKFPKVEISEHPLDIEDI
FT                   YTEDDLRS"
FT   gene            complement(395018..395542)
FT                   /locus_tag="LS215_0454"
FT   CDS_pept        complement(395018..395542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34580"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLI2"
FT                   /protein_id="ACP34580.1"
FT                   /translation="MPIIVRKVHKKADGSTIWIRVGESPPVIKDGNVIDGGFFIRIGDD
FT                   KSDKIIRLSDQEALDIAYRIIEAYRRHVRIFTKLDELSYEQYKKSKEVVKDEEEDEEEI
FT                   EKIEEKRNLTPDKIEAELIDYLTAAGGETTLDKVREDLGEEYAAYLRTMKNKGIIIEGT
FT                   RVKLGKNFKNT"
FT   gene            complement(395797..395982)
FT                   /pseudo
FT                   /locus_tag="LS215_0455"
FT   gene            396120..396371
FT                   /locus_tag="LS215_0456"
FT   CDS_pept        396120..396371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0456"
FT                   /product="transposase ISC1190"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34581"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLI3"
FT                   /protein_id="ACP34581.1"
FT                   /translation="MEAPVAEINISKDKLVVYFQGGFYELPNNRQGFEKIRQTLSKGCK
FT                   VGIESTRVYHVNLDKRLMGEYDVMIINPLRISSTSRFS"
FT   gene            complement(396906..397073)
FT                   /pseudo
FT                   /locus_tag="LS215_0457"
FT   gene            397799..398197
FT                   /locus_tag="LS215_0458"
FT   CDS_pept        397799..398197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34582"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLI4"
FT                   /protein_id="ACP34582.1"
FT                   /translation="MSNGSVLLPSPYPCGSQVLVGLKVFKGYYTTSNISLAKPLSLYEP
FT                   GTYFCPLIYAVTQYKLLPLSDQVQLICNGRVQATLNAEISASLNGCWITNSISSLSGGK
FT                   FTFFQPGVYTVEAVDYFNQTVLGYFTVT"
FT   gene            complement(398513..399583)
FT                   /locus_tag="LS215_0459"
FT   CDS_pept        complement(398513..399583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0459"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34583"
FT                   /db_xref="GOA:C3MLI5"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLI5"
FT                   /protein_id="ACP34583.1"
FT                   /translation="MLFDLHPKQNREELFGRDYEIEYVINQILSGNWVIIGGQREIGKT
FT                   SLMKVVINELRKKYGFKGIYVSLRGVRSLNSLLNLIILELNKSKTQINLRVSINFVVGS
FT                   AGIELKRNAKAANSLIELFNSIQEEFVIGIDEVQEISKASRQFLDVLGNVFSTNPKVKF
FT                   IFTGSYVGVTKTLINPSASSPLHGRPPALLNLKPFNEELSKGFLRKGMEELNVSFDKED
FT                   EVVKKLDGIVGWLTLFGNFYAIRRMDFKEALNLTLEEGKKIMIEEFNHFLESKTNKQLY
FT                   LIVMETLKFVNRWKDIKRGVEIKMGKVDDKELSLALDALINGNFVTRGERREYTITDPI
FT                   LKEIDFEKLSSRNAFI"
FT   gene            complement(399956..400185)
FT                   /pseudo
FT                   /locus_tag="LS215_0460"
FT   gene            400505..401152
FT                   /locus_tag="LS215_0461"
FT   CDS_pept        400505..401152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0461"
FT                   /product="CRISPR locus-related DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34584"
FT                   /db_xref="GOA:C3MLI6"
FT                   /db_xref="InterPro:IPR010163"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLI6"
FT                   /protein_id="ACP34584.1"
FT                   /translation="MEGNTLVFGLGFTSEYIVRSITERGRDNIDEVVLIGVFNIDDFRR
FT                   KQADNALNDVKKFLDIINVKYKWKYVDVNKDFAEILYEVANELSGKNNLEFYLIGGMRI
FT                   INFVLYYYATLAKRFGLNVRVFNYTEDMSKKYELPVEIPRRLTDSEAEILKLFKFENSI
FT                   EISIMADRLQKTLSTISKQVSEMEEEGFLECTKTRPKTCRKTILGRIALTFI"
FT   gene            401528..402394
FT                   /locus_tag="LS215_0462"
FT   CDS_pept        401528..402394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0462"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /EC_number="1.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34585"
FT                   /db_xref="GOA:C3MLI7"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLI7"
FT                   /protein_id="ACP34585.1"
FT                   /translation="MRVGFIGLGIMGGSMAMRIHKAGFPLIVYNRTKSKTELFAKLDIP
FT                   IANTPKEVAEKSDVVIDMVTDAPDVEEVLFGPNGVIQGVHQGLIVIDMSTNSPEYARNF
FT                   AERLAKYGIEFLDAPVTGGDKGAREGTLTIMVGGKYEIFQRVKPIFEAMGKTIVHAGGV
FT                   GNGQMLKLLNQTVVGINMLAVAEAMALAKKAGIDMEKLFTVLSTGAANSFTVQYYMPKM
FT                   MKGDYEPGFRAAHLKKDLKYVLETANKLNVPLPGTALTLQLYNALVAKGLGEKGTHTLI
FT                   KVYDDLS"
FT   gene            complement(402489..402764)
FT                   /pseudo
FT                   /locus_tag="LS215_0463"
FT   gene            complement(402792..403529)
FT                   /locus_tag="LS215_0464"
FT   CDS_pept        complement(402792..403529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34586"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLI8"
FT                   /protein_id="ACP34586.1"
FT                   /translation="MKIRVSIISLKGGVGKTTIALNTALYLSKRYKVLYIDKDLLSMGS
FT                   LILGFNGLGFHKAIVEGLGNEQYEYKVNNNLTLFKLYSEPVNEKELHDKMKDIGEKAKK
FT                   AYVDVISKGYDVIIVDYGRIFRTNDPLVYDEYEMFKKNFPDYLIATVGITDAIRNDITN
FT                   VVKYFLDTINGTKAKPLAFVINMVPPISDIQKEIGQMAREISEIVKCDTLIIPFNEKLV
FT                   QYSNIGEVEEMQKLGKLIEGILY"
FT   gene            403649..404286
FT                   /pseudo
FT                   /locus_tag="LS215_0465"
FT   gene            complement(404530..404934)
FT                   /pseudo
FT                   /locus_tag="LS215_0466"
FT   gene            404986..406114
FT                   /pseudo
FT                   /locus_tag="LS215_0467"
FT   gene            complement(406150..406736)
FT                   /pseudo
FT                   /locus_tag="LS215_0468"
FT   gene            406819..407019
FT                   /pseudo
FT                   /locus_tag="LS215_0469"
FT   gene            407105..407842
FT                   /locus_tag="LS215_0470"
FT   CDS_pept        407105..407842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0470"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34587"
FT                   /db_xref="GOA:C3MLI9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLI9"
FT                   /protein_id="ACP34587.1"
FT                   /translation="MKCKIPFVELPNSFPKSDVDVYRVLEEDGKYYIRLELDGRPMYLT
FT                   FSTNEIVLHSKELYEMVSREEIDDCSPLGILDEIFYIMLYQLGTKRTQLFLEFDNLFDL
FT                   ITSGKIKDSKRIILLRKRILANYSDSTVIYYVSRRLSKFLSAESIEDVKFNYERAELLV
FT                   TRSGDLYNIYLTEVQNDLNEIIKKLTSISFIFMPITAIASIYAVDYTNVYNTLINWQSL
FT                   IFLSPVLILTVLLVIYLRRIKWL"
FT   gene            408156..408858
FT                   /pseudo
FT                   /locus_tag="LS215_0471"
FT   gene            408859..409671
FT                   /locus_tag="LS215_0472"
FT   CDS_pept        408859..409671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0472"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34588"
FT                   /db_xref="GOA:C3MLJ0"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLJ0"
FT                   /protein_id="ACP34588.1"
FT                   /translation="MIVVHAAIGANSGPGTPLSLYWWGLDVIFPIGIVFFVFGVIYRIA
FT                   REFLFSRAAINGQAGFTAEFKEAVSAIPRPFGRAARRDPLLILETIFNHVFILGLIIVV
FT                   GIHIIAWNYIFSGLTGIQNILGWLMPASVPESFTSGYQLGILGSNSYSQGGIMNPVGAW
FT                   NSAQVATNTISPWGVLSVIVNGNFMTLLALAGLVGYLVTRIVDDTTRHRMISSVGDYVF
FT                   LILLAAIMITGLGAAYDWGFPFLGIPNQANWYGLHIALIGNIYRIYAI"
FT   gene            409698..410897
FT                   /locus_tag="LS215_0473"
FT   CDS_pept        409698..410897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0473"
FT                   /product="Fe-S oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34589"
FT                   /db_xref="GOA:C3MLJ1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLJ1"
FT                   /protein_id="ACP34589.1"
FT                   /translation="MYRRDLQVVCMAKEEFKCGGFRLSKGKIEINRKLASRTFDEFTPS
FT                   DVMGIENCMRCGICSYSCPFWLETKKFYDVPAWRTYEINKIYSMFYTGYGIVARYLRLR
FT                   RISGNEFKHWTESAYDCTACGACTYTSPMEVPNWYTAIIMRRILHYSGFNYESAEKLIR
FT                   NSKEKGNALGIENWGEVASKVGFNIDKKDSEILYVTSPLEIQNTDVLANTLSVLNKLKL
FT                   NVTVSSEISDPGYYAYLMGYFETARGMLVKVYETAMKLNVKKIITTDGMGYFWLRWQGP
FT                   KSVKENPPIEVEHLTKTVYEMYKQGRVKLEKADIVAPTTVHYSEFLSRLGGIEEPPREI
FT                   LRLTAPQFIEPKERPSSDKLYTCGHHVELIDEKKDILKRVRSYVVSQLTKWGREKHDSI
FT                   "
FT   gene            411036..411341
FT                   /locus_tag="LS215_0474"
FT   CDS_pept        411036..411341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0474"
FT                   /product="RNase L inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34590"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLJ2"
FT                   /protein_id="ACP34590.1"
FT                   /translation="MISDITKVLDENVRQSVRELIYPVITEREDSVLILKEILREYNLN
FT                   LEIKENRNIRISETRRLAALASNVTPLNIENPEDVLWKLAEAIKPKGASRCQKSQQ"
FT   gene            411320..411766
FT                   /locus_tag="LS215_0475"
FT   CDS_pept        411320..411766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34591"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLJ3"
FT                   /protein_id="ACP34591.1"
FT                   /translation="MSKVAAIGYWYKGDYQIPLLVMEEARREGIEVIDLSLGAIKASTF
FT                   LFQLNLDNLILLASEKRGKKELRVYRPEFDGSTFSDFLEIYSGMKAYFMDVDSFIKMAR
FT                   VMGSLPSDLIVVECEVVNNDGEISEWGKTCKEMMKKEVLKRSGK"
FT   gene            411718..412275
FT                   /locus_tag="LS215_0476"
FT   CDS_pept        411718..412275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34592"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLJ4"
FT                   /protein_id="ACP34592.1"
FT                   /translation="MQGNDEKGSIKKVRKIREMAYTISFLRSIPREIVNSFFSTNSLEF
FT                   NFKGVKINLILDERDNNFIKQIMFIGDESQKLVNDLINFLKARYSLRLDEIVWSYEVYL
FT                   EVEGDFNITKGLQIPSVLPLIGNVTNYGIVITNDPDFKMMNRNFTTVQIDKYVRVIKRS
FT                   QNFIDIVNLLNELEKLLDKIKI"
FT   gene            412322..413089
FT                   /locus_tag="LS215_0477"
FT   CDS_pept        412322..413089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34593"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLJ5"
FT                   /protein_id="ACP34593.1"
FT                   /translation="MSGITPFDTQLRKVDVDKMFKDYLSDAEKIYEKCKEKGIVALLYG
FT                   SIAVYYKVKDNKLSSDIMKFYRRSGPQDVNFIVRTEDREKFKQVMYNLDYTPYFHLEKT
FT                   LGNIVSMFFKEEKVVRAYYFNEMRFSHVIPVNWNSEFTLNEEDLLLSKLQIHFTLDKHL
FT                   SDVISLLLKYDIEGNKIIELTSADWGLWKDVTDNLLKARDLVGRLITDQVKEREELMPV
FT                   ISRLVRLHGRIMNSQKKPSWKPIPEGEKYWRDF"
FT   gene            413090..413614
FT                   /locus_tag="LS215_0478"
FT   CDS_pept        413090..413614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0478"
FT                   /product="hydrogenase maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34594"
FT                   /db_xref="GOA:C3MLJ6"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLJ6"
FT                   /protein_id="ACP34594.1"
FT                   /translation="MKRIAIVGVGNRLMGDDGFGSYMAEALYGNVKGCDVIDLGAAGAS
FT                   AMEVLKDYDIIILIDAVAMDKDFDISRMDINIDSDEVTSTVLDFEYSGSHGVGIQSILT
FT                   TLKIMGYVPEVYLVGCKPYVLDVKLGLSEQLRRKLDQIVLSLADFLKKNFGIKVTVDDT
FT                   IKKLYGVVNNN"
FT   gene            413610..414266
FT                   /pseudo
FT                   /locus_tag="LS215_0479"
FT   gene            complement(414243..414962)
FT                   /locus_tag="LS215_0480"
FT   CDS_pept        complement(414243..414962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34595"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLJ7"
FT                   /protein_id="ACP34595.1"
FT                   /translation="MWWKKVEPLLELAKGKLKGKKVIAVMSSKGGVGKSVVSALLSLSL
FT                   IPSATLIDLDIHSMGIAKLFGVENRSLEVSKEGIVPIKIGNVNLISLAGIVRDRYVILP
FT                   GRNQSNVMKELIAYSIINSDYVVFDLPPGLGDEVLVLEEITDFKPVAVTTPSKIAIKVV
FT                   KNLIDYLNERGKKSLVVVNMSFFNCHGEREYPFGYYDGDVNLPIDPNLEEYIGKIHEYN
FT                   GDVKKVIDKELIPKLVF"
FT   gene            complement(414922..415353)
FT                   /locus_tag="LS215_0481"
FT   CDS_pept        complement(414922..415353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0481"
FT                   /product="hydrogenase expression/synthesis HypA"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34596"
FT                   /db_xref="GOA:C3MLJ8"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLJ8"
FT                   /protein_id="ACP34596.1"
FT                   /translation="MHEWSIAYSIVKTLANNFTKKVLKATLVIPQFSFLDLEILKDAFN
FT                   ELKKENEITQNTELEIRIAEPRFRCRSCNREFSMSDVEKQLSDIRSQYGEEYPLHLMPE
FT                   LFPVFLKCPYCGSHDIEAKDQEIYIENVVEKSGAVARTS"
FT   gene            415503..415652
FT                   /locus_tag="LS215_0482"
FT   CDS_pept        415503..415652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="Critica"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34597"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLJ9"
FT                   /protein_id="ACP34597.1"
FT                   /translation="MACKIFDPYPKDSRENFYDRENIIDEVEKLVSGKFWPFLIGPKRV
FT                   GKHQ"
FT   gene            415748..416167
FT                   /locus_tag="LS215_2970"
FT   CDS_pept        415748..416167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34598"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLK0"
FT                   /protein_id="ACP34598.1"
FT                   /translation="MIKFQIDLKFVKIEGEKSPSQALQKALSKLGNTIIGIDEVQNIIT
FT                   PWFIRVLSVAYNTTDIRFVYTGSMIVMSKILTGEGKGEKFSYQFKGRPIIEIEIKPFTF
FT                   EESVNFLKYGKDTCNINMSEEEIIDASNTYRGIIV"
FT   gene            416168..416488
FT                   /locus_tag="LS215_2991"
FT   CDS_pept        416168..416488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2991"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2991"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34599"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLK1"
FT                   /protein_id="ACP34599.1"
FT                   /translation="MSYYGNLRSLGYTHHRAQDEVTKIARTIILSEFSSLSEIQQVIIK
FT                   ALSIMKQSRWRDLKKVSEGFLRRDIKDWTFNHALKQLINERIILKENEKYSLIDPLYSI
FT                   VQ"
FT   gene            416542..416970
FT                   /locus_tag="LS215_0483"
FT   CDS_pept        416542..416970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0483"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34600"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLK2"
FT                   /protein_id="ACP34600.1"
FT                   /translation="MLSASEVNEMLKQEEIFNFIGIKFEKLERGYARLKFNFNEKLTRI
FT                   GGILHGGIIFSAVDYAGSYAVRTLENVKDGVTVELKINFLKPMKDGPFIVEARIISEGK
FT                   RLIVVDISAYDGNGNLCAKALGTWVVYRDASSGTQLSS"
FT   gene            complement(416942..417751)
FT                   /locus_tag="LS215_0484"
FT   CDS_pept        complement(416942..417751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0484"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34601"
FT                   /db_xref="GOA:C3MLK3"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLK3"
FT                   /protein_id="ACP34601.1"
FT                   /translation="MIRRSQLYVPAISEKMIRKSIELKADSIIFDLEDAVPPEDKERAR
FT                   ELLIKLVKELDWGKRELCVRVNSLQLLDSYKDITRISKDDKITCIVIPKAENDLSFLHK
FT                   ATGKYLIPLIETAKGLVKIEDIVRSEGVVAVSYGAADLSLSLGGDYNFYEKNEYVKTLI
FT                   VSVARAYDVDAIDKVYFDLKNLDGFRRECEEAKKLGYLGKQVIHPSQIDIANEVFSPSK
FT                   EEIEWAKRVIEAYEKGKREGKGAIRLDDKLVDYVHYKIAKRIIEFQS"
FT   gene            complement(417782..418420)
FT                   /locus_tag="LS215_0485"
FT   CDS_pept        complement(417782..418420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0485"
FT                   /product="GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34602"
FT                   /db_xref="GOA:C3MLK4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLK4"
FT                   /protein_id="ACP34602.1"
FT                   /translation="MSLSQIAYEKILEYIITGKYKPGSTLKEEELASLLKISRTPIREA
FT                   LVRLEKEGVIVKNGKSFTVIPLTESDILQLYEVRINLESLAAKLAAIRASQDEINKIIN
FT                   VLNEIKVSVNADPLTLANLNGNLHRTIAEASHNKYIVDILDSIRLKLKIVRITLFTSFQ
FT                   RRDDEFREHESIVIAIKNRSPDLAYDMMRMHEEKVLEYVKQNILPVLFR"
FT   gene            418585..419682
FT                   /locus_tag="LS215_0486"
FT   CDS_pept        418585..419682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0486"
FT                   /product="high-affinity nickel-transporter"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34603"
FT                   /db_xref="GOA:C3MLK5"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLK5"
FT                   /protein_id="ACP34603.1"
FT                   /translation="MDKWNKGMPSRGKESLVNVVLFYISEVIITGFLFYWLLVSARVVG
FT                   NTPVNISESQIKGTFFTLGVLAYFFGLRHAIDPDHLAAIDNSTRKLIQEGKPAQFTGLF
FT                   FSLGHSTIVILLAVSLIVATRFIVSNISIRENMGSVLGTLISGGFLYIIGSLNFVILLE
FT                   IYQIYNQYTMNKNMDEKKLQDLLLKRGFMSRFFGKLFKVVDKQHYMYPIGVLFGLGFDT
FT                   ASETALLAISAAAAGIFLKLPLWNLLVFPLLFTAGMSLIDTTDGFYMSGAYGWAFSGNP
FT                   IRKLWYNLTMTTISILVAYLIGTLEFLGVVQAEFNFSGPFWELITIINGDRWWSSIGMI
FT                   IIGTFATAWLVSFIIYKVKISKFEH"
FT   gene            complement(419716..419943)
FT                   /pseudo
FT                   /locus_tag="LS215_3013"
FT   gene            complement(419797..420057)
FT                   /pseudo
FT                   /locus_tag="LS215_0487"
FT   gene            complement(420252..421382)
FT                   /locus_tag="LS215_0488"
FT   CDS_pept        complement(420252..421382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0488"
FT                   /product="mandelate racemase/muconate lactonizing family
FT                   protein"
FT                   /EC_number="4.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34604"
FT                   /db_xref="GOA:C3MLK6"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLK6"
FT                   /protein_id="ACP34604.1"
FT                   /translation="MKVKPFSLSIPFNTNPPSDWKDTWDVQLYVKVEDEEDYGWGETLV
FT                   AGSGIINSYLSIINDIVIPVLSKVELTEPTDVRTILEKILFSAGNCGVVSGAISAVEMA
FT                   LWGLKARKSNVELTRLIGGKVRDSVKVYASFPRFGKIDYIIIATRKSIERGFDLVKLHQ
FT                   SPSSVIDAVKAIRGNYKEVKIAIDLNSPFDNLDKAKEFVDKVHKYEIEWVEEPLWPPND
FT                   YDLLSKLTEFSPIPIAAGENEYSLYGFKKMIESGITYLQPDIAKIGGVSKFLEILDLAS
FT                   KHKVRVLPHDRPDASPLSLIYTLNLGLVKSQIEMVEYTIADFPNDLFYSLPKFKDGYIY
FT                   PSENPEVIEENIEKYGYKNRLRILHFSDLESKLTRK"
FT   gene            complement(421385..422551)
FT                   /locus_tag="LS215_0489"
FT   CDS_pept        complement(421385..422551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0489"
FT                   /product="D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein"
FT                   /EC_number="4.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34605"
FT                   /db_xref="GOA:C3MLK7"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLK7"
FT                   /protein_id="ACP34605.1"
FT                   /translation="MEKKPVIKGYIRENGSVGVRNYVTVIPVDDLSNSAAIGVSKLIRG
FT                   TVAIPHPYGRLQFGKDLDLLFHVLSGTGANPNVAGAIVIGIEENWANKVANKIAETGKP
FT                   VEVFPIEGNGDLRVIEKASRKAKEMVQEASEKQRTEVDLSSLVMSIKCGESDTTSGLAS
FT                   NPATGYAVDKLIDYGATVLFGETSELTGAEDIVASRIPDPVLREKFMKIYKEYVDFIES
FT                   QGVDLLGSQPTEGNIKGGLSTIEEKALGNIQKLGTKPITCVLDYLDPLEKNSSRLCFVN
FT                   TSSAAAEAVTLFAAKGSVLHLFTTGQGNVVGHPIIPVVKISANPKTVATMSEHIDVDVS
FT                   DLLQLKVSLREAGERIFNYTIRVANGRLTSAELLQHDEFSPIKLYISA"
FT   gene            complement(422533..422835)
FT                   /locus_tag="LS215_0490"
FT   CDS_pept        complement(422533..422835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0490"
FT                   /product="SAF domain protein"
FT                   /EC_number="4.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34606"
FT                   /db_xref="GOA:C3MLK8"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLK8"
FT                   /protein_id="ACP34606.1"
FT                   /translation="MPHFLIHNKNDNVGVAITDIKAGEEVEGVYIEDMAKGPKIKAINN
FT                   IPLGHKIALSNLKQGDTVIKYGRPIGSAIKEIKIGEHVHVHNIKSNRWGKWRKSQ"
FT   sig_peptide     complement(422761..422835)
FT                   /locus_tag="LS215_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.512 at
FT                   residue 25"
FT   gene            422934..423887
FT                   /locus_tag="LS215_0491"
FT   CDS_pept        422934..423887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0491"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.272"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34607"
FT                   /db_xref="GOA:C3MLK9"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLK9"
FT                   /protein_id="ACP34607.1"
FT                   /translation="MKKVRADELRGLIIEILKEREVEDSDVIADHFVEAELRGHSSHGI
FT                   QRLIPLVKGIELGTISKRLRYEIIRQSGNSMWIDAKASIGIVLWTKLVEREFTSDPISI
FT                   IAVKNSSHIGFLGYYTEKLGKRGLVGIMFGNAELAVVMPGSSRKVLSTTPISISIPPSI
FT                   VLDMALSATSRGKIIEALRRKEKIPLGLAVDENGNPTEDPERALRGGLLPIGGMKGFFL
FT                   MLVLESLVSFLTGSALGSDVKGVLNTESPPNKGEVLIGINPSFFAGYREEIEKLRETLG
FT                   IEFPGEHGLNVRAKRLVDGIPIDEELWNQLRKLSRK"
FT   gene            complement(423874..424401)
FT                   /locus_tag="LS215_0492"
FT   CDS_pept        complement(423874..424401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34608"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLL0"
FT                   /protein_id="ACP34608.1"
FT                   /translation="MIISIAAHSEEPNSELAEKARKFVRSIKACNPMLLLGGYWGLMKV
FT                   VVDEASKENMKTVLILPIERENVIIPRDVISIKSSCEFRCRSVILVRSGDILVSLGGGV
FT                   GTEIEIMIAYAMGKPIFALSNTGLSTDQFAKAFPEYIDDRKVIKIRYFEDPEEMAKEIC
FT                   KSEMKSVKTTFG"
FT   gene            complement(424421..424969)
FT                   /locus_tag="LS215_0493"
FT   CDS_pept        complement(424421..424969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34609"
FT                   /db_xref="GOA:C3MLL1"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLL1"
FT                   /protein_id="ACP34609.1"
FT                   /translation="MKFGLLTTIGLSLLVLSLLSINSPIHSYVSISNPYSIKIPNIAYV
FT                   NARLLENNSNVTVYAKLVHNGNVENIVKLPYYLELTPGIWEFSIYNETFPITLTKVINA
FT                   TVVNKSNGIVYVYEYQKIEKYQEIVTTKNATYPIALEVTIYKVNILQYKTIAEILGVLL
FT                   LFIDIILLAFRFIRDNHKL"
FT   gene            complement(424974..425711)
FT                   /locus_tag="LS215_0494"
FT   CDS_pept        complement(424974..425711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34610"
FT                   /db_xref="GOA:C3MLL2"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLL2"
FT                   /protein_id="ACP34610.1"
FT                   /translation="MMRSRSFQIFRVIFKERYRQPTLELVIPTMLVSNIFITAFYARGL
FT                   FNTYGLVLAFIPLISVSETLAFALALRNIIFVTGDHIYRGSIISFIMMPIKRISLFFFT
FT                   YFCDIVLPYLFWLFTTELYILLSGVPVPQYLILVYTVGYFFTENIILLTALSFKSGGIV
FT                   TLLSGTILGILFIFGGIAGYYGIMTNSPLTPIATISNPYVFLIYEAISQKQVTYLNVGI
FT                   YSEVIISLILFFVSLQKFRIMEV"
FT   gene            complement(425680..426537)
FT                   /locus_tag="LS215_0495"
FT   CDS_pept        complement(425680..426537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0495"
FT                   /product="ABC transporter related"
FT                   /EC_number="3.6.3.28"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34611"
FT                   /db_xref="GOA:C3MLL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLL3"
FT                   /protein_id="ACP34611.1"
FT                   /translation="MTIEVENLQKKFDDKAVLKGVSFTVRRGSITGFIGPNGAGKTTTI
FT                   KILAGLLRKDAGKVKVFGEDPWDNPKVIEMISVIFTNLIHPQENTVGEYLRDLGNIYGK
FT                   REIINYLIDEFKLTSHLNKKLYQLSSGLAQRVQLVAALIKEAELIIADEPTANLDPSFR
FT                   MEFYEIVKRLNRKNDVTFFISSHILSELEKVITDVVFINDGRISYTGKMNQALSGVGEE
FT                   EIYVMVNDSERALKVLGGILEGPYIKVKGKLREIVDKLDDSGIEIISIRRSSLDDAFKK
FT                   FSNI"
FT   gene            complement(426573..428327)
FT                   /locus_tag="LS215_0496"
FT   CDS_pept        complement(426573..428327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0496"
FT                   /product="glutamine amidotransferase class-II"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34612"
FT                   /db_xref="GOA:C3MLL4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLL4"
FT                   /protein_id="ACP34612.1"
FT                   /translation="MGGIFAFVCKDSIDVSIINKGLKKLIYRGYDSAGIAYLENDSLVI
FT                   KKILGNISKNEISVSDKARVAIGHTRYASRGWPTLENAHPLTDCNGKIAVVMDGILDDY
FT                   EKIREDLIAKGHKFVSTTDAEVIPHLLENSTNYLNSSLNVMKRVKGIYSLVFVTIDIDK
FT                   IFAINSGQPLMIGITQECKYVSSDLPSLSGFAENAIIMPENTVAVISWNDVQVYNIEGN
FT                   EVKPEIKRVKYKEEIAEKGGFPHFMLKEIYDIPQALINSFNSLMEKYLSLASMILYGAK
FT                   NVYVIGNGTSLHAGLISTYYFSEIGLNVNVVSAAEFPYYALENVTTGSVIIAMSQSGET
FT                   SDVIRSVKMAKQRGAVILGITNSVGSRLALESNVYLPITAGPEMAVPATKTFTSTIVVL
FT                   KVLSLYTGLHSGKNSRSDINSLKTEIEELAKQLVTSLPEMEKEAEKLSIKLDKESLYVS
FT                   SSGINYPVALEGALKFKEASMTHAEGMQLGELLHGPIVLTNKGYPVILIKPAEAEDLYN
FT                   KVVKSIRERRDVIITISEDGDMKSVKTIRDLTPISNVIPLQLLAYKLGVKRGFPIDTPP
FT                   GLVKAVIV"
FT   gene            complement(428362..428853)
FT                   /locus_tag="LS215_0497"
FT   CDS_pept        complement(428362..428853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34613"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLL5"
FT                   /protein_id="ACP34613.1"
FT                   /translation="MDLEKFRREYYYVVPIIANRIKRDEEKVKKYIELAIILQSAIGNE
FT                   VYTAYYLYYIYEELGDIDLGIPIVLAIVNHRDVWKARALRSVTAYNTLKVFEVKDDVKR
FT                   IIENKLREINIPIEIVMKILNNIEPIQIRKLFSNLSIVHPEVYSLILGVFTSIKQGNEG
FT                   "
FT   gene            complement(428844..430229)
FT                   /locus_tag="LS215_0498"
FT   CDS_pept        complement(428844..430229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34614"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLL6"
FT                   /protein_id="ACP34614.1"
FT                   /translation="MIGKVLELLNCKETEREINRRKFSICDDVNFILNLPIGYLKDVIS
FT                   PLENYLSKHMTNNFSRLTRVVPNDYEDTQLHFSKFFLNLYSSAISEIPRFNILTSLVIL
FT                   DEYRMMPDKALIAAADELARNGINAIFSTSTPSVFFEEEIVSRFRNRRVVSISIVNEYG
FT                   QAVEGRDCVKKGEGYYQCRGSYEVIELIEDFDIRDLDYEIIKGEEVFKVKEPFTLFVNS
FT                   WEKALRLYRKLREERNTEVCLLNSSDECKVTITPKIMPTRFNVVSEISSLPTIVARSGI
FT                   INDKDKIYVWIDRDNYDTVTESTLNLLSNIKVCLKHPFGCNGKMGYANKTVLKPNIDER
FT                   LIKRLSEISHLMDRREFEKVTELFSDFVTLDLFTDKEKITTVPPEFVYENKKKILYYGN
FT                   SCVYTYFTDGEKCSKIVYNWLEGGGVSWLKRNLARAYKNYVEEEGKKEVFLGLKAKDVG
FT                   EWI"
FT   gene            complement(430232..430684)
FT                   /locus_tag="LS215_0499"
FT   CDS_pept        complement(430232..430684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34615"
FT                   /db_xref="GOA:C3MLL7"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLL7"
FT                   /protein_id="ACP34615.1"
FT                   /translation="MDQVEIRTHTALLVVKGAVRKVLGAKWTASTYVNSNHGRLTVKFE
FT                   RKPSDQEMDKVFELANEKVRKNLPIIIEVLPREEAERKYGDEIYDLFLISAEVRELSIV
FT                   VIPDWSINACNKQHTKFTSEIGEIIKDYWRYRNSKQLLEISFDIKC"
FT   gene            430720..431727
FT                   /locus_tag="LS215_0500"
FT   CDS_pept        430720..431727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0500"
FT                   /product="protein of unknown function DUF871"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34616"
FT                   /db_xref="GOA:C3MLL8"
FT                   /db_xref="InterPro:IPR008589"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLL8"
FT                   /protein_id="ACP34616.1"
FT                   /translation="MTKRRIGFSIFPGWKEIKDEQISLLKNVRDLGFSEIFMGIGPGTH
FT                   WRTPVNEALSVAKEILKEANKLDYYAFVDINPQILKELNASPRNLSMFMEIGFKGVRAD
FT                   YGFSKEEIVEMSKQMTVELNPFEISEEEVDFIARNANLERIKACHNYYPVFYSGISKEI
FT                   FIEKNRIFKERGIEIGAFISNPKFNLRTTLEVLRYVEPFDSANYLFKFVDRVLIGDPIP
FT                   DYESLRQVSEVFKSDITKIRIKVYDESVGKRLDKKFAVENYREFAIVCYTRDNIYEGET
FT                   CYTKLFKNAVAVRGREVWIFTRDLGIGPYRLVGEIDDINMEIVKMSSEIMLISK"
FT   gene            431788..434508
FT                   /locus_tag="LS215_0501"
FT   CDS_pept        431788..434508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34617"
FT                   /db_xref="GOA:C3MLL9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLL9"
FT                   /protein_id="ACP34617.1"
FT                   /translation="MYSVLSIKDKKIISLLILVATAISPIFAIAQSASSSPASTAITII
FT                   SYNGNDANGILAFEHGQIAFYAYAVPPSEYTSLPPGAKAYLLPNTYYDILVNPLNTTFG
FT                   FNPFQFQEVRFALNYIVNRTYFVDSILHGYGIPTISLYAGEPDVIHLQQTLSKYANVHY
FT                   NFTYANETIYKVLTAHGAKYINGQWYYNGKPITVYVFVRTDATVRREYAQYFITQLQKL
FT                   GFTVQQIQGNLQKEISVVYGSDPANTTWNILIEAWGGTYGYYDSSLAVGLYSTLGASDP
FT                   FSSYYGLSMGTYNDTRYESPLLLKEANELDNLSLIIAQSQFTSAQEYYQIYNKIVELGI
FT                   NMSVRIGLGMSLTPIYALSNINGVYPSFAQSTLLSFQTYYSITNGSYPNVTIGVRYLSQ
FT                   GSANPGAGFTDAYTDEIGNALFTPSSLTVPGSGYPVPFIYTYKIVNITPHAVVSVPSNA
FT                   LWWNPTTQQITKVSPNTTAQMAVIYNLAPLFNNDKWADGQNITLADIIYEYIVASEMSL
FT                   NSSNPIYDSTASSVYAPALQTIKGFKIINSSAIEIWGNDWFFDPTEAVVSLFGSFNPLG
FT                   YALAGGGYFPWQMYVGMKDVVAQGKAAWSEGAAQSKGIDWLNLVSPTDIGYITSALQNA
FT                   SATGYIPKSLQIVENLSGITLVTPQEAKAGYEAAINFMKTYGNGLIGDGPYILVAWNPS
FT                   ASPPYAKLIRNPYFHLVPPSNALALPTMYSVSLSIPSTVSPGQTLTGTVMGTPAGSTTA
FT                   IPTPNAVVNIELLYPNGSIISGYQLMTNSSGQFTFTVPSSLSPGSYLLSVSAYSNTSIL
FT                   INPVTYTLVVLPSITTTTSTTTSTTTTTSTTTTTSVSTSLSTTTITSVSTVISTVVSTI
FT                   VSTVVSSASNIGYIAVIVVLIIIIIALAVLLFRRR"
FT   gene            434526..435572
FT                   /locus_tag="LS215_0502"
FT   CDS_pept        434526..435572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0502"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /EC_number="3.6.3.24"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34618"
FT                   /db_xref="GOA:C3MLM0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLM0"
FT                   /protein_id="ACP34618.1"
FT                   /translation="MGFTTYMIKKVLIYFSVLLATLTILYIFTFPILQEVIAKSINFQV
FT                   AQFSQTLFKNAHNLNSTQIQIAVEKYRESLIAAYGLNQPIIDKYFIQMYNLMRFDFGTA
FT                   YFLQAPSGSREVSSIIAYYLPNTILLFTTATIVFIVAGTIIGLLSAKSKFWEKVIAIIA
FT                   VIHSSIPTWWLGFVLIAALAYAVKVFPPGGMTSVPPPKNPFDYGISVLYHMSLPLITIF
FT                   IVNVGGFAYIVRSLVTSIMKEDFVITAKARGLPDSRILYRHVLRSASPSIATQAILALA
FT                   GSLGGSLTTEVVFEWPGVGLLTYVAITLNDLPVILGITYVLTIVLLLGLFLGELVYGLL
FT                   DPRIKVGE"
FT   gene            435575..436927
FT                   /locus_tag="LS215_0503"
FT   CDS_pept        435575..436927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0503"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34619"
FT                   /db_xref="GOA:C3MLM1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLM1"
FT                   /protein_id="ACP34619.1"
FT                   /translation="MSKRNVGFSSYLRDFLSSKIGLVGLIILIILLIFTGIAISIPAKV
FT                   YASWNNPASWNQYPEHVPPAWLSIFYPNKYFTTEELSPINMSLYSPAKNIFVAIITYQF
FT                   NWSKVLPAYNVYFIVSTNITPIEEVIYWSKPDGYTLQVNVPNGVFNVPFDLTSIRGDIL
FT                   NYISSITGKTPNIVNSTVLSSALFNSPKSNFTTTEQGRYVIKIEIVSSSPMNITKSGLL
FT                   LLGNSYGLMGTDYFGRPLDLGVLLGLPNALEIGALTSLVAVLVGIFVGGISGYLGGNKD
FT                   SAIQWLTLVFLALPALPFLVAVSFVTEPNLEIEALLIAFLSWPFYAIIARSMALSIKSN
FT                   SFVEADKLLGIPSYRVFFTHFMPRLIPITVAYMALGVPAGILLAQTLAFLGIAPANIVT
FT                   WGGILDAAETYQAQVNGWWWWVVFPGAMIVIVAIPFVLIGFAIERVTLGER"
FT   gene            436929..437867
FT                   /locus_tag="LS215_0504"
FT   CDS_pept        436929..437867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0504"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /EC_number="3.6.3.24"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34620"
FT                   /db_xref="GOA:C3MLM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLM2"
FT                   /protein_id="ACP34620.1"
FT                   /translation="MLLEVRNLKVYFYTKRGIVKAVDDVNLYLDNGEIIGLAGESGSGK
FT                   STIGYAIMRLVPFPGKIEGGEILFKGENILKLDEETFRKNYRWKKIAMVFQGSMSGFTP
FT                   VFKIRDQIIEVLRIHGWTGDYDKRVEELFKMVNMDPQLAEKYPHELSGGQKQRAFIAMA
FT                   LALNPEILIADEPTTALDVMVQEHILNLLKKLRKELNLSIIFITHDLALLSEISDRDYM
FT                   LYAGKVMESGPSEVIFKKPRHPYTSLLVESIATLDKDIIKGIPGSMPDLSNPPVGCRFN
FT                   TRCPFARDICFKEEPKMKAFSDGDEVACWLY"
FT   gene            437836..438813
FT                   /locus_tag="LS215_0505"
FT   CDS_pept        437836..438813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0505"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /EC_number="3.6.3.24"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34621"
FT                   /db_xref="GOA:C3MLM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLM3"
FT                   /protein_id="ACP34621.1"
FT                   /translation="MVMRLHVGSISDYIVKVENLKVYFTKGGIFSKKYIVKALDNVTLS
FT                   IKEKEVMGVVGESGSGKTTLGRVTIGLQKPTAGNIYIRVDKREINVNKAKLKDISKYVQ
FT                   MIYQDPYSSIDPIMRVYDVLAMPLKYKKEIDIDGKIEEAMRLVDLPLELFENRVYQLSG
FT                   GQRQRLSIARAIVVNPKYIVADEPTTMLDASLKGEILKIIKDARESKGFSFMLITHELP
FT                   IAKIISDRIAVLYLGKVVELGSSNEIIKNPLHPYTQGLIEVYPRIDPSLRDKMKEIKIK
FT                   VDIVRPEKGCVFYPRCPFAMPKCKEQEPELKEISPGHYVACWLY"
FT   gene            438829..439008
FT                   /locus_tag="LS215_0506"
FT   CDS_pept        438829..439008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34622"
FT                   /db_xref="GOA:C3MLM4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLM4"
FT                   /protein_id="ACP34622.1"
FT                   /translation="MRSILKIMVGLAMLSGAIGLDYIGASFQSLSVLVVSMILAIAGTM
FT                   VGIRGLMEFLGERF"
FT   gene            complement(439175..439888)
FT                   /locus_tag="LS215_0507"
FT   CDS_pept        complement(439175..439888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34623"
FT                   /db_xref="GOA:C3MLM5"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLM5"
FT                   /protein_id="ACP34623.1"
FT                   /translation="MSHAIYTNLTFSLLFSLLFFSLTFSGTQLLGYHGIFSSLSINLNV
FT                   EVSVKNLSYGGYNITIKESGSSYNNTLGIKVNYNGGYYYIVNATNKEISITYYLSNSSN
FT                   IGLLAPFYIPHLNNGTFTFNEKIVNSSSKEIESQLLTNVSVKENHSVLILNFSDLNLTA
FT                   IPTYYVSQRIIYVNNFVSQMQSNYTNSGQIYLYTDISLVKNETNSASLIIPIIVVIVIV
FT                   ATSGVGVYKLRKSSR"
FT   gene            439927..441742
FT                   /pseudo
FT                   /locus_tag="LS215_0508"
FT   gene            442409..443464
FT                   /locus_tag="LS215_0509"
FT   CDS_pept        442409..443464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0509"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34624"
FT                   /db_xref="GOA:C3MLM6"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLM6"
FT                   /protein_id="ACP34624.1"
FT                   /translation="MLVIYFDFKPKETKEDLFDREEELKKLLSSKDESIILLTGIRRIG
FT                   KTSLLKVFLNESKLPYALVDVRYPLTSYRSLYTIFSNVLSQLNKERRVAEVLKYVKGIS
FT                   LFGINISLSWDPKNRPSLLEIMDKVDESGKVIIAFDEAQNLRGKLANVFLSILAHCYDY
FT                   CKNVTFILTGSEIGLLYDFLKIDDTSSPLYGRHVEEIRLKRFSNEKSLEFLREGFRQAN
FT                   ISPNESVLEYAVSKLDGIVGWLTEFGYRCVKIGEVKREIVDEILEIASKLAMEELSHFS
FT                   KDYVIVIEAIAKGHSRWSELKRYLEDKKKRVVYDAELKRYLDKLEKMGYVVKKESREYD
FT                   LADPVLKNALA"
FT   gene            complement(443482..443739)
FT                   /pseudo
FT                   /locus_tag="LS215_0510"
FT   gene            443531..443776
FT                   /locus_tag="LS215_2971"
FT   CDS_pept        443531..443776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2971"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2971"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34625"
FT                   /db_xref="GOA:C3MLM7"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLM7"
FT                   /protein_id="ACP34625.1"
FT                   /translation="MYAFSQAFSTSSGGFRISLIASNDNSPTKGYYSGFTPALTWLLAT
FT                   RFNRFVYFFYILYINGLIASIAWPKKQYETGNGISI"
FT   gene            complement(443788..444321)
FT                   /locus_tag="LS215_0511"
FT   CDS_pept        complement(443788..444321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0511"
FT                   /product="Appr-1-p processing domain protein"
FT                   /EC_number="2.7.7.48"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34626"
FT                   /db_xref="GOA:C3MLM8"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLM8"
FT                   /protein_id="ACP34626.1"
FT                   /translation="MYKNPYGLEIHLIKGDITEMEADAIVNAANSYLQHGGGVAYAIVK
FT                   KGGYVIQKESDEYVEKYGPVPVGEVAVTSAGKLKSKYVIHTVGPRYGIEGKDKLESAIF
FT                   KSLLKADELSLTSIALPAISTGIYGYPYEICARVMANILKNYKAKSLRKVIVCLYSQDA
FT                   YDIFKKVFDSILKS"
FT   gene            complement(444394..445632)
FT                   /locus_tag="LS215_0512"
FT   CDS_pept        complement(444394..445632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0512"
FT                   /product="transposase, IS605 OrfB family"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34627"
FT                   /db_xref="GOA:C3MLM9"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLM9"
FT                   /protein_id="ACP34627.1"
FT                   /translation="MWRAREKSNKIQLSFKYKVYPTREAEEKLLRVMQVEAKVYNALLD
FT                   AVNNARKEGKKITSKDTQNMLKELKIEGKELVYSKVLQMVNNQLWYNINSLHKLKKKGR
FT                   RVGKLRYKKIMKTINYNQSGFKVQGDKLFLSKIGEIKVLFHRPLEGEVKGVIIKKNVTG
FT                   WYAIFQVEVEKKPLEKTGKVVGIDLGVEKLVTTSDGVVVENPKVFDKVERRMKILQKLL
FT                   SRKKKGSRNYEKVRKKLAKLHEHVKNLMNDYIHKVTSWLVEQYDEIYVEDLDVKEMVED
FT                   SESKVLRKHILHSNFSKFVSYLSYKAERAGRRVVKVDPRNTSKTCARCGHVKKDLTLTD
FT                   RVFVCPKCGWVADRDYNASLNILRAGSGLPLEPVDRKPLLYIPFSEGVYSKFLERSRKS
FT                   SSRGGDAPSVRAG"
FT   gene            complement(445607..446014)
FT                   /locus_tag="LS215_0513"
FT   CDS_pept        complement(445607..446014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0513"
FT                   /product="transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34628"
FT                   /db_xref="GOA:C3MLN0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN0"
FT                   /protein_id="ACP34628.1"
FT                   /translation="MRYRLDRGSHSVYALYYHYVQVVKYRRKVFDNEDIINFLKEQIQE
FT                   ISETFEVEVIDIGVDKDHFHMLFKAKPTLNIPRYINAIKTITSREIQRKFPQVKEKLWK
FT                   GHFWSPSYFLATSGQVTLEVLKKYVESQGKE"
FT   gene            446227..447279
FT                   /locus_tag="LS215_0514"
FT   CDS_pept        446227..447279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0514"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34629"
FT                   /db_xref="GOA:C3MLN1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN1"
FT                   /protein_id="ACP34629.1"
FT                   /translation="MVTPSLPHQNNIQQIGYKLLSMLNFQGEKVDEVAKTLISACLWND
FT                   SVENKSRAYDVSPQTVRNYVEKQGMGVIEKLLERARKISLEVLKGVKEIDLSIDWTTKT
FT                   WYGKPVKGLGSSEKGNSWNYATATTKYKGKVLLLAFIPQVNGMTKEEIVKVLVEQVMAM
FT                   GFKIRLITLDAGFYTVDVLNFISQFKYIIAVPVGDVKVYEEFDGDYTTNSKRHGRDEQV
FT                   KFRLLVYSKEKVRRKKSLVYFARATNLDLPKREVLDLYNKVRGPIETSYRNIKAFLPFT
FT                   SSTKFVFRTLIFVLALVLYSLYIIFKGEVGREEFRLLLILLFPDLFNPENFTFNIIETL
FT                   IYTIDLFLRR"
FT   gene            447420..448565
FT                   /locus_tag="LS215_0515"
FT   CDS_pept        447420..448565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0515"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34630"
FT                   /db_xref="GOA:C3MLN2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN2"
FT                   /protein_id="ACP34630.1"
FT                   /translation="MNVLAVVDFGLNEKTGGYKRNLEIMKRLSRNINVDIIPSLRNVRL
FT                   YSCRKDLITLLESLNSTPDYILELLEKSSGVEEFLNGLKTKRYDIAVVYSNSSENVRLA
FT                   RRITSAPIGVQLQLEPFYRDMTTLFKIKFRGITGRAVKKFKEAMEESKREEVKWKELIE
FT                   RGDLNFAISVSKVPLINSSLDKLLSYRVTNPGNAFDEDLLKFRRERDKEDYAVYFTRLM
FT                   PEKGLFEIPLIWKKLRRDVKLYVIGQFVDERDKDDFLSLIKRLDVNVEYVGFKEKEELY
FT                   NTVAKAMFTVYPSHYDSFSLVILESLALGTPVFAYDTLALKEIYGNVKGVHLAREDDVK
FT                   GLADLISNFKSEEVVPIPEEYSSWDKVAEAELEDIKAFAKR"
FT   gene            448570..449130
FT                   /locus_tag="LS215_0516"
FT   CDS_pept        448570..449130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0516"
FT                   /product="LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34631"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN3"
FT                   /protein_id="ACP34631.1"
FT                   /translation="MQVLIVAPHPDDETLCCGGVVQIFKERGYKVSVVVVTDGRYGSPD
FT                   EKLKGSMELVEIRRQEALRASKILGIDEITFLSFEDSKVIEKEVEKALVEFLHDKDVVL
FT                   SPIPFDSHPDHAKIGKVMEKLYPKAYFYLIWGSMQANWREVRFDIRKYREVKIRAINEY
FT                   KTQIGGLHLDRFTGDYEVFWMKV"
FT   gene            449134..449538
FT                   /locus_tag="LS215_0517"
FT   CDS_pept        449134..449538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34632"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN4"
FT                   /protein_id="ACP34632.1"
FT                   /translation="MEFEVLYMADDVLYRTLGELLGNYVKTLLEKSCQGKRLSDQEYLI
FT                   LMNYYNSKNMDYVFTELRNIRNEWRGIMEIIDRKSKEAIDYAEKNKKEVIDYVDKTKKE
FT                   ILDYVDKRFEAINKRFDDLRELILTLAKEA"
FT   gene            complement(449543..449656)
FT                   /pseudo
FT                   /locus_tag="LS215_0518"
FT   gene            complement(449744..449836)
FT                   /pseudo
FT                   /locus_tag="LS215_2972"
FT   gene            complement(449747..449824)
FT                   /pseudo
FT                   /locus_tag="LS215_0519"
FT   gene            449944..451108
FT                   /pseudo
FT                   /locus_tag="LS215_0520"
FT   gene            complement(451073..451726)
FT                   /locus_tag="LS215_0521"
FT   CDS_pept        complement(451073..451726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0521"
FT                   /product="Transposase, ISC1234/ST1916, Sulfolobus"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34633"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN5"
FT                   /protein_id="ACP34633.1"
FT                   /translation="MARTLRRIPNLVYYSLPPREDMPWREKWLTDIKPVLDTLDLERVL
FT                   GEGTLVYLKLLIVMVLYSCSYRDAVKMVNVNVVVAWFVGRKVGKSTLHDFVGRVYEVRK
FT                   KLLEISFKLEEKCLPSYLPASAHSLDFIAWLVDSFLLDLPLGKRSVETFREKAELEKKG
FT                   GNLKKAKKLLPLGRTKRRFKGKWTKKRGGATEYSCVRKYVSRRLKVFIKTHLEP"
FT   gene            452227..453033
FT                   /locus_tag="LS215_0522"
FT   CDS_pept        452227..453033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0522"
FT                   /product="Protein of unknown function DUF973"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34634"
FT                   /db_xref="GOA:C3MLN6"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN6"
FT                   /protein_id="ACP34634.1"
FT                   /translation="MESSIQALKNIKTGSLYYFLAIIIALVTEVVILRENSLANSFFVL
FT                   IFELVAYGILLIGFSRMRTGFFQLSKTINTYIGTTGVNIFIIGIVALLFGAILPILIYI
FT                   GGSLVFIGDVMIGYTIYKIGQRFQVNTEKIAGILVMISITSFIGYIISYFASDEVMRKM
FT                   LQAPREEKLLIVPSDKSIGYGILKSNGDANVVVYSKESSEIISAQIMGYNFQALQINPK
FT                   TVMAGENRIYIKFALSGVTFVPGNIYNLEILLANSEKLLASLVYEL"
FT   gene            453156..453602
FT                   /locus_tag="LS215_0523"
FT   CDS_pept        453156..453602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34635"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN7"
FT                   /protein_id="ACP34635.1"
FT                   /translation="MISMQVKISGNQVLLVNNSYCAEGFLTFNGNTYTIPVPRQFLYSG
FT                   TPVIFANSDFGGSVNPSFALEGTYTDLFKLFNIISLWSTGWYGMFINGQWVTYINAVVG
FT                   YSSATGVGDTATIPSYLVESGLTLFHNEFLGVWMNPYVWYFSIG"
FT   gene            454388..454549
FT                   /pseudo
FT                   /locus_tag="LS215_0524"
FT   gene            complement(454952..455287)
FT                   /locus_tag="LS215_0525"
FT   CDS_pept        complement(454952..455287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34636"
FT                   /db_xref="GOA:C3MLN8"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN8"
FT                   /protein_id="ACP34636.1"
FT                   /translation="MKLGVRSLWLIIVICNTIDLLYSYELWTGYIAITGGFIELNPLVN
FT                   LIETIGGNYVFPDSISLKIIGLAAMYWTTKFLPYRLKMLALKVVASIFLVVVIYELFIL
FT                   PLLSMAL"
FT   gene            complement(455294..455485)
FT                   /pseudo
FT                   /locus_tag="LS215_0526"
FT   gene            complement(455570..455857)
FT                   /locus_tag="LS215_0527"
FT   CDS_pept        complement(455570..455857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34637"
FT                   /db_xref="GOA:C3MLN9"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN9"
FT                   /protein_id="ACP34637.1"
FT                   /translation="MEFLSLLIFVSGIIVAFLTLYFSPDFGRVKPNKRSLSTIFLSIAL
FT                   TGIGLWLYSIDHSTYFCPNINAPQIHLVYFVEGMRSRHLCTLTYGHSQLQ"
FT   gene            complement(455889..456176)
FT                   /pseudo
FT                   /locus_tag="LS215_0528"
FT   gene            456474..456911
FT                   /locus_tag="LS215_0529"
FT   CDS_pept        456474..456911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0529"
FT                   /product="Vitamin K epoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34638"
FT                   /db_xref="GOA:C3MLP0"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLP0"
FT                   /protein_id="ACP34638.1"
FT                   /translation="MIILKGNKIDYLFLLFGLLGLSTMIYSYLSFGLDVISRNSCTINS
FT                   VISCSSVENSIYSTFLGIKLYYYGMAYFSAIIVLSLLVVKGTVKNIIGYVISLLSIIAS
FT                   IISVYLIYTEIFLLGHICIVCTLAHVSIFSVLILSVIKFKV"
FT   gene            456908..457319
FT                   /pseudo
FT                   /locus_tag="LS215_0530"
FT   gene            complement(457416..457520)
FT                   /locus_tag="LS215_0531"
FT   CDS_pept        complement(457416..457520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34639"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLP1"
FT                   /protein_id="ACP34639.1"
FT                   /translation="MGYHVDVKHLMPISIGRKLKRATLIEVFNGKKSK"
FT   gene            complement(457540..458772)
FT                   /locus_tag="LS215_0532"
FT   CDS_pept        complement(457540..458772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0532"
FT                   /product="transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34640"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLP2"
FT                   /protein_id="ACP34640.1"
FT                   /translation="MERTIKLRVRVDYITYSALKEVEGEYREVLEDAINYGLSNKTTSF
FT                   TRIKAGVYKTEREKHKDLPSHYIYTACEDASERLDSFEKLKKRGRSYTEKPSVRKVTVH
FT                   LDDHLWKFSLDKISISTMQGRVFISPTFPKIFWRYYNTEWRIASEARFKLLKGNVVEFF
FT                   IVFKRDEPKPYEPKGFIPVDLNEDSVSVLVDGKPMLLETNTKRITLGYEYRRKAITTGR
FT                   STKDREVKGKLKRLRERDKKVDIRRKLAKLIVKEAFESMSAIVLEDLPRRTPEHMIKDV
FT                   KDSQLRLRIYRSAFSSMKNAIIEKAKEFGVPVVLVNPSYTSSTCPIHGAKIVYQPDGGD
FT                   APRVGVCEKGKEKWHRDVVALYNLRKRAGDVSPVPLGSKESHDPPTVSRWLRAKSLHSI
FT                   MNEHKMIEMKV"
FT   gene            complement(458744..459385)
FT                   /locus_tag="LS215_0533"
FT   CDS_pept        complement(458744..459385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0533"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34641"
FT                   /db_xref="GOA:C3MLP3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLP3"
FT                   /protein_id="ACP34641.1"
FT                   /translation="MERLLRPKEACQLLSISYSTLLRWIREGKIRVVTTEGGKYRIPYS
FT                   EIKKYLEKREEIRAVIYARVSSSDQKEDLERQINYLTNYATAKGYKVVEVLKDIASGLN
FT                   TQRKGLLKLFKLVEGRSVDVVLITYKDRLTRFGFEYIEELFSTMGVKIEVVFGEEPKDA
FT                   TQELVEDLISIITSFAGKIYGIRSHKKTVLVQGVKKLIGELSGEDDKVKG"
FT   gene            459459..459587
FT                   /pseudo
FT                   /locus_tag="LS215_0534"
FT   gene            complement(459700..460059)
FT                   /locus_tag="LS215_0535"
FT   CDS_pept        complement(459700..460059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0535"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34642"
FT                   /db_xref="GOA:C3MLP4"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLP4"
FT                   /protein_id="ACP34642.1"
FT                   /translation="MGKAKSALKSQVELVKVAIEFINDISNEIKIEDIYVVGSRARGDY
FT                   LETSDIDLVIISRDFEGLRYIDRLEKLGKYLKARVEFFAFTPEEWNDSASLFVKQMKKE
FT                   AKRLKDLAKEIGLSF"
FT   gene            complement(460035..460424)
FT                   /locus_tag="LS215_0536"
FT   CDS_pept        complement(460035..460424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0536"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34643"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLP5"
FT                   /protein_id="ACP34643.1"
FT                   /translation="MREEAEKWLRQALEDLATAKDTITTGHYYASAFWAEQAAEKALKA
FT                   LLIAGGKIERTHDLNELLEIIKEEIGLSVEEIRSEVIKLTLHYTISRYPDAANTIPYSL
FT                   YSKEDAEELVKKAEKVIEWVKRNLH"
FT   gene            complement(460663..461724)
FT                   /locus_tag="LS215_0537"
FT   CDS_pept        complement(460663..461724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0537"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34644"
FT                   /db_xref="GOA:C3MLP6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLP6"
FT                   /protein_id="ACP34644.1"
FT                   /translation="MVDVSSEAKSSATGVTNPYRRTEHCDKIHEYRCDKEVGVIGIDIS
FT                   KEHLITSRGRVRKYENNKKGYEEILKMKPCTIVLEPTGVYAIRPSQYFKEKGIKVLQVS
FT                   PNVLSREKELRGKKTDFYDAEKLENMVNKAKEYDYNPLKELVTLYLFLKDIETKYKNRL
FT                   KRALFLVSDNDKVNKDRLERLAKGDFTREELYQLEYTPIVLEEIKILAKNLLEIQERLK
FT                   EVRRMIEGQVPQDHVLLTIPGVGKLAAGIVGDIRRFPKPESFVAYCGLDPVVERSGRAV
FT                   VSRGISKRSNKYLRSLFYFLAMRSYSRNPTLLKFYETHKDRLKGKKLYVALARKLARVV
FT                   WSVWYNNRPYEPK"
FT   gene            462071..464524
FT                   /locus_tag="LS215_0538"
FT   CDS_pept        462071..464524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0538"
FT                   /product="peptidase S45 penicillin amidase"
FT                   /EC_number="3.5.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34645"
FT                   /db_xref="GOA:C3MLP7"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLP7"
FT                   /protein_id="ACP34645.1"
FT                   /translation="MTLLVILSIFTTSLSILNPFLGIWYSSDNVNMLNEIVSIPGLSGN
FT                   VNIYIDSNGIAHIYANNLHDLFLAEGYYEASQRLFEIELFGLLAMGNLSSWVGAKALSS
FT                   DIAMHLIGIPQNAIMSAQYLKHNYPTIYSYLEAFSQGVNDYINTLNYRDLPLEFKLLNV
FT                   RPYYWSPEYSLAFGEYMGWSLTSGFNDELKSALLYTYFNYSEINEINPYYPHFIDGNLT
FT                   VIPGDGTVNGYNLTDQGISPQYLWSLNWYQSWATGINKDEFKDLVPLMKYAILNISDPF
FT                   ILFPKFASNSWVITSDFSTQGPILANDPHLPLFDPSVWIPLQLIAPAFNVTGWSLVGIP
FT                   GVLIGHTAYTAWGLTTPEGSSSDAYLEIVNGSQYYYNGKWYQMNEYNYTLMGRTYTVYY
FT                   TNNGPLVARYKNYGISLYWSAWKEPILTVISILLLDNSTSFNDLINAAKYWVIPPQNLA
FT                   IVSKHHAGIIVAGLYPLINETLPNGKSVLVVGARTPLNGTVTKYEPIGYIPFKYLPQTF
FT                   DPVRGFAFAPNQPTVWINYPFPFIGGFWSSGGRAEDIYHYLEYQRSVNISDMMKLQSNV
FT                   TDYWASLLTPLIIKAMVNNTNGSIQGTAFNYLRNWNFTFYQNEVAPTIYTYIVAEMVNN
FT                   SIAKILNKMGLDILDIASIPYIVPDFIYIAQYDPTSIWVNGNFTNLVRQSFVKAISLLE
FT                   QNLGDNISQWYWGRVHFLEIYNPLGLKALSVGPIPIFGDPHTLAVGSTPYIPTVPLPYV
FT                   TVGSSLRFIASPYSSQFYGIFPGGPSESLVSAFRENQLPLWLSFKYISYSGYNYTIIAK
FT                   ITLEA"
FT   gene            464530..464874
FT                   /locus_tag="LS215_0539"
FT   CDS_pept        464530..464874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34646"
FT                   /db_xref="GOA:C3MLP8"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLP8"
FT                   /protein_id="ACP34646.1"
FT                   /translation="MKGTNTIYIIVSSILLAYIMQIFVLYPFTAVAIGIPLGLLSRKYS
FT                   AIGGFLIGFLSSLSLYLIYPINAVSKIAEIIGQLIGINPFLVVLLYPLIYGTISLISAL
FT                   LFYYIVRLNK"
FT   sig_peptide     464530..464610
FT                   /locus_tag="LS215_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.871 at
FT                   residue 27"
FT   gene            complement(465058..466494)
FT                   /locus_tag="LS215_0540"
FT   CDS_pept        complement(465058..466494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34647"
FT                   /db_xref="GOA:C3MLP9"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLP9"
FT                   /protein_id="ACP34647.1"
FT                   /translation="MYHIQNTTQLFLMNLSGYAIKLPLEGIAHLYSYSNYLLVFVEPYF
FT                   NVVSNFMTSFLLNGTTVYVINTLTMKYYKLNLKELSVNVNNFYGDNDGIYAFNVASKIL
FT                   STTNEEVYGYTVVIPKVEIIINAYNLITNSTRTISFVTTGLPLSFEKDGENFTGKPYAV
FT                   LNPNNNFLYIITANNNLQYIINVINLTSGGVSEFNVSFNGEIADLTQDYLTFYNTSEVM
FT                   LYNPIKNITISYPFLSPRLISISCVPSTPNLYPLITYTNKSNNTLVSTILSFTNGGKNI
FT                   SIDNIPLILFCPAITVSELIDTNSLKIPFSTTPNEIKLNSVPVSINGNVVPSVSEIYIF
FT                   ESSVLLKTSNGYLVYNDGKLINGQVVSGVVITNSSNVNYAYENVLGVNQPIILMSTIII
FT                   GGKPYYIPGGKYFVGNIGNNVVLYGNGEISVIQVNESESGIHINTPELWLNIGITAFIT
FT                   LVLLIVVIPLIKLLRKKGGK"
FT   gene            complement(466808..466990)
FT                   /locus_tag="LS215_0541"
FT   CDS_pept        complement(466808..466990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0541"
FT                   /product="conserved hypothetical insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34648"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLQ0"
FT                   /protein_id="ACP34648.1"
FT                   /translation="MYRDCGRYFLGDAIYHSRELREEVLKMYSNGVSPSLMGEKVNFII
FT                   YNIMTTLSHIQIFFL"
FT   gene            complement(467330..467890)
FT                   /locus_tag="LS215_0542"
FT   CDS_pept        complement(467330..467890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34649"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLQ1"
FT                   /protein_id="ACP34649.1"
FT                   /translation="MLRELLSRISELKGSETDRFLKFLAILNTLLEDKGLGRIIIVGGF
FT                   AVELYSGRSYRTGDVDVIVEGIAENLVRQVLKEISDFGLRIYLPKIREISEKGIDIVDN
FT                   VYNKRKSPLKVQVDSYYIYITPPEEVVLTYLEAWKFWNSIEDRNKAVLVYCAQRNRIDV
FT                   NYINLESERRGVKDFLERVKDYC"
FT   gene            complement(467863..468066)
FT                   /locus_tag="LS215_0543"
FT   CDS_pept        complement(467863..468066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34650"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLQ2"
FT                   /protein_id="ACP34650.1"
FT                   /translation="MIDPKLIIKLLEDRQRPRGSKIKDEDLKRLAKFGEENMKLLEVLG
FT                   CWKMEGDIIYYKTGCLGNYFQE"
FT   gene            complement(468229..468470)
FT                   /pseudo
FT                   /locus_tag="LS215_0544"
FT   gene            complement(468558..468753)
FT                   /pseudo
FT                   /locus_tag="LS215_0545"
FT   gene            complement(469029..469127)
FT                   /locus_tag="LS215_0546"
FT   CDS_pept        complement(469029..469127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0546"
FT                   /product="ORF2 in transposon ISC1778"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34651"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLQ3"
FT                   /protein_id="ACP34651.1"
FT                   /translation="MCGFALDRQLNASLNIFLKMCEFPHIRGISRM"
FT   gene            469600..470088
FT                   /locus_tag="LS215_0547"
FT   CDS_pept        469600..470088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34652"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLQ4"
FT                   /protein_id="ACP34652.1"
FT                   /translation="MSQENNENNKKTITIRGVDEKIYRKLTEIARSSGKTIGEVTNQAF
FT                   RTFLDLSDAAKRTASGVVESGKTFIEGFKEGIGNLIIISDIDELSVNKEEMMQTSKPIA
FT                   FKGIKKLSLVNISDDDVEKYIQEISDVDELIIPPNINKLKLLQKCRRVKKIIVQNNPV"
FT   gene            470150..471286
FT                   /locus_tag="LS215_0548"
FT   CDS_pept        470150..471286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0548"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34653"
FT                   /db_xref="GOA:C3MLQ5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLQ5"
FT                   /protein_id="ACP34653.1"
FT                   /translation="MIPISVLVTNAGTVSFHIKGEYNKDRPSKFSDVFRPVVTWNLTRK
FT                   CNLKCLHCYINASPEGEDGSTTEEALRLIDEMAEMRIPLIIMSGGEPLMRRDFFELASY
FT                   ARIKGIKLALSTNGTLITESVAKKLKELDFSYVGISLDSYDPEFHDKFRGLNGAFNMTV
FT                   KGIKNAINVGLNVGLRFTITARNIHQIDEYVKLALELGVKRITFYHLSASGRGKELREW
FT                   MYTPEEYVGFINKMIDYAIKLSGKIEIETTLGQFDGVYIAKKLARDEEELEKYMKFVEN
FT                   SGGCGRKMISIYPNGDVYPCQFIDFYKLGNVREKPLKEIIKNIPDLFINTDKYLRGEYC
FT                   DKCKYKSACKGGDRARAYYWNGDVYGDDPLCPLKTLHI"
FT   gene            471259..472311
FT                   /locus_tag="LS215_0549"
FT   CDS_pept        471259..472311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0549"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34654"
FT                   /db_xref="GOA:C3MLQ6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027634"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLQ6"
FT                   /protein_id="ACP34654.1"
FT                   /translation="MPFENAPHLVFWEVTKACPLTCKHCRANAIDKPLPGELNTEESRK
FT                   LLEDIARFGKVVIVFTGGDPLSRSDIFELMEYAKSLGLVVSIAPSPSHRLDDETMKIIS
FT                   NYARYMSISLDGATSQTHDWLRGLGSYKYALRGIELGLKYGIQVQVNTLVWKKSYSELP
FT                   FVVKLLKEMGVKIWEVFFLIPVGRGTTELDIPRDKYKDVIDFLVEATRYDLIVRTVEAP
FT                   FFRRAKLEYTPATTNDNELVSTLRELLGEPVKEADKSILPTRDGAGVIFIGYNGDVYPS
FT                   GFLPLYLGNVKKESLVDIYRKSEVLKKIKDSRFEGKCGICKYNNICGGSRARAFAVYNN
FT                   PFAEDPMCPY"
FT   gene            472444..473853
FT                   /locus_tag="LS215_0550"
FT   CDS_pept        472444..473853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0550"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34655"
FT                   /db_xref="GOA:C3MLQ7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLQ7"
FT                   /protein_id="ACP34655.1"
FT                   /translation="MSQEVIEVRSPSNLNVIGTVKRMHKDEVRGEIEEAYKGFEIISKM
FT                   PLYKRTAILRKVSEILEREQERLAKLLAIEAGKPIRDSRVEVLRASRLFRHAAEEVGMV
FT                   LEGKNYRVDAYEYPPGNENRIVVSTREPIGVVTAILPFNFPINSFAHKVAPALAVGNSV
FT                   VVKPSINTPLAAIEMKKILVEAGLPDSAVRVVTGYSSEIGDEIITHPLVGLITLTGSTQ
FT                   TGLKIASKAVSLGKRIIMELGGSDPIIILEDANIERASSIAVRARFEYAGQNCNAGKRI
FT                   IVREEIYDKFVKAFNDKARALKVGDPLDETIDVGPVINKESVENLNSVLADAKAKGGKV
FT                   EILNKGPESGSFFPLTMVTNPSLDMLVLKSEVFGPIVPIVSVKSDEEAIRIANSTEYGL
FT                   QSAIFTNDVNRALKLSRELKFGAVIINDSTRLRWDSLAFGGFKKSGIGREGVRETMLEM
FT                   TENKLIAITLL"
FT   gene            complement(474133..475037)
FT                   /pseudo
FT                   /locus_tag="LS215_0551"
FT   gene            475834..477096
FT                   /locus_tag="LS215_0552"
FT   CDS_pept        475834..477096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0552"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34656"
FT                   /db_xref="GOA:C3MLQ8"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLQ8"
FT                   /protein_id="ACP34656.1"
FT                   /translation="MIFMNMVNRERELQALKKRLSSNDLELIIIYGRRRIGKTFLIINA
FT                   VNGYDFIYYLATEKNNLRKFKELTESKYEDIKYVKEDWEAIFHYLRDKIIIIDEFPYMI
FT                   KEDESILSTFQKIVDETLKGSKTKLILLGSSISMMEDAISYKSPLYGRRTASIELKELK
FT                   FKDLKGFNFSLIDAIHVYGFAGGVPFYLTKAKTPFLKWINAELKEVDSFIKDEIDFMLR
FT                   YEFSEIGTYKEILHAISSGKNTLGEIKDFVRISGDVSSYLNKLEKIGIIGKEFPYKMKK
FT                   GARYYIKDNFTLFWFTFIYPNLSLIEEGIYEIKEDEYNVYLGRIFEKIAREYVEDVYKV
FT                   KVERLWFKDVEIDIYGDGIADECKWSEGINGEKVLYELKRKVEDLGLDVKKYIIFAKSF
FT                   SKTNEEAEFIDLKKLEQWYRT"
FT   gene            complement(477359..477892)
FT                   /locus_tag="LS215_0553"
FT   CDS_pept        complement(477359..477892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0553"
FT                   /product="PaREP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34657"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLQ9"
FT                   /protein_id="ACP34657.1"
FT                   /translation="MVVEKDLYRVGEDYVEARIIESLSDLLLSLTLWKEGYTRNSAGKA
FT                   FSAVKALLSALIVTNEEKLINLAKDEKERKWIKKKAHIVPTHAMYGLAQVLKDIGIDVI
FT                   SLVNYALNLHDYHYNGFEPGFSRYSKKEEVFRDLITLVKETRKVIDIYYSKYEVKEILG
FT                   KIDELIKELTEGNK"
FT   gene            478096..478286
FT                   /pseudo
FT                   /locus_tag="LS215_0554"
FT   gene            478493..478702
FT                   /locus_tag="LS215_0555"
FT   CDS_pept        478493..478702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0555"
FT                   /product="Protein of unknown function DUF217"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34658"
FT                   /db_xref="InterPro:IPR003847"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLR0"
FT                   /protein_id="ACP34658.1"
FT                   /translation="MAKTITISNKAYEALLKEKKEGESFSDVIIRLTSSGNKEKLLKFA
FT                   GIWKDAKIDDVMKELEEMWSKWNV"
FT   gene            478690..479082
FT                   /locus_tag="LS215_0556"
FT   CDS_pept        478690..479082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0556"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34659"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLR1"
FT                   /protein_id="ACP34659.1"
FT                   /translation="MECLDSDIIIDFLKGRDEAVNYIKKSKEELATTSINVFEVYFGGY
FT                   KIGKTKCLEDFFSSLKILTLDYNASKKAAEIGTKLSNEGRQIEVKDLLIASICIVNGYT
FT                   LVTSNIKHFSRINELKLKNWRNEVFY"
FT   gene            complement(479085..479318)
FT                   /locus_tag="LS215_0557"
FT   CDS_pept        complement(479085..479318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34660"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLR2"
FT                   /protein_id="ACP34660.1"
FT                   /translation="MTSGLSSALKEGIDVNKALDEGVKVLVYSHKFQPLEGLSVEETEA
FT                   VLLAKDLTYYLITADDKVKEFAEKEGVKVIVL"
FT   gene            complement(479685..480374)
FT                   /locus_tag="LS215_0558"
FT   CDS_pept        complement(479685..480374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34661"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLR3"
FT                   /protein_id="ACP34661.1"
FT                   /translation="MNSGGKEISDLIKDYGFKEIRRNVRLLEARYLANKESKGDYALLL
FT                   DETRPLRKDAIEILSKNLHDMVIIGERELGDSFWVKAAQLDKDNIMYCNSPEAIKGFSL
FT                   PRLFRRELLTNALERLREGLSEKFNQVVFPDHELIYYEVSFLSNDVFIIKDELIYHYGD
FT                   ASLRDIMRKYYRYGKSLKVLKDTPYSFMTSISRKKREICKGGIYDRVALYILYLVRGVP
FT                   FLLGELL"
FT   gene            480626..481618
FT                   /pseudo
FT                   /locus_tag="LS215_0559"
FT   gene            481827..481898
FT                   /pseudo
FT                   /locus_tag="LS215_0560"
FT   gene            complement(481900..482842)
FT                   /pseudo
FT                   /locus_tag="LS215_0561"
FT   gene            483148..483420
FT                   /locus_tag="LS215_0562"
FT   CDS_pept        483148..483420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34662"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLR4"
FT                   /protein_id="ACP34662.1"
FT                   /translation="MVTTIKVKDKTKLDLENLRAEILLKSNTKLTLEELQDYLISFAID
FT                   NKESFFDYMMKKFKRKNYEKMKEAIKDWGIDTSNIDVDSVIYDNP"
FT   gene            483407..483790
FT                   /locus_tag="LS215_0563"
FT   CDS_pept        483407..483790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0563"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34663"
FT                   /db_xref="GOA:C3MLR5"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR039018"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLR5"
FT                   /protein_id="ACP34663.1"
FT                   /translation="MIILDTSFLIAFYNKRDSRHEKALKIFDEITNDKLVISDYIFDEI
FT                   VTFLRAKVPWIAIEVGENILENLDMIRVNDEDFRTAWELFNKFDELSFTDCTTLSLSKR
FT                   LKIRRVVTFDQALSNAFAEINKK"
FT   gene            484068..484604
FT                   /locus_tag="LS215_0564"
FT   CDS_pept        484068..484604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0564"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34664"
FT                   /db_xref="GOA:C3MLR6"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLR6"
FT                   /protein_id="ACP34664.1"
FT                   /translation="MPFEFEELGLGVILIKPKAFPDNRGYFKEIFKESEFRKMNIPTPL
FT                   QANISFSKPGVVRGLHYQLPPKEQGKIVTVMKGRIIDVAVDIRKKSKSFGKYVYAELNE
FT                   DNHYMLWIPPGFAHGFQALEDSTVLYFVTHNEYSPHHERCINYTMIDWPIKSVIVSEKD
FT                   AKCPPLERAEVFEDW"
FT   gene            484836..485423
FT                   /locus_tag="LS215_0565"
FT   CDS_pept        484836..485423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0565"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34665"
FT                   /db_xref="GOA:C3MLR7"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLR7"
FT                   /protein_id="ACP34665.1"
FT                   /translation="MQGGYKLDLTNYSAVEDFIIKKRPDVIINTASLTDVDKCEVERSL
FT                   AFKVNAETVKHIVRASRVVEAYLIHISTDYVFDGKKGLYKEEDLPNPINYYGLTKLLGE
FT                   TYALSYDDSLVIRTSGVFRHKGFPIYVYKTLKEGKEVSAFKGYYSPISARKLAEAISEL
FT                   IEYRKTGILNIASERVSREVNGMRLDSRLLQD"
FT   gene            485865..486302
FT                   /locus_tag="LS215_0566"
FT   CDS_pept        485865..486302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34666"
FT                   /db_xref="GOA:C3MLR8"
FT                   /db_xref="InterPro:IPR021443"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLR8"
FT                   /protein_id="ACP34666.1"
FT                   /translation="MHLFTFSKILIMKAPLMLRIHTKRGDKLFLYIQIIFWLAYVLVDV
FT                   GIFLNKILLFGVLAAALGTISIILAVKSYSYLNLRITPERVEVGRLKIPLDRVREIRVL
FT                   RSNDSTADLSIVYEGGEKAIKEVKNWEEVLETFQIYKESVI"
FT   gene            486419..486649
FT                   /locus_tag="LS215_0567"
FT   CDS_pept        486419..486649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34667"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLR9"
FT                   /protein_id="ACP34667.1"
FT                   /translation="MPWIAIEVGENILENLDMIRVNDEDFRTAWELFNKFDELSFTDCT
FT                   TLSLSKRLKIRRVVTFDRSLIRAFEKVKRNS"
FT   gene            complement(486911..487384)
FT                   /locus_tag="LS215_0568"
FT   CDS_pept        complement(486911..487384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0568"
FT                   /product="PaREP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34668"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLS0"
FT                   /protein_id="ACP34668.1"
FT                   /translation="MMEELIKKAEEMGIDVEDLIITAMSRKDPQEGIKLRLTLARKYMA
FT                   EAEEYLKKGDSVQASEKAYKVAEEVVKALAEKFNLPEYQQAVKEGRWYAYTLGSASASL
FT                   SKMLGEWIVNGWSSAYFLHVWGFHESKLSTNDVIPYIEGVRKLLENAEKVIGS"
FT   gene            487619..488017
FT                   /locus_tag="LS215_0569"
FT   CDS_pept        487619..488017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34669"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLS1"
FT                   /protein_id="ACP34669.1"
FT                   /translation="MENLLLRDLVEYHMRLEELYNVQSLDEWELLMDEAIKNKDKVAIL
FT                   VLTDYLRWIPKDFSPKFPNVREYMQHVKYLIDNCNDLVEDWLNIHSCEELRESCNFNIE
FT                   GKRSSFIPIDDKELIRYIAKGCGIFWLV"
FT   gene            488014..488493
FT                   /locus_tag="LS215_0570"
FT   CDS_pept        488014..488493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34670"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLS2"
FT                   /protein_id="ACP34670.1"
FT                   /translation="MKFSPSIWIPVLQKFYKSLEIPVVIYGSQIIYVNLGIAFESKDID
FT                   LLSDVYPHTVFVNAYRKAFSEENVRIEVFVKNRETIYHLFTKYGVSIEIFAPPKEESPL
FT                   TLFADEILFKERDGISYWTLSLEAYAVIQANRKEGIRDIDLSSSPPWNGRPKIIL"
FT   gene            488622..489647
FT                   /pseudo
FT                   /locus_tag="LS215_0571"
FT   gene            489955..490191
FT                   /locus_tag="LS215_0572"
FT   CDS_pept        489955..490191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0572"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34671"
FT                   /db_xref="GOA:C3MLS3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLS3"
FT                   /protein_id="ACP34671.1"
FT                   /translation="MEVKVHKKGIIVIPAEVRRRLNIKEGSVIELEVEGDKIILKRKLT
FT                   LLDAYGIDKEMGDSAVKELEKLRKEEVEKENSV"
FT   gene            490169..490567
FT                   /locus_tag="LS215_0573"
FT   CDS_pept        490169..490567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0573"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34672"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM49"
FT                   /protein_id="ACP34672.1"
FT                   /translation="MRRRILFDTGFFHVYFSGLNEEAKKAVEEVYTGKSAGYTLDLNLA
FT                   EFLYTYGKLNGVEEANVRLSLILNSPIKIVSTNKELALRAGELKVKYQNLSIVDCFLVA
FT                   FAEKENAVIYTTDSEIKRVYKNTIILHS"
FT   gene            complement(490615..490872)
FT                   /locus_tag="LS215_0574"
FT   CDS_pept        complement(490615..490872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34673"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM50"
FT                   /protein_id="ACP34673.1"
FT                   /translation="MDSPFIESLNISFSPRSFSNANDAPQLDGTVEGASSNASFLHYSS
FT                   VIKAPYSGGSLAISTAHHMRPESMRGTMRREPFQDGELPV"
FT   sig_peptide     complement(490750..490872)
FT                   /locus_tag="LS215_0574"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.579 at
FT                   residue 41"
FT   gene            complement(491054..491440)
FT                   /locus_tag="LS215_0575"
FT   CDS_pept        complement(491054..491440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0575"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34674"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM51"
FT                   /protein_id="ACP34674.1"
FT                   /translation="MKYYIDTSLAIALANEKDPNHEMAIKMYPKDGKKVVSKLVLAELY
FT                   SVYSRRMKISDEELEALVNYTLSKCKCEIEEVDFDRVIDFAIKISNKIKLKTLDLLHLS
FT                   ISAILQSEILSLDEEIMKAKNKLK"
FT   gene            complement(491437..491679)
FT                   /locus_tag="LS215_0576"
FT   CDS_pept        complement(491437..491679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34675"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM52"
FT                   /protein_id="ACP34675.1"
FT                   /translation="MKIVTIKVKDEYYEIAEQMVEMGLAKSKNEAFNLIILYGINRAVE
FT                   EIERKKKVKELTEKWLKEGLPFELPTSNDVISDRE"
FT   gene            complement(491934..492974)
FT                   /pseudo
FT                   /locus_tag="LS215_0577"
FT   gene            493224..493745
FT                   /locus_tag="LS215_0578"
FT   CDS_pept        493224..493745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0578"
FT                   /product="PaREP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34676"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM53"
FT                   /protein_id="ACP34676.1"
FT                   /translation="MYEVLDYKGNPKSYIHMKVMESLVESRLALEMLKRGLLTNASSKA
FT                   FISIKAFISALIVKDFDKIIQNKPEKEKEWYERIGYSAPTTGLIGVSYDLEKLGYNVSL
FT                   VVRIALSLHSFSYNGFDPNLVNYKDKEEVEKDIKNVVQFVIDNAKKYFNDFWNEELEKE
FT                   LENLVNVSKD"
FT   gene            complement(494076..494372)
FT                   /locus_tag="LS215_0579"
FT   CDS_pept        complement(494076..494372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0579"
FT                   /product="protein of unknown function DUF114"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34677"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM54"
FT                   /protein_id="ACP34677.1"
FT                   /translation="MLKGDNNAENKAKRIIKYLSNHKELKSHAAPISKDKLKELGLKII
FT                   ELEADQKLQDLVLSVYHATRITFQLTTVHKIVENSNGRAFIRILQPPQTSQQK"
FT   gene            494790..495962
FT                   /pseudo
FT                   /locus_tag="LS215_0580"
FT   gene            496367..496627
FT                   /locus_tag="LS215_0581"
FT   CDS_pept        496367..496627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34678"
FT                   /db_xref="GOA:C3MM55"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR039709"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM55"
FT                   /protein_id="ACP34678.1"
FT                   /translation="MFTEEENNMVSTVISIRIDEKLKKELEELGIDYAELVRKYLEEVV
FT                   RKEKLKRELKEADRIREELLKIHGYYSSSAELIREDRDDYH"
FT   gene            496614..497030
FT                   /locus_tag="LS215_0582"
FT   CDS_pept        496614..497030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0582"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34679"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM56"
FT                   /protein_id="ACP34679.1"
FT                   /translation="MTIIDTSALFALYIPEKWSNFVRKEVEKTEECYFLDLIFYEFPNV
FT                   IRKRIVRNELSVDKGEEILERGLSYINLCKVVSGKELTRKMYELSLKYNLTTYDAALIS
FT                   LAEKVNDVILTTDEKLLRGVRNYPEISKYFLSPY"
FT   gene            complement(497080..498004)
FT                   /pseudo
FT                   /locus_tag="LS215_0583"
FT   gene            complement(498099..498359)
FT                   /locus_tag="LS215_0584"
FT   CDS_pept        complement(498099..498359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0584"
FT                   /product="dTDP-4-dehydrorhamnose 3 5-epimerase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34680"
FT                   /db_xref="GOA:C3MM57"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM57"
FT                   /protein_id="ACP34680.1"
FT                   /translation="MPFEFEELGLGVILIKPKAFPDNRGYFKEIFKESEFRKMNIPTPL
FT                   QANVSFSKPGVVRGLHYQLPPKGGVLMQSSYSILNSKIIFD"
FT   gene            498709..499176
FT                   /pseudo
FT                   /locus_tag="LS215_0585"
FT   gene            499102..499182
FT                   /locus_tag="LS215_2973"
FT   CDS_pept        499102..499182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2973"
FT                   /product="tranposase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2973"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34681"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM58"
FT                   /protein_id="ACP34681.1"
FT                   /translation="MKGVIKKGVKVFFMDESGISHDPSRV"
FT   gene            499497..499718
FT                   /locus_tag="LS215_0586"
FT   CDS_pept        499497..499718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34682"
FT                   /db_xref="GOA:C3MM59"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM59"
FT                   /protein_id="ACP34682.1"
FT                   /translation="MVSKGNYTRYWINKFNDVLEDLEEGISMGKFFSYLIYYLLTSFIK
FT                   FYLTIIQAFLNVFLYFVLREVISPLQLL"
FT   gene            complement(499725..500234)
FT                   /locus_tag="LS215_0587"
FT   CDS_pept        complement(499725..500234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0587"
FT                   /product="Transposase, ISC1217"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34683"
FT                   /db_xref="InterPro:IPR006783"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM60"
FT                   /protein_id="ACP34683.1"
FT                   /translation="MNKNLSNDAYYQALNDAIYAALAPLEDIRKDSAIRLLLGGIIGKG
FT                   TYKISQEMNMDYMTLLKNLDKIANLMKAVKNIVKNHPVILIIDDTHDHKQYAIPTSRNA
FT                   TQAYHRKVHKKYEPANTNNCSKGLENKRNLHTLNNTIHTTKGSRNIKGKGEKVEFKTKI
FT                   QAYLEI"
FT   gene            500263..500607
FT                   /pseudo
FT                   /locus_tag="LS215_0588"
FT   gene            complement(500627..500833)
FT                   /pseudo
FT                   /locus_tag="LS215_0589"
FT   gene            complement(500936..501436)
FT                   /locus_tag="LS215_0590"
FT   CDS_pept        complement(500936..501436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34684"
FT                   /db_xref="GOA:C3MM61"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR039018"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM61"
FT                   /protein_id="ACP34684.1"
FT                   /translation="MERAIMIILDTSFLYSFLNKNDANHNKAVELMNKIISRKFGKPII
FT                   FEYVIDELFTLMINKQPFSYIEKVIDLILQDVEKNIFQIIILTDRENSLHDIIRLFKKI
FT                   NEDPNRKKKLSFTDCAILFAMIQNDIFYLASFDSGFDGILEKIEDGIYALSSDKILNLK
FT                   KIL"
FT   gene            complement(501421..501837)
FT                   /locus_tag="LS215_0591"
FT   CDS_pept        complement(501421..501837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34685"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM62"
FT                   /protein_id="ACP34685.1"
FT                   /translation="MKLAINYIVKGTSYRLVINAEKLKVYEELDNVLKEICEKFNGEVE
FT                   EYSVSKIVEELPLGKIIMPIATNVTLHSSDIKFSDDDNLNFIIKTLLGTTIGLVAGHLI
FT                   DSFISREEKVIDIKNPCERKEPSIFQAITEWKEQ"
FT   gene            502183..502653
FT                   /pseudo
FT                   /locus_tag="LS215_0592"
FT   gene            complement(503203..503550)
FT                   /locus_tag="LS215_0593"
FT   CDS_pept        complement(503203..503550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0593"
FT                   /product="glycine betaine/carnitine/choline ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34686"
FT                   /db_xref="GOA:C3MM63"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM63"
FT                   /protein_id="ACP34686.1"
FT                   /translation="MQGHLIEIRNLTVKRGGMTVLSNVNIIEDNNPTCLVGNNGTGKTT
FT                   LLLAIAKIIPANGEIKFAGRELSQEEISFYVEGMEPYGHLTVKDYYNLIKELYNTEVKD
FT                   IFGIYYKWKKH"
FT   gene            complement(503745..504653)
FT                   /locus_tag="LS215_0594"
FT   CDS_pept        complement(503745..504653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0594"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34687"
FT                   /db_xref="GOA:C3MM64"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM64"
FT                   /protein_id="ACP34687.1"
FT                   /translation="MYQKIIRGRVRKYENNLKGYEEILKMKPCTIVLEPTGVYAIRPSQ
FT                   YFKEKGIKVSPNAREKEFREKKTDFYDAEKLENMVDKAKEYDYTPLKEMTTLYLFLKDM
FT                   EVKYKNRLKRTLFLVSDNDKVNKDRLERLAKGDFTREELYQLEYTPIVLEEIKILAKNL
FT                   LEIQERLKEVRRMIEGQIPDDHVLLTIPGVGRLAAGIIGDIRRFPKPESFVAYCGLDPV
FT                   VERSGKAVISRGISKRGNKYLRSLFYFLAVRNYSRNPTLLKFYEAHRDRLKGKKLYTAL
FT                   ARKLARIVWSVWYNNRPYEPK"
FT   gene            complement(504634..504759)
FT                   /locus_tag="LS215_0595"
FT   CDS_pept        complement(504634..504759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0595"
FT                   /product="transposase ISC1229"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34688"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM65"
FT                   /protein_id="ACP34688.1"
FT                   /translation="MKSSARGVTNPYHRTEHCDKIHAYRCDKEVGVIGIDVSKDH"
FT   gene            505006..505479
FT                   /locus_tag="LS215_0596"
FT   CDS_pept        505006..505479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0596"
FT                   /product="PaREP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34689"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM66"
FT                   /protein_id="ACP34689.1"
FT                   /translation="MMEELIKKAEEMGIDVEDLIITAMSRKDPQEGIKLRLTLARKYMA
FT                   EAEEYLKKGDSVQASEKAYKVAEEVVKALAEKFNLPEYQQAVKEGRWYAYTLGSASASL
FT                   SKMLGEWVVNGWSSAYFLHVWGFHESKLSTNDVIPYIEGVRKLLENAEKVIGS"
FT   gene            506441..507721
FT                   /locus_tag="LS215_0597"
FT   CDS_pept        506441..507721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34690"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM67"
FT                   /protein_id="ACP34690.1"
FT                   /translation="MIIDNMEAINHDKIFEGYFGKLNEYLHCYLHDIFKSIVARGGRDG
FT                   RECDITASISEQYSKFAINKVREVLEKLCSIILSPITLSPMIYIDSRGNILKVNFKERF
FT                   DDLPRYYVKDFLNYKYGNDIYNKILEKITSGDKLNSYELIALIDASRFMVQRSWISAND
FT                   ITIHAHLRGALLASLNNISLIRISNPFYSEYNTLKDIEGIYAITKIFLYYLNSCLLEKL
FT                   TNTSLNNVLKRLIDELPEDKYATPLIDFYTPFIFDADERSITLFYVKDKLNDVKECIKS
FT                   SFTATINEVLSKLARRLIKIKETITYKLDLVKEHENMLNNPEALNEFLEVPNSVLFTEI
FT                   ENAEVELEGIETEDRLCSVCKLRKSVREDLIPTIITRKTEDRLCNICLSVRLAPYAVGR
FT                   TSTLKRGDRGDTDVEKEGWYNLFKKNR"
FT   gene            507768..508907
FT                   /locus_tag="LS215_0598"
FT   CDS_pept        507768..508907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34691"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM68"
FT                   /protein_id="ACP34691.1"
FT                   /translation="MIFLGIKLDLKKWDNRDVSLIEAYHLNLENLRNSVKEFLKDVRDR
FT                   ILSGTDPNVDFVVNNCVQLKDPNPEKFEKLTSSFIDLLTSQSKRININEFANKISDICD
FT                   NIFSSKELERLRNNIKNLLKNHIDYFNEKVEQLKNEYRCDLNTIEVENIIRNFIDSYRK
FT                   IEISKSLDRLFSIKQNFSVIIEYFMALLYIKKVGHITLIEPSITTPFFLAVIRKKDFKK
FT                   LFNEVLYPFFKKFLEDSRYSISNLMLVYIIKAKSYTPIKIIKEIINTEPKPLKDSTVLL
FT                   IPVIVNRNSLPVTELIGIDIYCFKKFMDLVEKEILDEEALIRLLRSSAEDLPYPAFEDC
FT                   NKLPEICSDIMSKWVRGKVFSIHHDNELKLKGYIARLLT"
FT   gene            508904..509614
FT                   /locus_tag="LS215_0599"
FT   CDS_pept        508904..509614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34692"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM69"
FT                   /protein_id="ACP34692.1"
FT                   /translation="MRVFKITLRAYNGFYKEILPSTTIAGGITYAAYLNKDILQTTIGF
FT                   TDFHKNNNIYKLYVSRIKLDKIMNKAEPFYLYKYVDKGEYYLTYIGYAIANEENEVKNL
FT                   INKYGAYIGNWNTIFSLDSISEVSNISDKCVYNLPVIDLSDLISKYKNMRVQVHRFTNS
FT                   NYLSMSPYKIYYDTREKKFLKVTNKKYVYLATFKIDNADIGYYYDESVLANLNPFERIY
FT                   VKMGFGVIGPCIQI"
FT   gene            509599..509946
FT                   /locus_tag="LS215_0600"
FT   CDS_pept        509599..509946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34693"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM70"
FT                   /protein_id="ACP34693.1"
FT                   /translation="MYSDLVKYAISFNPKQYKKKYYTLPTKIEENTLVRYIWHLKTLVR
FT                   CLLSNSKEKYILGSGKIKLPYISRILFSIDDNKLVVLCLLEDSICDLVFRTVEMALTID
FT                   EKTKEEIIKGC"
FT   gene            complement(509943..510638)
FT                   /locus_tag="LS215_0601"
FT   CDS_pept        complement(509943..510638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0601"
FT                   /product="protein of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34694"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM71"
FT                   /protein_id="ACP34694.1"
FT                   /translation="MIRIHVKLVPLTPYNISASLKTGERKVMFYFGSDPSFKFIPPTTI
FT                   KGLLRTAACYAYFEGACETVTAKILLSNLDRVESELEKCKNSEKKAKSSFTCAELQRLR
FT                   ESEDCESKVYANILGDVIEKFSKPCIICRVFGNENIRAKMRIVMSHKKVNTQFMSGLKF
FT                   TYDIKKKSKGLNIEVSKDEIEFDVLCEDEECKNVIIEALRQINDGIVRLGRFKSRGLGI
FT                   LRAEYKVIT"
FT   gene            complement(510635..510853)
FT                   /pseudo
FT                   /locus_tag="LS215_0602"
FT   gene            complement(510950..512080)
FT                   /locus_tag="LS215_0603"
FT   CDS_pept        complement(510950..512080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0603"
FT                   /product="protein of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34695"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM72"
FT                   /protein_id="ACP34695.1"
FT                   /translation="MKVLPVVLETLSLTRVGATGVYFDYSAADLVTYKIPLQVNDENYY
FT                   IPAISATSFKGLLRSTYERYLRKGRVDTKVLENVGVLSEEEKKIVFESLKEELSNYIYA
FT                   GLIDKVGETLEEAFKQYLEITGYGIDKACYVTSDLDRCENLALIEDEKRRKLKEAWIKL
FT                   TGRKNLCEVCRVLGTSGVRGFVKFTDLVAVDPFPVLLERTTHVAINRVTMTVEKGKLFT
FT                   EEVIPAGVKFLGFLAVLNDPLTDKVVEMLKILKEKADEGGVWIGGRGTSGYGSFRLYIP
FT                   GEVVEFNSVLLKGKFALSITEPKEVGCDKRILCKLFPNTFMNALNPVSEGEVVFTVITE
FT                   GGKIYEARNGEELKSILDKVRGEKYEVRVKGVWSLS"
FT   sig_peptide     complement(512003..512080)
FT                   /locus_tag="LS215_0603"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.455 at
FT                   residue 26"
FT   gene            complement(512077..512292)
FT                   /locus_tag="LS215_0604"
FT   CDS_pept        complement(512077..512292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34696"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM73"
FT                   /protein_id="ACP34696.1"
FT                   /translation="MEREDEIERAKILINVMQQYIISGIDDQKIVDNLILTLRSFKGLH
FT                   VENVIKALYNRDVSRAKEELIKVLRS"
FT   gene            512964..513293
FT                   /locus_tag="LS215_0605"
FT   CDS_pept        512964..513293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0605"
FT                   /product="transposase ISC1225"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34697"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM74"
FT                   /protein_id="ACP34697.1"
FT                   /translation="MTTPDYISPKIRVKIEEKLFSIINFKGRKAEEVKKTLVTAALTKD
FT                   SVENKAKEFGISPQTVRNYVEEQPQVIDQMLNVIKTISVKELGGRKRVKISIDWTSIEY
FT                   KGKPI"
FT   gene            513338..514401
FT                   /pseudo
FT                   /locus_tag="LS215_0606"
FT   gene            514604..515184
FT                   /pseudo
FT                   /locus_tag="LS215_0607"
FT   gene            complement(515170..515550)
FT                   /pseudo
FT                   /locus_tag="LS215_0608"
FT   gene            complement(515534..516473)
FT                   /pseudo
FT                   /locus_tag="LS215_0609"
FT                   /note="conserved hypothetical protein"
FT   gene            complement(516595..517833)
FT                   /locus_tag="LS215_0610"
FT   CDS_pept        complement(516595..517833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0610"
FT                   /product="transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34698"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM75"
FT                   /protein_id="ACP34698.1"
FT                   /translation="MERTIKLRVRVDYITYSALKEVEGEYREVLEDAINYGLSNKTTSF
FT                   TRIKAGVYKTEREKHKDLPSHYIYTACEDASERLDSFEKLKKRGRSYTEKPSVRKITVH
FT                   LDDHLWKFSLDKISISTMQGRVFISPTFPKIFWEYYNTEWRIASEARFKLLKGNVVEFF
FT                   IVFKRDEPKPYEPKGFIPVDLNEDSVSVLVDGKPMLLETNTKRITLGYEYRRKAITTGR
FT                   STKDREVKRKLKRLRERDKKVDIRRKLAKLIVKEAFESMSAIVLEDLPRRTPEHMIKDV
FT                   KDSQLRLRIYRSAFSSMKNAIIEKAKEFRVPVVLVNPSYTSSTCPIHGAKIVYQPDGGD
FT                   APRVGVCEKGKEKWHRDVVALYNLRKRAGDVSPVPLGSKESHDPPTVKLGRWLRAKSLH
FT                   SIMNEHKMIEMKV"
FT   sig_peptide     complement(517771..517833)
FT                   /locus_tag="LS215_0610"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.305 at
FT                   residue 21"
FT   gene            complement(517805..518446)
FT                   /locus_tag="LS215_0611"
FT   CDS_pept        complement(517805..518446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0611"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34699"
FT                   /db_xref="GOA:C3MM76"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM76"
FT                   /protein_id="ACP34699.1"
FT                   /translation="MERLLRPKEACQLLSISYSTLLRWIREGKIRVVTTEGGKYRIPYS
FT                   EIKKYLEKREEIRAVIYARVSSSDQKEDLERQINYLTNYATAKGYKVVEVLKDIASGLN
FT                   TQRKGLLKLFKLVEGRSVDVVLITYKDRLTRFGFEYIEELFSTMGVKIEVVFGEEPKDA
FT                   TQELVEDLIFIITSFAGKIYGMRSHKKTVLVQGVKKLIGELSGEDDKVKG"
FT   gene            complement(519520..520308)
FT                   /locus_tag="LS215_0612"
FT   CDS_pept        complement(519520..520308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0612"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34700"
FT                   /db_xref="GOA:C3MM77"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM77"
FT                   /protein_id="ACP34700.1"
FT                   /translation="MFSIQIPSLHGKYLREVFESIRLQTFQDYEVVVVNSGGDEISDLI
FT                   REYGFKEVRKDVKLLEARYLANKESKGDYALLLDETRPLRKDALELLSKNLHDMVIIGE
FT                   RELGESVWVKAAQLDKDNIMYCNSPEAIKGFALPRVFKRELLTLALETLRVNLGDVFSQ
FT                   VVFPDHELIYYEASKLSNDVTIVRDELIYHYGDVKLSDIMRKYYRYGKSLKVLKGTPYS
FT                   FMTSVSRKRRNICKGGIYDRIVLYTLYFARGIPFLLGEIL"
FT   gene            520933..521877
FT                   /locus_tag="LS215_0613"
FT   CDS_pept        520933..521877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0613"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34701"
FT                   /db_xref="GOA:C3MM78"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM78"
FT                   /protein_id="ACP34701.1"
FT                   /translation="MWLKARREGHGIFTPIFYVGTKMFARDRGIESTVDLDLIMKISGI
FT                   AKEEKADYLICHDQFTAIGCLKAFERNKIPFSVFVHEKVTNYSLPILGKIINNLEKKVF
FT                   IKAKKVFAVTDKVARTVYEKHGINAISNYPGMDKISEKSFREKENYLITVSFWDLGRKP
FT                   WDYIEVIKNVDDYKLLFVGNWRVKKAKEYFLKKVKEEGIESKVEMLEGVSESKLHELYD
FT                   KSKFLIRFGYGEYGLATPFIEAMQHTLPVIINDELGTADLAKRYNVGLVIHGINIKEIK
FT                   EFLKNMNENKYKELQLGIAKIQREYTWENHTKN"
FT   gene            complement(521958..522686)
FT                   /locus_tag="LS215_0614"
FT   CDS_pept        complement(521958..522686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0614"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34702"
FT                   /db_xref="GOA:C3MM79"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM79"
FT                   /protein_id="ACP34702.1"
FT                   /translation="MEKHPIKDFYETHYAKLDLTKHMLERITLTEKALSLFLNEKGTIV
FT                   KIGCGNGKNLRYYKERLGFKDAYCIEIASSAEDEIRNGITPYIEDVNTSKLPFMDSSVN
FT                   AVIFEEVIEHLYNSDLVLSEIHRVLKKGENGILILSTPNLSSWINRLALFMGYQPFSHD
FT                   VSFVKGSGRLAYKDQTNGHIKSFTLRAMIEYLEYFGFKVIEKRGLIADGIPSWLSALDR
FT                   FFSHFPSLASHMFIVARKEQ"
FT   gene            complement(522767..523510)
FT                   /pseudo
FT                   /locus_tag="LS215_2992"
FT                   /note="methyltransferase FkbM family"
FT   gene            524088..524711
FT                   /locus_tag="LS215_0616"
FT   CDS_pept        524088..524711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34703"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM80"
FT                   /protein_id="ACP34703.1"
FT                   /translation="MEYIPPKRLLELIRQYSITFANWYSVMLDIYFYREKIKCKLRNGQ
FT                   VLYLKPNEVVLLAGLRITELNEDSVKFQFKGREIYLKGWKLSYLGDSFPDYWRINVKGK
FT                   RVLDIGAGIGDSPIYFSIAGAKEIVAVEIDKRKVELMRDNLKVNGINNVTIVDKGVGVE
FT                   DSNNIISWPKLVSLYGPFDVAKIDCDGCERIIAPYITVDPKSPP"
FT   gene            complement(524700..525667)
FT                   /pseudo
FT                   /locus_tag="LS215_0617"
FT   gene            525855..526013
FT                   /locus_tag="LS215_2993"
FT   CDS_pept        525855..526013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2993"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2993"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34704"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM81"
FT                   /protein_id="ACP34704.1"
FT                   /translation="MILGLPIKEISELLIEWDNDYQDIISSLNKNGYKVNVEHTLKNLG
FT                   FIYAKKK"
FT   gene            526020..527069
FT                   /locus_tag="LS215_0618"
FT   CDS_pept        526020..527069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0618"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34705"
FT                   /db_xref="GOA:C3MM82"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM82"
FT                   /protein_id="ACP34705.1"
FT                   /translation="MKIFLLTSHLKERDGASKAIINFAKGIKTLSNNEPVIVSLSVSLD
FT                   TSKLGNIEVVNLGKSLGIFSSFRILLGSSSPLRPFRKYMLEDGKFIVATDDLVPLSEFK
FT                   NDLVYWSQGVLISVFFWEPFYRKNKLISVLGSPFLLHNTIKFSNFVRKYKIVLANSKTS
FT                   AVYVSLFYNRPPSSVVYPPLDTDFFKPSKSKEKFVVAILKRGYPSHIELLSKLAEKVKM
FT                   KVIGYKIPNADYLEKVSDEELRDLYSSALVTLYPVDFEYFGYIPVESMASGTPVIAFRY
FT                   SGGPSETIIDGRCGWLASDEEEFYRLTMKIYREGYSEDVNIQSRKRAEEFSIQNQTKLL
FT                   LSILDKLKV"
FT   gene            complement(527070..528032)
FT                   /locus_tag="LS215_0619"
FT   CDS_pept        complement(527070..528032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0619"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34706"
FT                   /db_xref="GOA:C3MM83"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM83"
FT                   /protein_id="ACP34706.1"
FT                   /translation="MLRSTVIVTAYKRKAFIKDAIKSIMENSLGPTEIIVVKNFKDSEI
FT                   DSFLGAYHIKNIYTDNETLGGKISLGISQSSGDILFFLEDDDLFSKNKIREVVHKFSEY
FT                   DIGFYHNDQEIFSDKAIGSYSSIDNRGFVYYSDIDSQKLKKLLFKFKAGFNVSSIVISR
FT                   DLAMRCIDLLRNVKITVDTFLLFCAIENKLPIMIDFRRLTHYRLLTSQSGNKDVNLSLF
FT                   RMQYEDALYFKRIFTSKVLKDFIEMSVIQRELIYKMLSKEISRREALIDVITNLKYSLK
FT                   YPNKWNFFLQGLSLMAAFSAEKGRSFYLKKVRSNSMLSV"
FT   gene            527911..528993
FT                   /locus_tag="LS215_0620"
FT   CDS_pept        527911..528993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0620"
FT                   /product="methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34707"
FT                   /db_xref="GOA:C3MM84"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM84"
FT                   /protein_id="ACP34707.1"
FT                   /translation="MKFFTTIISVGPNEFSMMDLIASFINAFLLYAVTITVDLSTKTII
FT                   RFVFYFFIMTNYASFKEVLISYFNRYPYTLLPLYTKAYKNPLIVALKSALRHYPFTACL
FT                   KNGDKVIITGKGYKIASYYAFLYLSHKKGKKINIIDIDENTIKVIYDTHEIIFKDYTAG
FT                   DVIGVYVKEEYQDINVKDKTVIDCGAAIGDSAIYFSLKGAKRVIAIEAYPKIAKVAEEN
FT                   VKLNNLTNIWIVNAACGIDGFITVDSRLGGGPTPLINTNNGYTVPSYSLKSIIKNFQIE
FT                   KGSVLKLDCEGCEYDFILNEDSSTLEYFDQVIMEYHYGYSLLKRKLENAGFKVKVTKPE
FT                   LWDNQFRRGLILGKLYAFRE"
FT   gene            complement(528999..530210)
FT                   /locus_tag="LS215_0621"
FT   CDS_pept        complement(528999..530210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0621"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34708"
FT                   /db_xref="GOA:C3MM85"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM85"
FT                   /protein_id="ACP34708.1"
FT                   /translation="MVKIAVLVDYDLQGGSGYVEKQISNRLMQLYGDSIRIVYKTNDWN
FT                   QINVILKELKSENIKLIFDLDYWPINYYQVKSLKHNLKAITKLPYLLGESYYYAKKLKV
FT                   KSAVLLQSMGLNALKFGLPYILIKYLKMKSELPIDIFLNTKNKFIYTVYKGLRESFISS
FT                   FIKYSNAIHRIYGVSQGQLSSLGLAKSKKATVIDPPLAVEKELLSKRKDVNEKKDYLVF
FT                   YARLIPLKGILELPFIVKEVITLSGYKELKVFIMGKFPVVDLKNFFFSIVNKLGLEENI
FT                   VYKGYVSREELLNTVSEARCVVYPSHEDSFSLAILEAITMGTPVVAYDIPGPKSVYSGL
FT                   SSVKFVDEFNIKSMATEVVKILKMTDDEYNSLIYNDKMDKFIEKYTDWDLVVERYYRDL
FT                   MSLL"
FT   gene            complement(530218..532452)
FT                   /locus_tag="LS215_0622"
FT   CDS_pept        complement(530218..532452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34709"
FT                   /db_xref="GOA:C3MM86"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM86"
FT                   /protein_id="ACP34709.1"
FT                   /translation="MVELKKVSVIKLLYYLIPLFLDAALLSTYLQGGIIYWLDSNFPFN
FT                   PIIWLNKIFLDYWNGPFFPGAPNAYSQDSLFIGLFIYLFYDIFHLSLYISEFLYLLIFL
FT                   YLSQIGFIKLLGIIEKIFDKKIDKYTYIGALAGGFLYTWGFYAYSPPILGVNYPFFVFY
FT                   SLFPLFLYFSIKYVFIDKDYITFSLFSIYLILFSGTQFAAFTFLLWAIVIYVLIMFSLW
FT                   KLSKKGTLVKLMSRNAIIFLFSIVAGLEQLYQTINASIGAYSVGTHQKFLGKHIVISET
FT                   LSTYESYHIQTVFSLFSNYDFVGLLVFVSLVAFVFGIEKDKISKFLLSMLFLFIFVGGL
FT                   LTGIINVIPLYSLSSTPIGFAAIGLMYSIQFIFSGFVLSFTSSLIFSYVIPWAISFINS
FT                   NYKKILAIIVILLILSSYIYSFRIGEYHAGFRAFNLPVNATNIFYPPSELVNTGNYLSS
FT                   HAAYYNILEFPQQYASGMYDDNGTKAVWYTIYPLSDYIYGTVIKSPAVNVVYPLYKYFP
FT                   SCDFKNITNYFVLLGAKYIVLNKQEYPGPGVPLGYAGGYPWNYTKFIDALSRAPNITLL
FT                   MENKYYNVYVINLNVSLLYPSEGLAENLSCNQLFFLYSNNTLKAQTQSVIYGLGAINIT
FT                   NISDVHIKIVNNYWNEVYEIQVNASKPFYLVFDEGYSQLWEVIINGEINTHHYIANGYA
FT                   NAWLMPAGKYEAILELSIVSTVHLLYIITFSGLIILALIYVIYKFKNFKK"
FT   gene            complement(532650..533384)
FT                   /locus_tag="LS215_0623"
FT   CDS_pept        complement(532650..533384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0623"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM87"
FT                   /protein_id="ACP34710.1"
FT                   /translation="MPNKLSKVLSVFENDRKLGFYRHKMMIINEEGKPSKFGINNLNKI
FT                   YLDKEKVKLSQAYLIMFRNREGYAAVSSMIMRKNILLHRIEYLNKIRIATDSFYIISSL
FT                   LSKYNIYLDNEILGKYRFQKVSASSRLTNFNEFVNYYTEKYKYQCLDMLAIYNLTKGTD
FT                   LERFLYYDYIFLKVLHKLFSSNNECNLSIRDVFRLLYNPYGEKSLMNFVLGVASFLPLS
FT                   VKRIIQRRIFNDRMLLYKKLFE"
FT   gene            533666..534616
FT                   /locus_tag="LS215_0624"
FT   CDS_pept        533666..534616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0624"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34711"
FT                   /db_xref="GOA:C3MM88"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM88"
FT                   /protein_id="ACP34711.1"
FT                   /translation="MEIFKTSFKLLSVMLITIVTYNPEEDFVAGIIKKIREKEERVKIL
FT                   VVDNHSTRKPLNKVQFLSDYFIPFDKNYGLGKAYNKATEVAKELGEDYVMFLDQDTTIL
FT                   DNFAPSKVIREAKELKDRGGPLPIILSVNIDNALIDKEIPNSNFYTARGVVNSGMILNV
FT                   DYALRQPFLESLFLDRLDFEYTYRAEKFGYLPLVYRERMILHKPGEKSKYYSRLCGKLL
FT                   VALMLMLHRNDKDREKYKQYGYYSNFLRYYLILRNDIYLWFRGKIYPSFWKMIIEDIFI
FT                   MCEVLGYRKSAKWIFRAIKYGLLGDLEKDNQKLFN"
FT   gene            complement(534630..535808)
FT                   /locus_tag="LS215_0625"
FT   CDS_pept        complement(534630..535808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0625"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34712"
FT                   /db_xref="GOA:C3MM89"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM89"
FT                   /protein_id="ACP34712.1"
FT                   /translation="MNISLMRISFVLPGTYTAGGVRYVFEVANGLKDKGYDVNILSLTG
FT                   DHSWFNGLKVKVIYKQLKLNKISLVLYYIYKLYKYIYYRNSKGRPYDALIAFSSLLDIK
FT                   YDIITELADFIQNFDSDIVIATYYLTAFSVWFSQSKRPFYLMQDFPELVENNEGKIGLN
FT                   MFKLSLKLPFSFVTVSSYTKQLILDNNPTARVTIANPGVNLEVFRPKRELQNDNKRRVM
FT                   LILRGPKYKSDNIGLEVLKIVNKKIPIHALIVGSKNLVKRYSKTIGIDFSYTVFSNVDD
FT                   EKLSRLYSSADAFIFTSYAEGFGLPPLEAMACGTPVVMSDNKGSMDYAVNGYNALVSQP
FT                   GDVKSLSDNLIKVLQDDKLREKLIENGLETAKRFTWSSTVNNFEKALREELL"
FT   gene            536007..537158
FT                   /locus_tag="LS215_0626"
FT   CDS_pept        536007..537158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0626"
FT                   /product="hypothetical protein,Gain"
FT                   /note="Critica"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34713"
FT                   /db_xref="GOA:C3MM90"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM90"
FT                   /protein_id="ACP34713.1"
FT                   /translation="MFTGLYPYFHGVHEYYGITNIVEDFSKLSKMAMSKFDNLISLARD
FT                   ENYETIGISANSFISPSFGFNFDLNYLVAFPPLSIIDNEILASLHKYNSSHKAKLLISL
FT                   LKDREFSKLKSLILYKLFNNSLREYFYYKSKILHKGCNLILKKLYKIKFTDRFFLFINI
FT                   MEAHEPYSNEIIGKDPHEKYIYNFLRSIFLGSAENYMIEHYRQHYEVHAMNAINCVLNI
FT                   ISILWKKININNSLIIITSDHGNHIGEKGRVNHGFYLSDELLKVPLYIRYPKDTNRDLK
FT                   LKSNMNSLVVIYSLIKSIIYSENLDINNNLAISESYGPQHSLRAIKAYFNLTDVDIKKY
FT                   YTHRIRLSYNGNYLIYDLGKDEIIETSQEFNRAYIQKIKELFS"
FT   gene            complement(537211..538299)
FT                   /locus_tag="LS215_0627"
FT   CDS_pept        complement(537211..538299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0627"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34714"
FT                   /db_xref="GOA:C3MM91"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM91"
FT                   /protein_id="ACP34714.1"
FT                   /translation="MSNGTSIKNIRTRAIYLTPSSTPNRGGMRYILSIINQCNFDERKI
FT                   IYIDSTSVFSWIKNVLKYLRENVSQNELNIVFIRGAPVLDSIGPILFKLFFNRNIKLIA
FT                   PLFHLNPLSQSKNRYDKSTIIFSFMQRIGAFLEILLADIFLTENTYISKYIRKFRKNAK
FT                   VIVKQLGITKNYIPNIEQILTADKDIDFLYVGGLDKSKGVEDILRAFKPISKDHSLIIA
FT                   GYGSKDWLERLINRKYNLENVSIYTNISEEEKFKLYLRSKVYVFPSVADGIPITFHEAW
FT                   AYGNLIVTYMLPTYIDIKDRIFGVPQLNIEKLREKMVYVLSNYDKYKELIVSNYWYAVK
FT                   NSNSPENVQEICDKIYRYLNIS"
FT   gene            complement(538277..539383)
FT                   /locus_tag="LS215_0628"
FT   CDS_pept        complement(538277..539383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0628"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /EC_number="2.6.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34715"
FT                   /db_xref="GOA:C3MM92"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM92"
FT                   /protein_id="ACP34715.1"
FT                   /translation="MIPVYKPEIGKEEEEEVLKVIRSGWISSASPAVREFEEKFSAYIG
FT                   RKYGVATSNGTTALHLAVTALGIKEGDEVIVPDLTFISPVNVVLYNRAIPVIVDVEEEN
FT                   WGLDPEKVRKAITNKTKAIIVVHLYGNPAKVSELKEIAEEKGIYLIEDCAEAHGAEYEG
FT                   KKVGNFGDIACFSFYANKVITTGEGGMCLTDDEGLYEKMQILRDHGMTKEKRYWHEVVG
FT                   YNYRMTGLQAALGLAQLKKIDKFIERKREIARLYQELLEDVVTVQKDPPNGKSIFWLFS
FT                   ILTEKRDELAEYLAKNDVETRKFFYPVHEMPPYRDFAKNDYVVSEKLSKLGLSLPSYLS
FT                   LSKSETSFISEKIIGFFKGLKHEQWDQH"
FT   gene            complement(539380..540441)
FT                   /locus_tag="LS215_0629"
FT   CDS_pept        complement(539380..540441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0629"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34716"
FT                   /db_xref="GOA:C3MM93"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM93"
FT                   /protein_id="ACP34716.1"
FT                   /translation="MKSKKLTLITGITGQDGAYLAKLLLEKGYEVYGIFRRVSSPNFWR
FT                   LQALGIESKVNLIPADITDFSSILEAIKFTSPDEVYHLAAQSFVGASFESPIATSQITG
FT                   VSTLNLLEAIRQVDPTIKFYFAATSELYGNTKYDGKINEETPFNPASPYAVAKLYGYWI
FT                   TKVYRESYKIFAVNGILFNHESELRGLEFVTRKISNEVARIYLGLSNELRLGNLEARRD
FT                   WGYAPEYVEAMWMMLQQDKPEDFVIATGESHSVREFVEEAFSYVGLDWTKYVKIDKRFF
FT                   RPLDVNELIGDYSKAKQKLGWEPKTTFRELVRKMVDADIERWRKWLKGERIPFDAPYYD
FT                   ENSLNIITRGLRV"
FT   gene            complement(540643..541500)
FT                   /locus_tag="LS215_0630"
FT   CDS_pept        complement(540643..541500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0630"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34717"
FT                   /db_xref="GOA:C3MM94"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM94"
FT                   /protein_id="ACP34717.1"
FT                   /translation="MTIDCSKPKIMEDFYDEELLSKYVEAQLTSIEREILIDKNAVSKQ
FT                   DKVLDVGCGPGRVSIYLSRFVNQIIGIDVSKSSVEYCNKRTSQLKITNIHCFFADITSE
FT                   NTLTMLKDYSPFDVALLLFNTIEGIPKRDNRILALKNINWLLKAQGRLILSIHNRYWFN
FT                   WLKTTSLLNLRRLLLRLKSDKDLSLIDQCIKTSEFNSIILKTSTTIYPWYIHSFMDIRK
FT                   ELKHAGFLIERVFLTEDDNPLRPAQYKILDEINYSKITEALLLLIKILSRPKYYIIARK
FT                   QSEL"
FT   gene            complement(541511..542416)
FT                   /locus_tag="LS215_0631"
FT   CDS_pept        complement(541511..542416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34718"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM95"
FT                   /protein_id="ACP34718.1"
FT                   /translation="MLDPDIIVPITKNKFQPYFFDDYPKIIVILEDGNIIGYMFTYFAY
FT                   IRKIFKSIRIFYPFVSSVNLNYGEIIRKISNSHMVNLVPLLDNPYMHLVPNSFTRVELQ
FT                   RIVSYDLIPDKKARNLVRKAIANNLETQILSGDQITKDDIRDFLLVAKESLNRRGRTIN
FT                   VDNTLICKWYTTISSIPENKGVFVKVLDNSGKILGGNYVIISGKILYHYIAYNSIEGLK
FT                   KEAGYLALDTIFKFARDNNLIVDFGLNPFEPFVEYKKHWGITRIEPAFNYIPIHYKIIF
FT                   NLYKKLLKSTFIKKIIGFGN"
FT   gene            complement(542513..543481)
FT                   /locus_tag="LS215_0632"
FT   CDS_pept        complement(542513..543481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0632"
FT                   /product="methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34719"
FT                   /db_xref="GOA:C3MM96"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM96"
FT                   /protein_id="ACP34719.1"
FT                   /translation="MKLSHLKELRNIRKLNNFFDNMYSAILQYIEKKPLITLKVEGNAI
FT                   KVSRRLFEQLAYSILNNKVTSLDLSEEQMVINKEIRIFRCDVDGLSYFDDNLPLNLSEE
FT                   AKKLGWKVEDGLWTNGKVKFLVMLGILMETFNYNIYRIEGVKGRDVVDIGGSIGDTAIF
FT                   YKINGARNVISLEPLSLPYNLAKIHIRINGITGVNFIRGALLAEKQNVNVPRCYPLYGS
FT                   AGFSIQSKSFNDNEEVPTYTLSEIMPEDPYILKMYCEGCEYNIILKDYDTVRKFNVIVF
FT                   ETHEYITHISHKVLLDKLNANYKCNIYEIEGHPIVKCLAKG"
FT   gene            complement(543481..544386)
FT                   /locus_tag="LS215_0633"
FT   CDS_pept        complement(543481..544386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0633"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34720"
FT                   /db_xref="GOA:C3MM97"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM97"
FT                   /protein_id="ACP34720.1"
FT                   /translation="MSSITLRGKIAEQLYEIASSTGLTPESYIVSLLQNKNKKRVEYLP
FT                   LEYKAKIAELVIEAAYNTFKRVVVVWSGGKDSTLSLYFARKVSEKLGKPLEAIIIDHYM
FT                   HFDETWKFIDEVKKDWNVNLIVKGNERLKGHKYGDVIKISDLSEKDRKELENVGYSKDT
FT                   FLYALNNIAANHLLKTVPLKEAIEEYNIDALIVGDRWDENPARSTETFFSARENPKHFR
FT                   VHPILLFTERDVWNFILTNKLPIHPLYYKGFRSIDDKYETKPTDTKPAWEQDLENTPER
FT                   AGRAQDKENIMEILRRHGYM"
FT   gene            544855..546264
FT                   /locus_tag="LS215_0634"
FT   CDS_pept        544855..546264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0634"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34721"
FT                   /db_xref="GOA:C3MM98"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM98"
FT                   /protein_id="ACP34721.1"
FT                   /translation="MNPIKNALKSLSVTTTNVVVALIFFLITAKITNPEFFGKVAIIQL
FT                   LEVVTSAFFYFIPGQIITREISYLYARKEISKNIIGKFLSFPFLVLPLFLILLLFPNYV
FT                   KLAIPYLFLYLLNSVMGSIMVGMDMFTETAITGNIFLIIRWGISIIAVLSHSIYLFIEI
FT                   WTLGGIISVSMNYAFLSRKVGLILPSFDFAFLFKHFKEGLPLYLSSSATFLSSQGDRVT
FT                   TAYLLGSYYLGLYQFSALVAGVPSMVLGSMSGVLLPTASFYKALGKDEKKMSSISFRVL
FT                   SLITFLAVIISIPVAVLVVNKFFPAYTAGLKVLILLLLAITLPFPIGSLTNFIIAAKKS
FT                   LRLFLLLSILNGSLVLSTSYLLIPRIGIMGGAISQLVVSIISSIFIIIYALKENVFVLG
FT                   RKEAVLLTSIPLIGLYEAFVDPPYLDFLLLLLVILFFKTFKVIEKGDVKLVKSFLPSKL
FT                   KFISYILELMS"
FT   gene            546607..547416
FT                   /locus_tag="LS215_0635"
FT   CDS_pept        546607..547416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0635"
FT                   /product="conserved hypothetical protein"
FT                   /note="Critica"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34722"
FT                   /db_xref="GOA:C3MM99"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C3MM99"
FT                   /protein_id="ACP34722.1"
FT                   /translation="MEIAKIVFPIYLTGIVYFISGQGDRVVTAFLLGSYYLGIYQLVAL
FT                   AAVVPPMLISSFSSSLLPSSTYYYTKGKDMKEISSISFRIVTLISLPLAILGYAISPLF
FT                   ISKFFPQYVLGIPSMQLLILSLTSTMPLQLLSTFMIAAKKDYRPFIIIGIISAAEVVGV
FT                   SYYLIPRIGIYGAAIAQAFNAVITSLLYLFFSYSQGVFKLERREIASLALIGLSFLGFI
FT                   NWEVVLIVVLLGFKLLGIIGSDEVKVIEGFTPYSLKRITKILYLIAR"
FT   gene            547652..547813
FT                   /locus_tag="LS215_3014"
FT   CDS_pept        547652..547813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_3014"
FT                   /product="polysaccharide biosynthesis related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_3014"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34723"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMA0"
FT                   /protein_id="ACP34723.1"
FT                   /translation="MELAKPCLSLYLLNGVIGSIMVGMDMFTEGAITGNLTIRWGISII
FT                   AVLSHNFH"
FT   gene            548024..548893
FT                   /locus_tag="LS215_0636"
FT   CDS_pept        548024..548893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0636"
FT                   /product="CRISPR-associated RAMP protein, Cmr4 family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34724"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMA1"
FT                   /protein_id="ACP34724.1"
FT                   /translation="MANYFAKAHVFYIFTVTNCHVGSGSTASEEIDLPFQRDSLGYPTI
FT                   YASSLKGSMKSFLLRTYEDSKKGDVFYLFGKDESADEASKVSILDAVLLLIPARIISVS
FT                   NGFRGVYAYATTVELLDTAKSYLDAVSSLTQGNLDKKNDDVKFYKVDENGNLEVIVNES
FT                   YFKFKEDNDLKNNYSRLIPPSVNKPIFVFEGNIGKDIINRSLIRVRRIRIDRGKKTVEI
FT                   GGLWSEEYVPHDTYFMSVALVREDGKKDGGSQSALELFNSIKNKLNYLVIGGHETIGKG
FT                   IVRLIWAD"
FT   gene            548895..549392
FT                   /locus_tag="LS215_0637"
FT   CDS_pept        548895..549392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0637"
FT                   /product="CRISPR-associated protein, Cmr5 family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34725"
FT                   /db_xref="InterPro:IPR010160"
FT                   /db_xref="InterPro:IPR023101"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMA2"
FT                   /protein_id="ACP34725.1"
FT                   /translation="MIDSIKLAIDVFPKTISNIEDKDVLKYLKSRCRDFPEEALNSGFL
FT                   PAFLFYLSKSNICVMIDFLDYLNSNSESKFNKFDKNESKQTIAYTIYTALVIYFLEKTE
FT                   LKDKLGLNDLSKLCPNNNISESAKKLGEILNGLYFNSSVVTILSKNYLLTLKRLAEAII
FT                   NV"
FT   gene            549385..550842
FT                   /locus_tag="LS215_0638"
FT   CDS_pept        549385..550842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0638"
FT                   /product="CRISPR-associated RAMP protein, Cmr1 family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34726"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR007522"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMA3"
FT                   /protein_id="ACP34726.1"
FT                   /translation="MYEEILSIDAIALYPIVGGYNSYPVSLTVGYEEPIRATEIKGLWK
FT                   WWTRILLESVIFKQVNYVVPYSEIDKVMEDIFGSEDRKSLVRIDVKVNDDFIGVAEKIW
FT                   QFLLSFFQKGQVINQRNVSSQNNIIIQVQNSNVYVINIDTYNNLKSIRVRRDDRDPKPD
FT                   DKLIVIDFNNKKISIGGVGELKLEGLDKHLTIDNMRDFLSIPRIKLDMLRYNNTGLKVK
FT                   DLNGRELNELVRIILDLITTVLIPKEVKFTISIKVDTERLKNEKNELDMNKVKKLKFAL
FT                   YSLFVYSILGGIGRMTNRGMGSLSPTVPTGINCRDNDLCGNLKSLFNEFSKISDESKIN
FT                   DFIRTLIDFDSLKKLSENWINEIGNTSKVNNVFYISTYTLKYLYAREINDPLKYLKALG
FT                   ELTLSTNINDPTFANEIFGRPRKRDDIRLPSAFRFKILYIGNKYYLIWYLLDRYSDANS
FT                   SRSVIEGYKEKIARFIKNAQQKLGEVH"
FT   gene            550890..551747
FT                   /locus_tag="LS215_0639"
FT   CDS_pept        550890..551747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0639"
FT                   /product="CRISPR-associated RAMP protein, Cmr6 family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34727"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010172"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMA4"
FT                   /protein_id="ACP34727.1"
FT                   /translation="MNTNFQSINLYSILQLEGIIMSILRLYSNNKAGEKELDDFENIPI
FT                   AEIYKNYIRFKNNQVQRYSIEDVYNLKKRQIAELLSISYKPDFSMLRHVINNTKEILEK
FT                   LKYSFIEVRIKTSSKTFIGISAQFGFTIFESGISFDPIFNAPYIPASEIKGILRSCIED
FT                   KDKELVEKLFGTENNEGLLMITDAFPISAERNTFLPEIITPHYTSNVKQETEVNPNPVI
FT                   LLAIAPGVTFEFLVYYKDQNLDDKEKEIIKDLIYKMVKEGIGAKTTLGFSQFTVNRILW
FT                   SVKN"
FT   gene            551729..554842
FT                   /locus_tag="LS215_0640"
FT   CDS_pept        551729..554842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0640"
FT                   /product="CRISPR-associated protein, Crm2 family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34728"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMA5"
FT                   /protein_id="ACP34728.1"
FT                   /translation="MEREKLTKSLEEIIKEKFAALLHDPPNKPFILKCTQRSVSKESLK
FT                   NAKFKYLSNLTKNKIGHEDVVAELISHLDFLNENNIMMEIIENHIKSNNSTVKKADGKA
FT                   SKFDRYLTSTLYNIRERIYFANYDNIELKNFLVPELQVKLKTIECEKEPINAECFFKDP
FT                   YSNQDIIQLFDYISKVFKALNLNGISVETYNVFYFLYELLWIAKGYSVGPAETRAPTHS
FT                   IFDHLYATASILNWFHGISKFLVGLDIVGVADYINKSRKLRDLWASSYLLSALVWYVLI
FT                   NIVEEFGADVVLFPSLRFNPFFASYIYNKYLKDKENSETVIHEVVNFITKYIFNNDETY
FT                   KKLGIPPYAIIPARATLILPGIRYVERTLNLRCERDQNSQNEYEKCISNYIEEKFKEGW
FT                   KKLVNSLIEYASKNPNDYFWAVFHKVMSKTSVQEFKENPPLLLRVIVTEIRNDEKNKDK
FT                   EPNYMDFDNKYIKLVSEFKKCKLSRTSPATKLSNFEYYKDAIGESSRGFEYCSVCGVLP
FT                   AVLILPKGDEEYKEFVKGIMGEQIGDEIDDLKVVLSPGEKLCPWCLIKRGLGMRPEVFK
FT                   VLVNNGDFGQEEMENKRVFIPSVSHIASYEKYEALKNEESKCEKIRDTISLWKYYETYP
FT                   EDKRCLILKDPEILWFGRTRDKTLSPYYALIRADTDYLGDLLEGKLTPYLAGIIDSTFY
FT                   GGKKDGKENVENAIKRYLGNAGEGPYKNVMKLVLSNKESEAKEIIKEEIKDEKLINNII
FT                   HHIKKFIKKNRRRDRLVLFPSWHVSISSMLNRILLMEIKLANDLDGFVVYAGGDDLLAI
FT                   LPVEKALEFVEKSRKAIAGIIRDKIGEFMQTESKGFVKLNNAYFSLLPLVGRSYVIYFS
FT                   HIKYPLQLVLEDSYNLLEDGKERIRYGNYKKDIVIVKYRGSASVLPLSIKRPYEGNIDE
FT                   YLNSIGKSLELLRRLYELIKQEKLSKSVIYDVLSDELLNNGKIKDELLAIYLDYLINRN
FT                   RLDKKLKFSFNDYKDLIQLEIKSDNNSKTLIYNLFQALSNILGAEKSE"
FT   gene            554835..555743
FT                   /locus_tag="LS215_0641"
FT   CDS_pept        554835..555743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0641"
FT                   /product="CRISPR-associated protein, Cmr3 family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34729"
FT                   /db_xref="InterPro:IPR010165"
FT                   /db_xref="InterPro:IPR019117"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMA6"
FT                   /protein_id="ACP34729.1"
FT                   /translation="MSEKVTLVIKPLEPLMLRSSGEFDIETKGPASYAKSLLIPRPSTI
FT                   AGMLASLLYKGVVKENWIDEVKENMKPINEICGPLLVKENYAYVPLRIGGVFTLIKAPL
FT                   DKLSESIRDKIYDIIKFYKDEDKEKIDYNKIDTEISELTREDLSPVVFIQPRLGIGLDR
FT                   DKKVTKEGMLYIANYVSIDAEIHVILTGDKNEIKKALDGKIAFLGGEGRIVKLSILDKE
FT                   TFNCSKNTNNGILLSPLPVNKADKFIGELGIIGMGFDIRNKKRKEIVKAVLEGSIVISA
FT                   NPITKYNVLGYGSQITLNLGC"
FT   gene            555928..556300
FT                   /pseudo
FT                   /locus_tag="LS215_0642"
FT   gene            556537..557502
FT                   /locus_tag="LS215_0643"
FT   CDS_pept        556537..557502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0643"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34730"
FT                   /db_xref="GOA:C3MMA7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMA7"
FT                   /protein_id="ACP34730.1"
FT                   /translation="MLNFQGEKVAKTLISACLWNDSVENKSRAYDVSPQTVRNYVEKQG
FT                   MEVIEKLLERARKISLEVLKGVKEIDLSIDWTTKTWYGKPVEGSSEKGNSWNYATTKYK
FT                   GKVLLLAFIPQVNGMTKDEIVKVLVEQVMAMGFKIRLITLDAGFYTVDVLNFISQFKYI
FT                   IAVPVGDVKVYEEFDGDYTTNSKRHRRDEQVKFRLLVYSKEKVRRKSLVYFARATNLDL
FT                   SKREVLDLYNKVRGPIETSCRNIKAFLPFTSSTKFVFRTLIFVLAIVLYSLYAIFKGEV
FT                   GREEFRLLLILLFPDLFNPENFTFNVIETLIYTIDLFLRR"
FT   gene            complement(557707..558771)
FT                   /locus_tag="LS215_0644"
FT   CDS_pept        complement(557707..558771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0644"
FT                   /product="glycosyl transferase group 1"
FT                   /EC_number="3.6.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34731"
FT                   /db_xref="GOA:C3MMA8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMA8"
FT                   /protein_id="ACP34731.1"
FT                   /translation="MFTIALRVLWNGGVARIAVEQARNAKAKLLVYRESFYNYDLSGIY
FT                   VEFLRRKGEKGFLTPLFRKITEIYAKNRGDEATVDLDLIVKASRIIKEPALFHDQFAGI
FT                   TGYLRKVFHGEDYVIYLHETSLTLKGIKYLIPKVMERKVLEGAKIILTNSQWNKRVLED
FT                   KGMGAEVLYPGCYTIDEVEEDKENFVLAVSMWDEGRRPEIYGEIAKRIKGRLIMAGSWA
FT                   RRDTMEEFKRKYPEVIVTGRISEDKLRELYKKASLTIRFGFDERGPGMAVLESLCNGTA
FT                   VIVNDGIGGKEFVIEGENGYVVKDWKEAVDRINEVLENHKLRRSLSINALETGKKYSWR
FT                   NHAIKLTEIMEKLA"
FT   gene            559158..560118
FT                   /pseudo
FT                   /locus_tag="LS215_0645"
FT   gene            560334..560459
FT                   /pseudo
FT                   /locus_tag="LS215_0646"
FT   gene            560456..560656
FT                   /pseudo
FT                   /locus_tag="LS215_0647"
FT   gene            complement(560753..561163)
FT                   /locus_tag="LS215_0648"
FT   CDS_pept        complement(560753..561163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0648"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34732"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMA9"
FT                   /protein_id="ACP34732.1"
FT                   /translation="MSIFVDTNVIISFVEQDVNYNKALKIREINDLMTSEVTVLELYSF
FT                   FSRKLKDEILAEASTKYALKVSNVKVVELDMNRLFRKSLELSTKLQLKTLDVLQISSAL
FT                   LLNAKSFITFDKDILKKRDLIEKIVKISVSEL"
FT   gene            complement(561160..561405)
FT                   /locus_tag="LS215_0649"
FT   CDS_pept        complement(561160..561405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0649"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34733"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMB0"
FT                   /protein_id="ACP34733.1"
FT                   /translation="MSVVITIKVDKRISELIEKMISLGIAKTKNEAVNLLIEYGRNEIE
FT                   KWITKEEKVEELINKWLKDGFPYKGLDTSDLREERV"
FT   gene            complement(561558..561662)
FT                   /locus_tag="LS215_2975"
FT   CDS_pept        complement(561558..561662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2975"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34734"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMB1"
FT                   /protein_id="ACP34734.1"
FT                   /translation="MSKRSFSVESDLGSNLIVAYGYSLKSEREAGATG"
FT   gene            561655..562165
FT                   /pseudo
FT                   /locus_tag="LS215_0650"
FT   gene            562171..562400
FT                   /pseudo
FT                   /locus_tag="LS215_0651"
FT   gene            562823..563047
FT                   /locus_tag="LS215_0652"
FT   CDS_pept        562823..563047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34735"
FT                   /db_xref="InterPro:IPR039709"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMB2"
FT                   /protein_id="ACP34735.1"
FT                   /translation="MSTVISVRIKKEIKEELEKHGVDIDQEVRKFLEELYLKVKAKEYI
FT                   NKWIEDLKDVKPSEEGFSSNSVREDRESH"
FT   gene            563034..563429
FT                   /locus_tag="LS215_0653"
FT   CDS_pept        563034..563429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0653"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34736"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMB3"
FT                   /protein_id="ACP34736.1"
FT                   /translation="MRVIDSSSLVKFFSKEKGWEKVVEIISEGVMTLDLSIKEVANSLW
FT                   KKILLGEMKEDVVIKILSDLLKREALLIVSQDEYLIEAFKIANRNKITVYDSLFIALAK
FT                   SNNLELVTSDKKQYEVAIKEGVNTRLI"
FT   gene            complement(563532..563726)
FT                   /locus_tag="LS215_0654"
FT   CDS_pept        complement(563532..563726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0654"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34737"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMB4"
FT                   /protein_id="ACP34737.1"
FT                   /translation="MEELIKRTEEKGIDVEELILSALSRIDPKESIKLRIELAEKYMAE
FT                   GEEYLKRGLKLRRNLTLKT"
FT   gene            complement(564343..565398)
FT                   /locus_tag="LS215_0655"
FT   CDS_pept        complement(564343..565398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0655"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34738"
FT                   /db_xref="GOA:C3MMB5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMB5"
FT                   /protein_id="ACP34738.1"
FT                   /translation="MVDVSSEAKSSATGVTDPYRRTEHCDKIHEYRCDKEVGVIGIDVS
FT                   KDHLITSRGRVRKYENSKKGYEEILKMKPCVIVLEPTGVYAIKPSQYFKERGVRVLQVS
FT                   PNVLSREKEFRGKKTDFYDAEKLENMVDKAKEYDYNPLKELVTLYLFLKDIETKYKNRL
FT                   KRALFLVSDNDKVSKNRLEKLAKGDFTQEELYQLGYTPLVLEEIKILAKNLLETQERLK
FT                   EVRRMIEGQVPQDHVLLTIPGVGRLAAGIVGDVKRFPKPESFVAYCGLDPVVERSGKAV
FT                   ISRGISKRGNKYLRSLFYFLAMRSYSRNPTLLKFYETHKDRLKGRKLYVALARKLARVV
FT                   WSVWYRPYEPK"
FT   gene            565543..565950
FT                   /locus_tag="LS215_0656"
FT   CDS_pept        565543..565950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0656"
FT                   /product="transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34739"
FT                   /db_xref="GOA:C3MLN0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN0"
FT                   /protein_id="ACP34739.1"
FT                   /translation="MRYRLDRGSHSVYALYYHYVQVVKYRRKVFDNEDIINFLKEQIQE
FT                   ISETFEVEVIDIGVDKDHFHMLFKAKPTLNIPRYINAIKTITSREIQRKFPQVKEKLWK
FT                   GHFWSPSYFLATSGQVTLEVLKKYVESQGKE"
FT   gene            565925..567163
FT                   /locus_tag="LS215_0657"
FT   CDS_pept        565925..567163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0657"
FT                   /product="transposase, IS605 OrfB family"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34740"
FT                   /db_xref="GOA:C3MMB7"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMB7"
FT                   /protein_id="ACP34740.1"
FT                   /translation="MWRAREKSNKIQLSFKYKVYPTREVEEKLLRVMQVEAKVYNALLD
FT                   AVNNARKEGKKITSKDTQNMLKELKIEGKELVYSKVLQMVNNQLWYNINSLHKLKKKGR
FT                   RVGKLRYKKIMKTINYNQSGFKVQGDKLFLSKIGEIKVLFHRPLEGEVKGVIIKKNVTG
FT                   WYAIFQVEVEKKPLEKTGKVVGIDLGVEKLVTTSDGVVVENPKVFDKVERRMKILQELL
FT                   SRKKKGSRNYEKVRKKLAKLHEHVKNLMNDYIHKVTSWLVEQYDEIYVEDLDVKEMVED
FT                   SESKVLRKHILHSNFSKFVSYLSYKAERAGRRVVKVDPRNTSKTCARCGHVKKDLTLTD
FT                   RVFVCPKCGWVADRDYNASLNILGAGSGLPLEPVDRKPLLYISFSEGVYSKFLERSRKS
FT                   SSRGGDAPSVRAG"
FT   gene            complement(567494..568348)
FT                   /locus_tag="LS215_0658"
FT   CDS_pept        complement(567494..568348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34741"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMB8"
FT                   /protein_id="ACP34741.1"
FT                   /translation="MNAKKPIILTIIVLISAFIVVLASTHPTTQESGSTTDTFHYSTLD
FT                   EIHTYNISPITNFISYYVNNTNATLALSLASQIIGNGTINFISFNNTVAIIGYFKASSP
FT                   LSSFAFTIINKTLVKHGFVYGQYNTLLYDYKNTSAFGFDGHYFYIVKDNASFNTTFFLL
FT                   KYLYTSQKIFASQPSINVIAYGNTTYGSFQLLSSNSQLILKSTGNFSSVTKLLKYFNIT
FT                   IGNFTVAGKVVFKNATVVVYSINATYDNRSLFVMIGINKQDNYSIVITSHQEISLAEVL
FT                   KEL"
FT   gene            568577..569470
FT                   /locus_tag="LS215_0659"
FT   CDS_pept        568577..569470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0659"
FT                   /product="ABC transporter related"
FT                   /EC_number="3.6.3.28"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34742"
FT                   /db_xref="GOA:C3MMB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMB9"
FT                   /protein_id="ACP34742.1"
FT                   /translation="MIVVSSIVKKYGNKIALDNVSLEVKKGEFVSLIGPNGAGKTTLIR
FT                   ILLTLMKPDKGEVQILGENPFRNKRIFKAIGYVQEIPNYPPFLTGRQVLELSAKIRGVD
FT                   KSEVKRVLEFVEMENYANSPIIKYSKGMVQRIAIAESLLGNPSILIMDEPNMGIDPIFS
FT                   LKTRELLNKLKRKDNVSILMTSHELEDVKKLSDRIFMIYKGKIVFSGTVEDMIKEFLGI
FT                   QVIVETDEIENAEEALKGIEYVKGVFNDGNRLIVKLNEDRREDLLRDLVTSGVKVKGFY
FT                   IDLNLEEAYMRALRNV"
FT   gene            569463..570296
FT                   /locus_tag="LS215_0660"
FT   CDS_pept        569463..570296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34743"
FT                   /db_xref="GOA:C3MMC0"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMC0"
FT                   /protein_id="ACP34743.1"
FT                   /translation="MFEIMLYEWRRAIARKKVIVLSIITFIFELGIYLAIYLAPSHSLK
FT                   TLIIPLSPYLWALGVLLPQVLLIHFLAISIASGSMAEEYEQGTVDYFISKPITRLRFVM
FT                   EKWLGSFSLLLIIYLFMVVLALILSSLLFGVQSELILLPELFFSIIFSTLVFLNIAFAI
FT                   GEILRRSNLSFTISGFILIASIIVSDVLVFVSVITHNSNYETISEYLPTWGSTELPFML
FT                   LHNSPFSAIARGLNILPSISNNVSLAIVSIVVYSLIPLVLSIINFLGRDISKKVS"
FT   gene            complement(570359..570499)
FT                   /pseudo
FT                   /locus_tag="LS215_0661"
FT   gene            570598..571138
FT                   /pseudo
FT                   /locus_tag="LS215_0662"
FT   gene            571144..571197
FT                   /pseudo
FT                   /locus_tag="LS215_0663"
FT   gene            571218..571391
FT                   /locus_tag="LS215_2976"
FT   CDS_pept        571218..571391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2976"
FT                   /product="tranposase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2976"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34744"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMC1"
FT                   /protein_id="ACP34744.1"
FT                   /translation="MFKVGLANLSDLAFSFDGFKLLADRASRKNILVKGVSSARLPVEG
FT                   SRLGKVRLQQRL"
FT   gene            571388..571654
FT                   /pseudo
FT                   /locus_tag="LS215_0664"
FT   gene            571782..572945
FT                   /locus_tag="LS215_0665"
FT   CDS_pept        571782..572945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0665"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34745"
FT                   /db_xref="GOA:C3MMC2"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMC2"
FT                   /protein_id="ACP34745.1"
FT                   /translation="MLFNTRPKEDRKDLYDREKEIEMIKDSIARGEWIAVLGMRRIGKT
FT                   SVVNVAVKEIGAIKVSINLMRIHDSRKKQYPKHVLISLLIEEINEAIKNYTILGKVAKL
FT                   LSNILGVEEIQTNKVRAKLTKIRGTDITYIIREMDSIARDNKKQLVIILDEAQELAKVN
FT                   GLDFPSIFHDVYDNCKNTVIIFTGSMVKLIEKTLKNIEYTEPFFGRYIRKITLGRFLPE
FT                   QSREFLEKGFEEEGIKVDESVIDEAVKRLDGIPGWLTLFGSEYTFSAKMGTKPRIDEII
FT                   EKAINEVRNEARNFIFSTQSPLRYSAVILALDRLGGKGELHEIVKVSSTILNENIPEPR
FT                   VYEILNRLVEFDFIERREDNEYYLHQDEPNRKGLILAAKDSPASYSI"
FT   gene            572980..574281
FT                   /locus_tag="LS215_0666"
FT   CDS_pept        572980..574281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0666"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34746"
FT                   /db_xref="GOA:C3MMC3"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MMC3"
FT                   /protein_id="ACP34746.1"
FT                   /translation="MGIIDEAKRGQITDEMRAISKLEGIPVEKVRNRISEGKIMLIRNA
FT                   KYPSRKLVPIGKGLTTKVNVNIGTSSEVVDLDMELQKVKVANKWGDTLMDLSTGGDLDA
FT                   IRRDIIKASDLPVGTVPVYQIFIESFKKKSGGAYFTEDELLNTVEKHLKDGVAFMTIHA
FT                   GITKDLAIRALKSDRIIPIVSRGGDMIAGWMIHNNSENPYRKNWDYVLEMFKEYDAVIS
FT                   LGDALRPGATGDAHDEFQIGELLETARLVKSALQKGVQVMVEGPGHVPLNEIAWDVKLM
FT                   KKLTGGVPYYVLGPLPIDVGAPYDHIASAIGAAISSASGVDLLCYLTPAEHLGLPTVKQ
FT                   VEEGAIAYRIAAHAGDVVKLGRKARKWDDEVSYYRGKLDWENMISKLIDPQRAYQVYTQ
FT                   FGTPKVKACTMCGGYCPMMWAMDQVRKIGSSSSL"
FT   gene            574324..575322
FT                   /locus_tag="LS215_0667"
FT   CDS_pept        574324..575322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0667"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34747"
FT                   /db_xref="GOA:C3MMC4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMC4"
FT                   /protein_id="ACP34747.1"
FT                   /translation="MDKTVLDASLEPLKGKTIAVIGYGNQGRVQANIMRENGLNVIIGN
FT                   VKDRYYDLAIKEGFEVYDIGEAVKKADVAFLLIPDEIMKEIYEKKIAPILEGKKEFVLD
FT                   FASGYNVAFGLIRPPKNVDTVMVAPRMVGEGIMDLHKQGKGYPVLLGVKQDASGKAWDY
FT                   AKAIAKGIGAIPGGIAVISSFEEEALLDLMSEHTWVPILFGAIKACFDVAVKEYGVSPE
FT                   AALLEFYASGELAEIARLIAEEGIFNQMVHHSTTSQYGTLTRMFKYYDLVKEIVKDEAK
FT                   YIWDGSFAKEWTLEQQAGYPVFYRLWELAVQSEMAKAEKELYKILRRKVSE"
FT   gene            575511..576519
FT                   /pseudo
FT                   /locus_tag="LS215_0668"
FT   gene            complement(576910..577017)
FT                   /pseudo
FT                   /locus_tag="LS215_0669"
FT   gene            577070..577876
FT                   /locus_tag="LS215_0670"
FT   CDS_pept        577070..577876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0670"
FT                   /product="protein of unknown function DUF1028"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34748"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR014927"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMC5"
FT                   /protein_id="ACP34748.1"
FT                   /translation="MTFSIVIYDPEEKAWGVGVASKFLAVGAFVPWLRPNVGAIATQAL
FT                   ANLTYGVNGLSLLEKGYSASDTIRVLTESDPLREKRQVGIVDTKGSAAAFTGKECYSYA
FT                   GHIVGNNFTVQGNILAGEEVLEAMAKEAESKGKIYEKILRALKAGESKGGDRRGKQSAA
FT                   IIVVKTVDKSEKEIDPLIVGKYVDLRVDDSQDPLKDLERLLDLWVATFIEEEMVNVKDY
FT                   ENQIRQALNKWGYNDLRTWVEMNNLEGKYTGDKIGKTVLKILLSKE"
FT   gene            578094..578273
FT                   /locus_tag="LS215_0671"
FT   CDS_pept        578094..578273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0671"
FT                   /product="permease, multidrug efflux"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34749"
FT                   /db_xref="GOA:C3MMC6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMC6"
FT                   /protein_id="ACP34749.1"
FT                   /translation="MQYKWIALSNTTIGVLVASINGTIILISLPAIFRDISINPFTSFQ
FT                   YLLWILTLMKYLGI"
FT   gene            complement(578340..580325)
FT                   /locus_tag="LS215_0672"
FT   CDS_pept        complement(578340..580325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0672"
FT                   /product="protein of unknown function DUF608"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34750"
FT                   /db_xref="GOA:C3MMC7"
FT                   /db_xref="InterPro:IPR006775"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024462"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMC7"
FT                   /protein_id="ACP34750.1"
FT                   /translation="MVKYTDKDRIVAGVPLGGIGTGKLEIDNKVRIINVTIRNNWGNPI
FT                   KLLRGFHVFIKPKDKRGFIFQKDGGIYKVSEFPGEIIYEGKYPVVKVVGKSNEVEVELE
FT                   AFSPIIPNDLKNSSLPAIGISLKVKGIKEGKVAISFPNIVGSVSIGRVNESIRNGVIHK
FT                   NLKANDYDPAKGNTTLISNNVSDIITQYNLKRKPSETMNFWLSQYENEEPWVKLNRGEE
FT                   IEDNPHEVTGHRDDPASIIISEGEEMRYVFAWYFNGKHVFYPYGHYYENFFKDSSEIAK
FT                   YFLDNFDHLRKDIFHNIVNVKEEWLRDAIINSSYILSSNTWLDENGRFAIYEAPQNCPY
FT                   LGTIGTCYEFGSLPVILMFPELEKLFLKLLISYVRNDGYVPHDLGFHSLDSPIDGTTSP
FT                   PKWKDMNPSLILLVYRYFKFTNDIDFLKEVYPTIVKVMDWELRQCRDGLPFMEGEMDNA
FT                   FDATIIKGHDSYTSSLFIASLIAMREIAKLVGDSNYVGFINEKLNVAREAFRKMFNGKY
FT                   FKAWDGVDKASFLAQLYGEWFTTLLELENIVDENMIKSALESIIRLNGNASPYCVPNLV
FT                   DENGKIVNLSVQTYSSWPRLVFAICWLAYKKGVGDLSFCKKEWDNLVRNGMVWDQPSRI
FT                   NCYTGKPEINYLDHYVGSPSLWSFLF"
FT   gene            580541..581593
FT                   /locus_tag="LS215_0673"
FT   CDS_pept        580541..581593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0673"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34751"
FT                   /db_xref="GOA:C3MMC8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMC8"
FT                   /protein_id="ACP34751.1"
FT                   /translation="MVTPSLPHQNNIQQIGYKLLSMLNFQGEKVDEVAKTLISACLWND
FT                   SVENKSRAYDVSPQTVRNYVEKQGMGVIEKLLERARKISLEVLKGVKEIDLSIDWTTKT
FT                   WYGKPVKGLGSSEKGNSWNYATATTKYKGKVLLLAFIPQVNGMTKEEIVKVLVEQVMAM
FT                   GFKIRLITLDAGFYTVDVLNFISQFKYIIAVPVGDVKVFEEFDGDYTTNSKRHRRDEQV
FT                   KFRLLVYSKEKVRRKKSLVYFARATNLDLPKREVLDLYNKVRGPIETSYRNIKAFLPFT
FT                   SSTKFVFRTLIFVLAIVLYSLYTIFKGEVGREEFRLLLILLFPDLFNPENFTFNVIETL
FT                   IYTIDLFLRR"
FT   gene            complement(581582..582835)
FT                   /locus_tag="LS215_0674"
FT   CDS_pept        complement(581582..582835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0674"
FT                   /product="transposase, IS605 OrfB family"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34752"
FT                   /db_xref="GOA:C3MMC9"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMC9"
FT                   /protein_id="ACP34752.1"
FT                   /translation="MWRAREKSNKIQLSFKYKVYPTREVEEKLLRVMQVEAKVYNALLD
FT                   AVNNARKEGKKITPKDTQNMLKELKIEGKELVYSKVLQMVNNQLWYNINSLHKLKKKGR
FT                   SVGKLRYKKIMKTINYNQSGFKVQGDKLFLSKIGEIKVLFHRPLEGEVKGVIIKKNVTG
FT                   WYAIFQVEVEKKPLEKTGKVVGIDLGVEKLVTTSDGVVVENPKVFDKVERRMKILQELL
FT                   SRKKKGSRNYEKVRKKLAKLHEHVKNLMNDYIHKVTSWLVEQYDEIYVEDLGVKEMVED
FT                   SESKVLRKHILHSNFSKFVSYLSYKAERAGRRVVKVDPRNTSKTCARCGHVKKDLTLTD
FT                   RVFVCPKCGWVADRDYNASLNILRAGSGLPLEPVDRKPLLYIPFSEGVYSKFLERSRKS
FT                   SSRGGDAPSVTVDPKSPP"
FT   gene            complement(582810..583217)
FT                   /locus_tag="LS215_0675"
FT   CDS_pept        complement(582810..583217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0675"
FT                   /product="transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34753"
FT                   /db_xref="GOA:C3MLN0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C3MLN0"
FT                   /protein_id="ACP34753.1"
FT                   /translation="MRYRLDRGSHSVYALYYHYVQVVKYRRKVFDNEDIINFLKEQIQE
FT                   ISETFEVEVIDIGVDKDHFHMLFKAKPTLNIPRYINAIKTITSREIQRKFPQVKEKLWK
FT                   GHFWSPSYFLATSGQVTLEVLKKYVESQGKE"
FT   gene            complement(583331..584335)
FT                   /locus_tag="LS215_0676"
FT   CDS_pept        complement(583331..584335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0676"
FT                   /product="endoglucanase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34754"
FT                   /db_xref="GOA:C3MMD1"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMD1"
FT                   /protein_id="ACP34754.1"
FT                   /translation="MIMNKLYIIIVPIIVIIVVGVIGGAIYLHHQSPNVKTSSITVTTN
FT                   ETTTLMSITTNTVPTTVTPTTSSIPQLIYVTSSASSPTPVYLNNSTVPSFYLEVNMWNA
FT                   KTWNGNYTMVFNPLTRTLSVSFNLTQVNPLQWTNGYPEIYVGRKPWDTSYAGNIFPMRI
FT                   GNMTPFMVSFYINLTKLDPSINFDIASDAWIVRPQIAFSPGTAPGNGDIEIMVWLFSQN
FT                   LQPAGQQVGEVVIPIYINHTLVNATFQVWKMKNVPWGGWEYIAFRPDGWKVTNGYVAYE
FT                   PNLFIKALNNFASYNITNYYLTDWEFGTEWGTMTSNGTAYFSWTISNFYETLL"
FT   gene            584750..585931
FT                   /locus_tag="LS215_0677"
FT   CDS_pept        584750..585931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0677"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34755"
FT                   /db_xref="GOA:C3MMD2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMD2"
FT                   /protein_id="ACP34755.1"
FT                   /translation="MDLVEKLKNDVKEIEDWIIQIRRKIHENPELSYKEYSTSKLVAET
FT                   LRKLGIEVEEGVGLPTAVVGKIRGNKPGKTVALRADMDALPVEETSDVEFKSKVKGVMH
FT                   ACGHDTHVAMLLGGAYLLVKNKDLISGEIRLIFQPAEEDGGLGGAKPMIEAGVMNGVDY
FT                   VFGIHISSSYPSGVFATRKGPIMATPDAFKIVVHGKGGHGSAPHETIDPIFISLQIANA
FT                   IYGITARQIDPVQPFVISITTIHSGTKDNIIPDDAEMQGTIRSLDENVRSKAKDYMRRI
FT                   VSSICGIYGATCEVKFMEDVYPITVNNPEVTDEVMKILSSISTVVETEPVLGAEDFSRF
FT                   LQKAPGTYFFLGTRNEKKGCIYPNHSSKFCVDEDVLKLGALAHALLAIKFSNK"
FT   gene            585961..586434
FT                   /locus_tag="LS215_0678"
FT   CDS_pept        585961..586434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34756"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMD3"
FT                   /protein_id="ACP34756.1"
FT                   /translation="MDKEKVLNILRNSSNLPLDLIRRLLSDKDKDIKHEAWNYVISNVR
FT                   DKDFLLELLSFHDTGTRYRAWNSVPEFVERGILTLEEVIKRKEHFLEMLKDSNKVVRAL
FT                   SWYVTLKPLLEMNVVSLGEVLSYSPFLCELINSEFHEVVEGVMQEFKITCKFI"
FT   gene            complement(586556..586876)
FT                   /locus_tag="LS215_2984"
FT   CDS_pept        complement(586556..586876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2984"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2984"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34757"
FT                   /db_xref="GOA:C3MMD4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMD4"
FT                   /protein_id="ACP34757.1"
FT                   /translation="MTRSASVLKILSNSSSVMGKSASNNKTLWKLLSLIPLFIAPPLPS
FT                   LLSLIRSFTGNFLTTSGVLSCPSNTTTISALGSVDDIFSNVLPILLSSLNAGMIIEINL
FT                   IS"
FT   gene            586569..587297
FT                   /locus_tag="LS215_0679"
FT   CDS_pept        586569..587297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0679"
FT                   /product="glycosyl transferase family 2"
FT                   /EC_number="2.4.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34758"
FT                   /db_xref="GOA:C3MMD5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMD5"
FT                   /protein_id="ACP34758.1"
FT                   /translation="MISIIIPAFNEERRIGRTLEKISSTLPNAEIVVVFDGHDNTPEVV
FT                   KKFPVKLLISESRLGKGGAIKRGINESNFQRVLLLDADFPITEEELDKILSTDADLVIP
FT                   KRKIVGMPLKRRFLHKAFIIITKILFPSLAKFSDFQAGVKLVNREKVLNILDELIINDF
FT                   LFDVNLIYGFKRRHYKVKEVEINYIHDESDSKISKKLIKVIILMFLSLIKLRVYYSPFR
FT                   KILYTKTYLKAQDYILRKLR"
FT   gene            complement(587280..587819)
FT                   /locus_tag="LS215_0680"
FT   CDS_pept        complement(587280..587819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34759"
FT                   /db_xref="GOA:C3MMD6"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMD6"
FT                   /protein_id="ACP34759.1"
FT                   /translation="MIVTKRTLILTISMLLNVLVALLPGYWWYYSAGGMVVIKDSLFSF
FT                   YLEFLGKELEIGIIINYILFAFRFYVISVSLYYIYLALKKDVINNYLLITWISYLYLLD
FT                   PLLFYLLFNYVVGYVTPTKYPLFIIGSQNMTVFYKNIMVTILVESYPTTYYWIALFAGT
FT                   FNLISRIIISRLSKLS"
FT   gene            complement(587816..588226)
FT                   /locus_tag="LS215_0681"
FT   CDS_pept        complement(587816..588226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34760"
FT                   /db_xref="GOA:C3MMD7"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMD7"
FT                   /protein_id="ACP34760.1"
FT                   /translation="MDLGKIIGLIVFISVLIVQFAMINNFNGLLQTALNQINSTILILF
FT                   TSQPKIGLVISNNQLILTFNNTLNFPITLLNVTGDYTYLSKPVTINPNEVKNISVVVTN
FT                   LEMFERAIHDNSYNLTIVMKMFNTTFSQSEMI"
FT   gene            complement(588250..589374)
FT                   /locus_tag="LS215_0682"
FT   CDS_pept        complement(588250..589374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0682"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34761"
FT                   /db_xref="GOA:C3MMD8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMD8"
FT                   /protein_id="ACP34761.1"
FT                   /translation="MLRNIIVSWIGTFLQLFLRLSWGVISLPIALVFHLNSIQIGLVAT
FT                   VFYIGYVVSSIPWGLVIDRIGPSSAVEYASILLIGMNLLLFLFLTSYAILLVAYLIEGL
FT                   ITAAIFPSAMKIVAVSYSNSPKFTFYVALVESAGPITIITLGIIASFLLHLWRFIYLIM
FT                   AISFGLIAIFSHFNRIDVNRTEIKRSFKIILDRKITIATIVRLGELWSTWGTTTWIFPM
FT                   LVLYRNISPTLSGIFLLLFGVGQLVGILSVERLVERFGDRTVILINLIGFILLTFSIIF
FT                   SNNIDILPEAFLLGIFSFSYRPPTDSLIMRIAGQSSAGTSIGYANAVSQIGTMIAPSFV
FT                   GLALYLTHSFSISMLALDVGCIISIISLLSLKHL"
FT   gene            589471..589947
FT                   /locus_tag="LS215_0683"
FT   CDS_pept        589471..589947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0683"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34762"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMD9"
FT                   /protein_id="ACP34762.1"
FT                   /translation="MPRELTPIEQLQLLLPGYRGYKAKDLIRQDDFLVRRAVIDRLEQT
FT                   IRIISEKESFIASTDPFSPQLKVMEFLISKIRELINNIMSSQGGGADIYARWKVTTEEL
FT                   DQIVNHDMKMIDIASQLVELAKNNRIEEFEPLLNDLRAVFYDRMKLFYPPELRK"
FT   gene            589991..590857
FT                   /locus_tag="LS215_0684"
FT   CDS_pept        589991..590857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0684"
FT                   /product="band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34763"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C3MME0"
FT                   /protein_id="ACP34763.1"
FT                   /translation="MSLTIRGQVISTEKEDGSSFMTADAIIFKYPKEAITSKSFIIVQP
FT                   TERAIVLIQGQIVADLPPGSHNIQTPGNPVSAFLSKFRYNTLPYDTIVYFISTTRHEVR
FT                   VAGVSQTDDLVPLEYETAIYFRVQNPAALVTNVQFGSLYFKDADLAHYISPIVDQEVSS
FT                   VLNRVNLTDVFKKFSEISTAVTAALKQFLAEIGVDLISVRITRLLPQDPELRRIIQLRD
FT                   MGIPLMDAVRMGLARILAEQQNAAAVNMAIGVPYYPNLSTIVNLPDGLIRVGIGRRGQQ
FT                   QSGGAQQ"
FT   gene            590838..591254
FT                   /locus_tag="LS215_0685"
FT   CDS_pept        590838..591254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0685"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34764"
FT                   /db_xref="GOA:C3MME1"
FT                   /db_xref="UniProtKB/TrEMBL:C3MME1"
FT                   /protein_id="ACP34764.1"
FT                   /translation="MVEHNSRILGYNIATSIGYSFILTIIMAIVSLIVKAFYPPSTFDI
FT                   SPIEAMIHSPAEGIVQILILVILVAFVFPTRTTLEKSSLIQVRKIALITASSYLVFSLL
FT                   PYAFQVSYPQTYLGLTIAYNLLNGTFAGFISTIV"
FT   gene            591368..591580
FT                   /pseudo
FT                   /locus_tag="LS215_0686"
FT   gene            complement(591649..592422)
FT                   /locus_tag="LS215_0687"
FT   CDS_pept        complement(591649..592422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0687"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34765"
FT                   /db_xref="GOA:C3MME2"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:C3MME2"
FT                   /protein_id="ACP34765.1"
FT                   /translation="MISFILVAPHGDEIIDPKDEKSSLLNKAMREAASLVKADKYIVIT
FT                   PHNIRIDDHMAVILTQYAEGKRGKIKRKYLCDRGLAYEIYERAKGSGLPVVGVNFGALE
FT                   GKESKIALDWGSSIPLYFLKRRRIVLLTPARGVKREILRKFGVVIGEVLRDHRKRVGVI
FT                   VSADHAHTHDPKGPYGYSEYAAVYDSTIVDIFKSERFEDLMKIDDKVISEAKPDSYWQL
FT                   LIMLGILESSYNKYSVKLMEYQVPSYFGMMVALLS"
FT   gene            complement(592684..593925)
FT                   /locus_tag="LS215_0688"
FT   CDS_pept        complement(592684..593925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0688"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34766"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C3MME3"
FT                   /protein_id="ACP34766.1"
FT                   /translation="MNVEEAKRIVADQKELVEEKLSMNYIKREVGDISRFLVIPNVLAI
FT                   LGVRRSGKSTLSLMLMKELNVKFAYLNFDDESLYGLTTKDLKSIEQAIYEVYGNDVNYL
FT                   VFDEIHNIKGWELFVSRLRETKRIITTGSNSRMLSGELATSLTGRHSDFILFPFYFREY
FT                   LRFKKVSEEVPMSTRRIAEVKVELEKYMEVGGFPEALIIGKDQIDVIYNDILFKDVVFR
FT                   YKIRELEKFKDFSKSLISYYSTEVSLSKLAKVIGVDRKTIDLWSFGLENAYLIYFLPRY
FT                   GEKPRERLTFNKKVYVVDPGIISRVALRAKDRGRVMENLVALKLFRDNQLKGLYYVKGK
FT                   DFEVDFYDEVNSRLLQVTYASDKIEEREIRSLLKAEEMLRAKELIMITYDIEGEEEREG
FT                   KKIKLIPLYKFLLT"
FT   gene            594089..594241
FT                   /pseudo
FT                   /locus_tag="LS215_0689"
FT   gene            complement(594622..595787)
FT                   /pseudo
FT                   /locus_tag="LS215_0690"
FT   gene            596096..596677
FT                   /locus_tag="LS215_0691"
FT   CDS_pept        596096..596677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0691"
FT                   /product="Ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34767"
FT                   /db_xref="GOA:C3MME4"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="InterPro:IPR033921"
FT                   /db_xref="UniProtKB/TrEMBL:C3MME4"
FT                   /protein_id="ACP34767.1"
FT                   /translation="MQDKPKEEPKVVGVEVLEKSGLDVKKLIEKLVKATAAEFTTYYYY
FT                   TILRMHLTDMEGEGLKEIAEDARLEDRLHFELMTQRIYELGGNLPRDIRQLADLSACAD
FT                   AYLPENWKDPKEILKVLLEAEQCAIRTWKEVCDMTYGKDPRTYDLAQRILQEEIEHEAW
FT                   FLELLYGRPSGHFRRSYPGKGPFSRKSGYE"
FT   gene            596708..597046
FT                   /locus_tag="LS215_0692"
FT   CDS_pept        596708..597046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0692"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34768"
FT                   /db_xref="GOA:C3MME5"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C3MME5"
FT                   /protein_id="ACP34768.1"
FT                   /translation="MLIRVCKISDLIDNKPMKFSVSKFEIVLIKIRDEVFTIEAYCPHK
FT                   GANIEYGDVIAKEYRIRCHLHGYEFNLKDVRLVFKPYNRDGNWYYSNNLRVYKVKIIND
FT                   DIFIDIDK"
FT   gene            complement(597072..597608)
FT                   /locus_tag="LS215_0693"
FT   CDS_pept        complement(597072..597608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0693"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34769"
FT                   /db_xref="InterPro:IPR019092"
FT                   /db_xref="UniProtKB/TrEMBL:C3MME6"
FT                   /protein_id="ACP34769.1"
FT                   /translation="MAKLVATLGTSPGGVLETFLYLIRQGVEIDEIRVITTTNPEVEKA
FT                   WKIVKIMFICCVKEKYPNVIISKHPVEMDDINNEEDLIKFKNFIEKHIGEGDYVDITGG
FT                   RKGMSVAAALAAKKKGAKIITSIISQDSYREINNRIRELKNIPELQDRAQCVEEIKNTY
FT                   CNLISDKANTILFDI"
FT   gene            598107..598331
FT                   /locus_tag="LS215_0694"
FT   CDS_pept        598107..598331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0694"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34770"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:C3MME7"
FT                   /protein_id="ACP34770.1"
FT                   /translation="MSDVISVRVKKELKKRAEELGINIREVVEKALKEAIREKEKEELK
FT                   DIVMRIKELMRDVSEDDWVRAVRESRDER"
FT   gene            598321..598713
FT                   /locus_tag="LS215_0695"
FT   CDS_pept        598321..598713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0695"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34771"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3MME8"
FT                   /protein_id="ACP34771.1"
FT                   /translation="MKDKEFLFDASALYSLLDYVDKIDLKKIHILTLTFYEVGNVIWKE
FT                   YYIHKKVKDPITLSMLFHKLMRKLNVVEDPPLEGVMRIAVERGLTYYDASYAYVAESLG
FT                   LILVSNDKELIRKTNAISLKEFIKFI"
FT   gene            599648..599920
FT                   /locus_tag="LS215_0696"
FT   CDS_pept        599648..599920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0696"
FT                   /product="transposase ISC1190"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34772"
FT                   /db_xref="GOA:C3MME9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:C3MME9"
FT                   /protein_id="ACP34772.1"
FT                   /translation="MEAPVAGIDVLKDKLNVYFQGKLYEFTNDRQGFEEIRKILPKGCK
FT                   VGIESTGVYHINLAKYLNNEYDVRIINPFMLKKFKDFRGKKSDKN"
FT   gene            complement(600022..600357)
FT                   /pseudo
FT                   /locus_tag="LS215_0697"
FT   gene            complement(600661..600987)
FT                   /locus_tag="LS215_0698"
FT   CDS_pept        complement(600661..600987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0698"
FT                   /product="zinc finger C2H2-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34773"
FT                   /db_xref="GOA:C3MMF0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMF0"
FT                   /protein_id="ACP34773.1"
FT                   /translation="MGYRCPLCKGLFNSFHSLKIHIIKSHVHKVCQLCGKETKNLTMHY
FT                   RMMAKNDFLHLIVSCIVTECTYIDDGEIRRLVINLVKVILDESIPLDIISKKANQTENI
FT                   KALD"
FT   gene            complement(600977..601615)
FT                   /locus_tag="LS215_0699"
FT   CDS_pept        complement(600977..601615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0699"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34774"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMF1"
FT                   /protein_id="ACP34774.1"
FT                   /translation="MGKSLVTSTKVTISPLKKGRSYLIKYSTIPHFMEVEGGNIYSFEV
FT                   GGNYDDVIYALRDLDKKRIFNTTWEIVDVRLKEVKFNYKGRIRVSIRTPALIADPLIKS
FT                   KKKRFTNAFSFVFAVNFMDHLKITREEYRKLILELEEKVREEPSEIGYASVIYAGKKII
FT                   GIVGKLRYELLEVDERIIGTLENALAKGIGSSRRNGFGRIEVKCEDYGI"
FT   gene            complement(601694..602335)
FT                   /locus_tag="LS215_0700"
FT   CDS_pept        complement(601694..602335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34775"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMF2"
FT                   /protein_id="ACP34775.1"
FT                   /translation="MSLYPNYESPIFSHYVSIIRESTIKVSNSATYYAEKVWVKSKHPL
FT                   NCLYEKFLPECRSIKFNSNFSWSAENAILDILERNGYRGLKRNQKIIYKGTPYHPDAVI
FT                   INQPSSNKPNYLIEVKSSRVKNWNAHRCLIMRGALQSLRNASVFVKAGIVNEILPKLVV
FT                   ATYIPVDKIQPEEKQIRIILKHVNIYKVGWKEIFKVDEQLADEIYSIIGG"
FT   gene            603078..603266
FT                   /pseudo
FT                   /locus_tag="LS215_0701"
FT   gene            603361..603678
FT                   /pseudo
FT                   /locus_tag="LS215_0702"
FT   gene            603703..603990
FT                   /locus_tag="LS215_0703"
FT   CDS_pept        603703..603990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34776"
FT                   /db_xref="GOA:C3MMF3"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMF3"
FT                   /protein_id="ACP34776.1"
FT                   /translation="MSWKDLKSWFNTYHNPELDQVEDEFYYLVSQGTGYWVKLFSDELK
FT                   EGVVMEKFLSILKYYLLTSLNKIILLIIQPFLNVFLYFVSIKFITPLQLL"
FT   gene            604120..604530
FT                   /locus_tag="LS215_0704"
FT   CDS_pept        604120..604530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0704"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34777"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMF4"
FT                   /protein_id="ACP34777.1"
FT                   /translation="MTQVIKTDTDLLDIATRIAISALTPVQKGREQEPAVDSNTINNLL
FT                   AYMQSRKSIKELLAYILRQTSRGEIDRNTSKLLLSALKDLKENEEDINKALELLGYVKW
FT                   IYETLNGLKIDITQLKGVDNFQKLVNELVKRM"
FT   gene            604532..605257
FT                   /locus_tag="LS215_0705"
FT   CDS_pept        604532..605257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0705"
FT                   /product="CRISPR-associated RAMP protein, SSO1426 family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34778"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013411"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMF5"
FT                   /protein_id="ACP34778.1"
FT                   /translation="MSNEKPCYDLDIIKSIIKITGKIKNETPLRIGYGKSQSFTDATDN
FT                   PILKVNGRPVIPGSSLKGALRSLAEAYVKSWNDSKYIVCDLDDNNCSSCINEKYCIPCI
FT                   IFGFKDLSSSVYILDAIAEEYSISQRTMVTINRVFGGQLPGHLYTLDYVEPNSIFKFSM
FT                   FLYNINIVDEETEEWRKKTVEVVRYLLKTLITDGIFIGAKKSAGFGLIKLISGEIEIRK
FT                   LPDLMKPIKLNLMEVVKSW"
FT   gene            605251..606087
FT                   /locus_tag="LS215_0706"
FT   CDS_pept        605251..606087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0706"
FT                   /product="CRISPR-associated RAMP protein, SSO1426 family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34779"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013411"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMF6"
FT                   /protein_id="ACP34779.1"
FT                   /translation="MVDYTFIRKDIIKRQTVIEGILELQSPLRIGVGKSGGMDPASIAR
FT                   DTVLKDTGGTPIIPGSSWKGVFRSEGERILRRKNLIVCSGVGKDYCLNNFRKYDDFQRN
FT                   LTRDIDEAIRIFWNYTCLNCKLFGSMSVIGAVKFLDSKAIEFKLGTRTMIAISRTEGAV
FT                   ARGALVQVEFVEPGSKFTFKIMGNNLPNYAIGYLLTIMKNIHDGFIQIGGHKSRGFGFI
FT                   RFVNLRFSDKGEKKIGDEDVSVSTQDEIKEEGDKFFEKMKPFMEAFNNAKIPYPVH"
FT   gene            606059..606859
FT                   /locus_tag="LS215_0707"
FT   CDS_pept        606059..606859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0707"
FT                   /product="protein of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34780"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMF7"
FT                   /protein_id="ACP34780.1"
FT                   /translation="MQRSHTQYTERNSLGLEGILELEMEVVSDYLHIGSGVYDIEIIKP
FT                   LENIDQLVESALKGSIPNLNNYFSPVTHEMNKYLDKVIIPGSTIKGLVRTRLELSIRDA
FT                   CFIISRNANSSSSTYRRIFNNPRPRPTDRFPQRVCPVCDLLGNSGLASKVSFSDFVMTQ
FT                   GKIEYVNVNGQYYESSVKGSKFKGKVVYRSLKTIELGMLLYGFGLRVKDRKLEGKVMLI
FT                   GRFKYSDRRFGRIRFSLLSPKQDYINALEDFMRTFRPFDYNEEW"
FT   gene            607049..609718
FT                   /locus_tag="LS215_0708"
FT   CDS_pept        607049..609718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0708"
FT                   /product="metal dependent phophohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34781"
FT                   /db_xref="GOA:C3MMF8"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMF8"
FT                   /protein_id="ACP34781.1"
FT                   /translation="MTLRGKLNLPEFRVVFDGEDGKVYEGNKDLKEKIVDTLAHMAQIS
FT                   CEIAKGNEKKAMDIYADIVSMLYKLPMFVSYAPIAEETKVNKVNYIPTAFEYFFIYTVA
FT                   RHVMDITIDKNTSLEDVFKKLESFEHIDMLRSLIRSYFLSIREIYEALINTPADTRPGF
FT                   NFTSLASHLQLTSLISWLLQPYSIDLSYLRVASLLHDIGKLIDPRHHVTEAINILRKLE
FT                   NALESGGACIKLERVKELIASHHGDYENIVQKADRLASSADRLTELVNKALDTIEYGKE
FT                   VKECFNKEHEQSYDCFTNLGKEKYEKVSKDIYKFILSQVVSEEVIKNEGAKVFPFIPEK
FT                   VEKGVKEIQPGRLLGYLVYIDVPGIQNFITNFSKLRDMSFASMLVDFLVTVYSFVLLDT
FT                   EFSSRVKSRLPAEALLSGYGGHSYIVIRKDICNSDKCYEEIKDLFRGIKLLSNLDLKLQ
FT                   VSIAEFAYDNYIKNYNEVWDEIKDQFSERHLVDFDEEIYSIGLHMVCDNCGIRPASVFA
FT                   KDFGEYLCKRCYEVRRLSSTRGFISKVKLTYLLPAGEVPLKITPEKSAKKIFGENYTEY
FT                   AMEFIAGYKGLEDTRYVTIIKADGNRGGIIFSASVTFSDYIDKSFRLDYGVKKAFYETL
FT                   TELANAEREFLKSDDDLPLTSRILSGVLYLGGDDITILAPSIIAIPFAVKFFEKATQFT
FT                   GFTFKVGIVSVKPDHPIQFAFQASDELMERSKIKPERDSKNAIEYNKTSIACMVFSSTL
FT                   ASKSVIHSEISKYKKPNNSYLVVANDIKKVKELLELVNLYEFKDVVSLYNSENDKKEIR
FT                   EKLRQLEDIVSYAETNLDKSNGYLRTLAYILRKIAKSDRAYDKEILKKLVEKKEGSLKE
FT                   IPLYDYYFILKTFKVGVG"
FT   gene            609718..610326
FT                   /locus_tag="LS215_0709"
FT   CDS_pept        609718..610326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0709"
FT                   /product="protein of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34782"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR017005"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMF9"
FT                   /protein_id="ACP34782.1"
FT                   /translation="MEFKVYIKNLTFLTVGGGSSIGVVDIPLNPMILPPSTIKGVLRTA
FT                   IHNYLPEGYTSCGKIEPSKIKEAHEKSSVCDVCKLFGYPDYKDSGCFTITVSVPDIKRY
FT                   RITRVKIDDSTQKSEEGHLFTQEVIAPNTEFEVNIYFRDSCGDRMLKLLLYSLLALRFC
FT                   RIGRNAMVDVKLKGDICQRVKCDADMKSIVFSLSNYIWR"
FT   gene            610332..611276
FT                   /locus_tag="LS215_0710"
FT   CDS_pept        610332..611276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34783"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMG0"
FT                   /protein_id="ACP34783.1"
FT                   /translation="MKFTLLKLTVNGYITTRTRKIGNYYFSVTDYIPATQLRGALLAEY
FT                   YYQTRKIDQSFFSSPAFPIDSAPAHYFSPAEGRKSREFVEEKGILRRKSEELEKQGKTL
FT                   REVLKLKGEKKPKIGAIIKRKESNKDETRYSHFNSESFISMHVTIEKTLASSYHRMLYA
FT                   YEYKRFDTLWAIAKPSEVIDVIKGNKIRLGRGKNRTNALIIVDVISEIDLPEPHGLSYC
FT                   LSQCIPSLFGKQLFTVGKADGRSIIIGSTSIYAGWFTNDKISGQKPSFRTLSEGTLVFV
FT                   KDKGSYSEVFPAGLNFMLGIDDLDSLLQKVSVK"
FT   gene            611273..611968
FT                   /locus_tag="LS215_0711"
FT   CDS_pept        611273..611968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0711"
FT                   /product="protein of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34784"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMG1"
FT                   /protein_id="ACP34784.1"
FT                   /translation="MKKVYLFKLKFNTPHGLRVGGPKEDINTLTPLQIDQYYIIPSSSW
FT                   KGIFRRATEVLIANPNHFKGHENEDVVDDGSLDELLEAKGLENKNDENIKKERKRFIAM
FT                   WNCPVERLYGSEYFASAVTFSDTLIDAEINERTHVVIERKTRRSKEKHLFKEQIVNVNN
FT                   VKVNAIVRDRIEDWIKTLKFLSEVGTFIGGGKSRGIGYAILDWKESEYAEVDELTKKVV
FT                   FKPLEEFKI"
FT   sig_peptide     611273..611329
FT                   /locus_tag="LS215_0711"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.568 at
FT                   residue 19"
FT   gene            complement(612307..613240)
FT                   /pseudo
FT                   /locus_tag="LS215_0712"
FT   gene            complement(613237..613545)
FT                   /locus_tag="LS215_0713"
FT   CDS_pept        complement(613237..613545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0713"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34785"
FT                   /db_xref="GOA:C3MMG2"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMG2"
FT                   /protein_id="ACP34785.1"
FT                   /translation="MVWKDLKRWVNTYYYSCYTLEFIEDEFYYLVSKGNYTRYWINKFH
FT                   DVLEDLEEGISMGKFFSYLIYYLLTSFIKFYLTIIQAFLNVFLYFVLREVKSLLQLL"
FT   gene            complement(613551..613910)
FT                   /locus_tag="LS215_0714"
FT   CDS_pept        complement(613551..613910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0714"
FT                   /product="ORF2 in transposon ISC1395"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34786"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMG3"
FT                   /protein_id="ACP34786.1"
FT                   /translation="MKGVIKKGVKVFFMDESGISHDPSRVRRLGLYVVRADYPGVKVNI
FT                   LACIPLFDGKPCFMLIYSNVDSRVFVNFLYLLRVRNSGNVVLILDNAKFHKSSYVLATA
FT                   SRLNITLLFLPPYSP"
FT   gene            complement(614037..614292)
FT                   /pseudo
FT                   /locus_tag="LS215_0715"
FT   gene            614825..615724
FT                   /pseudo
FT                   /locus_tag="LS215_0716"
FT                   /note="CRISPR-associated protein cas1"
FT   gene            615725..616012
FT                   /locus_tag="LS215_0717"
FT   CDS_pept        615725..616012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0717"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34787"
FT                   /db_xref="GOA:C3MMG4"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMG4"
FT                   /protein_id="ACP34787.1"
FT                   /translation="MLYVVFYDITDNELRNKVADFLKKKGMRRVQLSVFVGELNSSRLK
FT                   DVEAGLRLIYRKSKPGDRFMILILPVTDTLFKQRIVIGGEYREEESNVIW"
FT   gene            complement(616978..618294)
FT                   /locus_tag="LS215_0718"
FT   CDS_pept        complement(616978..618294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0718"
FT                   /product="CRISPR-associated protein DxTHG motif"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34788"
FT                   /db_xref="InterPro:IPR013383"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="InterPro:IPR027419"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMG5"
FT                   /protein_id="ACP34788.1"
FT                   /translation="MFLYIIINYHFSVAHLRLFNYLLIFNIMVYIATWGDPLGWSIAEY
FT                   NSDQGKIRCWTTLPLSKDRSILIVFYSAIFAKPREGNVLYSFCHEAKEALSKANERVKK
FT                   GDYIRDVVRDYFYDLLKCLNNCDKLVSNVEVIPIPNLGKVGGVSFEITAEAMRGLLYAE
FT                   LYKRLKGENEIVGENEIVLDITHGINYLTAITLNVLQQLSALLGAKLRVTNAVPITQTE
FT                   FEIETVAKFNKDSFNLQDLKNTGVINSIKLNAPLPLIYLCRRNRRKFEIPEVKFIREDT
FT                   KSQGILFSLKDKRVLRELEESVILSRIVEDYVCDRINTYDDPFKVKKLHEITKLFERFY
FT                   SISKSLIINELNNITNKKKSGMVYEILAQPREDCNSMMKSIDQTRRNFIAHGGFLKEFT
FT                   YYDNEMDSIYYKINDECYGNVLNKILRFNIYELIKENKK"
FT   gene            618826..619029
FT                   /pseudo
FT                   /locus_tag="LS215_0719"
FT   repeat_region   complement(619238..627117)
FT                   /rpt_unit_range=627093..627116
FT                   /note="CRISPRs"
FT   gene            627470..628321
FT                   /locus_tag="LS215_0720"
FT   CDS_pept        627470..628321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0720"
FT                   /product="CRISPR-associated protein, Csa1 family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34789"
FT                   /db_xref="InterPro:IPR009260"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMU9"
FT                   /protein_id="ACP34789.1"
FT                   /translation="MYNVRSQIIRQVRRLHSYRASDPIEEELRGWNYHMAPIKPRRYLG
FT                   LSMSDVAYRYCDTKRDVYLRRVLKVQGEQRSALVLGQSVHEVLASVSNEIVKLLSLGYK
FT                   PWAAIEAIFRKVKKVSNLCPQQFFKFCEEVYKAFALDLISDFSDSTSFLPIISEFRVDG
FT                   TPLGLSSRLSVDAITQLSLVVEIKVASTQEFHKLALAGYALALESALELPIDFGSLIYV
FT                   NGINKNVPEFKYEVYYISPDLRKEFIDARDEVIDMVSEGRDPGMPTACSPSCPFLNYCN
FT                   KR"
FT   gene            628364..629236
FT                   /locus_tag="LS215_0721"
FT   CDS_pept        628364..629236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0721"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34790"
FT                   /db_xref="GOA:C3MMV0"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMV0"
FT                   /protein_id="ACP34790.1"
FT                   /translation="MSVKKGMFVIKKGDNKVEVSPSEVDEILVLSSSLISTKALMVALS
FT                   HGIGVIFLDSRENPWGMLLPSVVTETVKTKRAQYEAVLNNDTRYGEEIIKCKIFNQHVH
FT                   LKYWTRSGIRTDYKELIGRDEPTAARIYWQNIAFLLPKDIHFDGRDTDSADQFNMALNY
FT                   SYAILYNRIFKYLVIAGLDPYLGFVHKDRPGSESLVYDFSEMFKPYIDFILVRAFREGF
FT                   RLKIKDGLIDRESRSLLARIVVKGMDDKVKEENDHNPKTLVQAIRAHTVKLASSVREKR
FT                   PYNGFKLVL"
FT   gene            629353..629622
FT                   /locus_tag="LS215_0722"
FT   CDS_pept        629353..629622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0722"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34791"
FT                   /db_xref="GOA:C3MMV1"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMV1"
FT                   /protein_id="ACP34791.1"
FT                   /translation="MKIVVVYDISDNGKRNKLANELKKFGLYRIQKSAFEGDIDTQRVK
FT                   NLIRVINDIVDIKTDIVHIIPLGIRDWERRIVIGKEGVVGEWLA"
FT   gene            629610..630137
FT                   /locus_tag="LS215_0723"
FT   CDS_pept        629610..630137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0723"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34792"
FT                   /db_xref="GOA:C3MMV2"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMV2"
FT                   /protein_id="ACP34792.1"
FT                   /translation="MVSVTDLKDFALCPVIPWIRKKLGWREPITEGQRIAKNIKPRELA
FT                   NDLPDPKYYEVYMRDKSTGLSGIIDVLAKDIVAEIKAFNRRFYGHFKIQLLSYAYLAER
FT                   NGFRVKDAILILGREKRVKIEVRKEHMEYVEKITNKLVESLEEDSPPVANPSPKLCEAC
FT                   QYRRVCPLSVIL"
FT   gene            complement(630209..630901)
FT                   /locus_tag="LS215_0724"
FT   CDS_pept        complement(630209..630901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0724"
FT                   /product="CRISPR locus-related DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34793"
FT                   /db_xref="GOA:C3MMV3"
FT                   /db_xref="InterPro:IPR010163"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMV3"
FT                   /protein_id="ACP34793.1"
FT                   /translation="MILPYIMMKSYFVTLGFNETYLLRLLNETSAQKEDKLLIVVPSPI
FT                   VEGTRAAIENLKIQTLRLRYPSPEIIEIKISTFDDILSQLLDNLLPLQEPIISDLTMGM
FT                   RLMNTLILIAILVSRKKFTIYLRDENGGSRVVSFTSSDINALSKEYSSEEFKMLYSIFR
FT                   NNTISTFELSKILGKSEKTIQNKISELKKLGILTQKGKDRTVELTSLGLNVIKLIKNSK
FT                   LYIENKIQ"
FT   repeat_region   complement(631174..637796)
FT                   /rpt_unit_range=631174..631197
FT                   /note="CRISPRs"
FT   gene            638556..639167
FT                   /locus_tag="LS215_0725"
FT   CDS_pept        638556..639167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0725"
FT                   /product="CRISPR locus-related DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34794"
FT                   /db_xref="GOA:C3MMV4"
FT                   /db_xref="InterPro:IPR010163"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMV4"
FT                   /protein_id="ACP34794.1"
FT                   /translation="MILVLTLGFDEKFQYRALMRQGKSIEKVIIVGGFEEEKAKKALES
FT                   LTDFLKTVNVPYETIEVDPRDFKNIVEKVGKLILTNAGKDFMVNLSGGMRLMILAVFSA
FT                   FLLTGIEATVEIETEDLTKVYYFRVSDVTLPFLSLTKDHLTILKAIKDGYSSANVISKS
FT                   TEIPLTTTWRRLNELRKEKLIDETNKLTTKGELLLKIYGS"
FT   gene            639246..639677
FT                   /locus_tag="LS215_0726"
FT   CDS_pept        639246..639677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0726"
FT                   /product="CRISPR-associated protein, Csa5 family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34795"
FT                   /db_xref="InterPro:IPR010157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMV5"
FT                   /protein_id="ACP34795.1"
FT                   /translation="MAQQVKEEKEGIIVRVANLLAVGFLYSESPTLVDRFANALSKEAV
FT                   TKVLYDVQRIVQMGIDRGEIVSTTTMIQGKEYPAVNVSSSEGKYTVVGYLPTNQDIEYF
FT                   LRMIEEDVYYARKAGALAMSIANRTKLVSKSEQGGGEKK"
FT   gene            639674..640639
FT                   /locus_tag="LS215_0727"
FT   CDS_pept        639674..640639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0727"
FT                   /product="CRISPR-associated regulatory protein, Csa2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34796"
FT                   /db_xref="InterPro:IPR002764"
FT                   /db_xref="InterPro:IPR010154"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMV6"
FT                   /protein_id="ACP34796.1"
FT                   /translation="MIGGSGRFLVNLESLNGVESIGNLTKHRTAPVVLKTSTGYLVRYV
FT                   PVISGEALAHAYQASLVDIAKKEGLPVGNLSSQYEFIKFSTDEALKIEGIKEPKDYNDA
FT                   RRFEVEVMLKDVIADVGGFMYAGSAPVRRTSRIKLGYMIPALRGDEIPAQLEAQFHVRF
FT                   SNKPVKGSQAIFNVEVSSALYTFSFELDEDLIAVPSTVGEKVKDEEELERQKARRVDSA
FT                   IKALYSLLAGNFGGKRSRFLPSMKLMSLVVVKTDFPFIPEPGHDDSYIKTTVMRLEKAK
FT                   SVLNGNVAKVYVINNEGIEVGEGATVLSSVEDLVATLKEK"
FT   gene            640655..641377
FT                   /locus_tag="LS215_0728"
FT   CDS_pept        640655..641377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0728"
FT                   /product="CRISPR-associated protein Cas5 family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34797"
FT                   /db_xref="InterPro:IPR010153"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMV7"
FT                   /protein_id="ACP34797.1"
FT                   /translation="MIYSKVFLKLHWGFSVVKPSAAKAKSGFYLPPPTTLIGALSYGKF
FT                   RGIDNTNLGKIYGSPAYNFRNVMATARLESEGAYTEDIVRNVISYFQRKDRRDNPRYIY
FT                   GVIPTGKVYMPNGTLVVVYVTDSMSKEELEKLSWSITRIGGKECLVSVENVEIGEAKKV
FT                   SGRMKTRYYFRDTVKVVGKKEFLEYVTFWEENGYIWGKEGGPIRYILPVATYPLASKEV
FT                   EVEAKEAYEVGGEYVVFS"
FT   gene            641361..642866
FT                   /locus_tag="LS215_0729"
FT   CDS_pept        641361..642866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0729"
FT                   /product="CRISPR-associated helicase Cas3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34798"
FT                   /db_xref="GOA:C3MMV8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMV8"
FT                   /protein_id="ACP34798.1"
FT                   /translation="MLSLADFYNDFITRHGFEERKGIEETLLNLEKGHSVILKAPTGYG
FT                   KTTLTMILANAVSSDIDLGSRVIHVLPYRAIVQDLYLKLKNYADKGVISTKNIGAQDMD
FT                   YQDSPFFMKKVNVTTLDTFILNLFKLPTIDFKLIFKNHGSHYEFPRALIYSSIVIFDEF
FT                   HLLGEDGKSLGAGLAALEVLKDAGVPIVVTSATIDKGLERVLMNKLGKNVKVVNADDFK
FT                   IDRKVYVNVLENDEISITEEKVKEGKRVLLVYNTRMGAIEAYKKLKGMGLSPILIHSKF
FT                   SKKDRIDKVNKINEAKLVVSTQVIEAGIDTSFDVLITEASPSHNLIQRAGRVARYGKGG
FT                   RGKLEGEVYIFPFSGKVYDEREVKETVERIRELKTIDENLLIERNYTEVIDSILAKDLS
FT                   VIDNSVFVDSKKMKSMYEEICSITRNASIILGFPPNSNDVNDAIPLTEKEAIEIIENKG
FT                   SSAFVGNGNVKLYNKKCLQLEMLKNDILGVRIQDYNSEIGGVY"
FT   gene            642863..643582
FT                   /locus_tag="LS215_0730"
FT   CDS_pept        642863..643582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0730"
FT                   /product="CRISPR-associated HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34799"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMV9"
FT                   /protein_id="ACP34799.1"
FT                   /translation="MIKPCAYEKQGLIDHAIGSYKVLSGKISESYYKIISRRLERYGIF
FT                   LDLNGVKEIVKDVVVLHDMGKAGEYYQDQFDDNCNSLKSNFSFIYHELGSALFFYNDYE
FT                   LIDVEKAEEVKSLLTLAVLNHLNAIRVISDYLVNKFPDKFDERMIKLNNYGSIMLQNLR
FT                   GVISKSLKVRDYTFDHYHDMLYAFSKKSDKYLKLYNLFLAPIMLGDNLDSSLVRNNGSK
FT                   TRFVRILEGELNGGSTL"
FT   gene            643563..644600
FT                   /locus_tag="LS215_0731"
FT   CDS_pept        643563..644600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0731"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34800"
FT                   /db_xref="InterPro:IPR022297"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMW0"
FT                   /protein_id="ACP34800.1"
FT                   /translation="MEVPLYNIFGDNYIIQVATEAENSSIYNNKVEIDDDELRNVLNLA
FT                   YKIAKNNEDAAAERRGKTKKKKGEEGETTTSNVILPLSGNDKNPWTETLKCYNFPTTVA
FT                   LSEVFKNFSQVKECEEVSAPSFVKPEFYEFGRSPGMVERTRRVKLEVEPHYLIIAAAGW
FT                   VLTRLGKAKVSERDYVGVNVFTPTRGILYSLIQNVNEIIPGIKPETAFGLWIARKVVSS
FT                   VTNPNVSVMRIYTISDAAGQNPTIINGGFSIDLTKLLEKRDLLSERLEAIARNALSISS
FT                   NMRERYIVLANYIYEYLTGSKRLEDLLYFANRDLIMNLNSDEERVRDLKLISTYVNGEL
FT                   IRGEG"
FT   gene            644600..645496
FT                   /locus_tag="LS215_0732"
FT   CDS_pept        644600..645496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0732"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34801"
FT                   /db_xref="GOA:C3MMW1"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="InterPro:IPR041165"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMW1"
FT                   /protein_id="ACP34801.1"
FT                   /translation="MPLIFKIGYNVIPLQDVILPTPSSKVLKYLIQSGKLIPSLKDLIT
FT                   SRDKYKPIFISHLGFNQRRIFQTNGNLKTITKGSRLSSIIAFSTQANVLSEVADEGIFE
FT                   TVYGKFHIMIESIEIVEVEKLKEEVEKHMNDNIRVRFVSPTLLSSKVLLPPSLSERYKK
FT                   IDAGYSTLPSVGLLVAYAYNVYCNLIGKKEVKVRAFKFGILSNALSRIIGYDLHPVTVA
FT                   IGEDSKGNLRKSRGVMGWIEFDIPDERLKRRALKYLLTSSYLGIGRSRGIGFGEIRLEF
FT                   RKIEEKEDKYTSSDFKG"
FT   gene            complement(645539..645839)
FT                   /pseudo
FT                   /locus_tag="LS215_0733"
FT   gene            645896..646959
FT                   /pseudo
FT                   /locus_tag="LS215_0734"
FT   gene            complement(647062..647530)
FT                   /pseudo
FT                   /locus_tag="LS215_0735"
FT   gene            complement(647521..647619)
FT                   /locus_tag="LS215_0736"
FT   CDS_pept        complement(647521..647619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0736"
FT                   /product="ORF1 in transposon ISC1048"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34802"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMW2"
FT                   /protein_id="ACP34802.1"
FT                   /translation="MKPRLTNVQAKKDMWEDFKIGRRGSVLSRVGQ"
FT   gene            complement(647609..647821)
FT                   /locus_tag="LS215_2977"
FT   CDS_pept        complement(647609..647821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2977"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2977"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34803"
FT                   /db_xref="GOA:C3MMW3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMW3"
FT                   /protein_id="ACP34803.1"
FT                   /translation="MDLVDGKSEKEVSKMLNKGYSTIKLWIGKYKKEGLDGLRDKSSST
FT                   ITTRNRVQEIKIIRTSSRTRIQLET"
FT   gene            648024..648251
FT                   /pseudo
FT                   /locus_tag="LS215_0737"
FT   gene            complement(648293..649321)
FT                   /locus_tag="LS215_0738"
FT   CDS_pept        complement(648293..649321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0738"
FT                   /product="Luciferase-like monooxygenase"
FT                   /EC_number="1.14.14.3"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34804"
FT                   /db_xref="GOA:C3MMW4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMW4"
FT                   /protein_id="ACP34804.1"
FT                   /translation="MMNKIKPELFWVVDYYPDSGISKGEYYEQITREVEYAEKLGYRGV
FT                   WIAEHHFIDYGIVPSAPIYLTYLASRTSRIRLGPAVSTIVFRNPIQAAEEYSLLDTLSK
FT                   GRLNLAVGSGYLKHEFTGFNVPPEAKREIFDEALDIIIKLMRGEKITVNGKYFKYENIG
FT                   INVLPMQKPHPPIWIAVLRAEAAYHVGKKGFNLIMIPYATVDKIDDIMPVVNSFREGLK
FT                   ESKTEEKELSLSFHTHVASSFHDAVETSKEYLHRYVFSRLYAKRRTLDELYGSGLLLFG
FT                   SPEDVANQIYKIYKLAKPSRIMFLVDYGMKPYDMVIDVLTKIREKVAKHLEEKGILLEF
FT                   AD"
FT   gene            649406..650560
FT                   /locus_tag="LS215_0739"
FT   CDS_pept        649406..650560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0739"
FT                   /product="homogentisate 12-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34805"
FT                   /db_xref="GOA:C3MMW5"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMW5"
FT                   /protein_id="ACP34805.1"
FT                   /translation="MVFYYRQGEVPKKRHTVFMKDNLLLREEVFGLNGFSGRYSLLYHL
FT                   NPPTRIAKVGEWRNNVIEEWKDAGYKHHKLSTSKLRKSNDVFLDRIPLIFNEDVIISYA
FT                   KVDEGESKLFYRNADFDEVYYIQEGEAEFRSVFGSIELVQGDYLVIPRGTTYTFNFKRY
FT                   SELLIVEGRQVEIPRQHRNDYGQLIEGSFYYNRDIKLPNLKTFNEKGNYNLVVKTSQGF
FT                   QSITLDYHPFDVIGWDGYLYPFALNVYDLEPITGKLHQPPTVYTTFTANNFVICTFVPR
FT                   LFDYHPNSVPISYYHDNVDADEVLFYSSGQFMSRRGISKGDITLHRGGHVHGPQPGAVE
FT                   SSLSKRGSYNDEVAVMVETQRRVKLTNYAKEVDDPSYPLSWYIP"
FT   gene            650593..651240
FT                   /locus_tag="LS215_0740"
FT   CDS_pept        650593..651240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0740"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34806"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMW6"
FT                   /protein_id="ACP34806.1"
FT                   /translation="MEKFSVLSIDLFHPGCWTSLTDKYEVNVKLISQNFSDDDFFSSRV
FT                   LILGRDTKKLINEMRTSKSVKVIKVYSMDRGAFLVDFICPKRNAISNLIHETESIVVSH
FT                   RIVDGTEKWKIVANVSFIPKILESLERTSNLINFKEIKLNELRKLMSKLTDRNLEILKI
FT                   AYERGLFDYPRQCKLTSISNEIGIKPNTLLYHIRKAEKLLLEILLDEYYSLL"
FT   gene            651237..652085
FT                   /locus_tag="LS215_0741"
FT   CDS_pept        651237..652085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0741"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34807"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMW7"
FT                   /protein_id="ACP34807.1"
FT                   /translation="MKTNLNHKTNKRNMSVNKIYLLDHGKISADLAWFLPTFMTEEEMK
FT                   NPKPRSWTDVSVMSAVIEHKDGIILFDTGISEKVKEKWPQIALSAFPVTKFSDENRMEN
FT                   HLRQIGLKPEDIHFIVFSHLHLDHTGNLDLFRSAKPAVIVHEKELKYSLLNVWLNKPVP
FT                   YLLKDLEILREMNVVPMSTDYLELLPGVELYLFGGHTPGSIILKVRTQNDNNYIFTGDF
FT                   IHLPDELDFESKGWLLGNAEEYYTRIRLLKALMKLPRTNVIITHDPKLWDKYPKAPKEL
FT                   K"
FT   gene            complement(652385..652507)
FT                   /pseudo
FT                   /locus_tag="LS215_0742"
FT   gene            complement(652542..653772)
FT                   /pseudo
FT                   /locus_tag="LS215_0743"
FT   gene            complement(653744..654379)
FT                   /locus_tag="LS215_0744"
FT   CDS_pept        complement(653744..654379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0744"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34808"
FT                   /db_xref="GOA:C3MMW8"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMW8"
FT                   /protein_id="ACP34808.1"
FT                   /translation="MERLLRPKEACQLLSISYSTLLRWIREGKIRVVTTEGGKYRIPYS
FT                   EIKKYLEKREEIRAVIYARVSSSDQKEDLERQINYLTNYATAKGYKVVEVLKDIASGLN
FT                   TQRKGLLKLFKLVEGRSVDVVLITYKDRLTRFGFEYIEELFSTMGVKIEVVFGEEPKDA
FT                   TQELVEDLISIITSFAGNGMRSHKKTVLVQGVKKLIGELSGEDDKVKG"
FT   gene            complement(654471..655188)
FT                   /pseudo
FT                   /locus_tag="LS215_0745"
FT   gene            655293..655612
FT                   /pseudo
FT                   /locus_tag="LS215_0746"
FT   gene            complement(656029..656541)
FT                   /locus_tag="LS215_0747"
FT   CDS_pept        complement(656029..656541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0747"
FT                   /product="aromatic-ring-hydroxylating dioxygenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34809"
FT                   /db_xref="GOA:C3MMW9"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMW9"
FT                   /protein_id="ACP34809.1"
FT                   /translation="MNLQELFYNIYNFEIMEAELLDAEEYDKWLTLLDDDYEYYVMEGD
FT                   NRQGKKLDFGNRKFLFSADKNKWKLFIDRLFSSYGWSYQYAQTKTRRIIGNIRIVDLKG
FT                   NNIVHVASNVLVLRFNAEDIKEFPTLISGKREDTLRIYRDNEIKIVRRIVYLDSTSYPS
FT                   YNLYFPL"
FT   gene            complement(656538..657854)
FT                   /locus_tag="LS215_0748"
FT   CDS_pept        complement(656538..657854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0748"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /EC_number="1.14.12.19"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34810"
FT                   /db_xref="GOA:C3MMX0"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMX0"
FT                   /protein_id="ACP34810.1"
FT                   /translation="MSVYDMLRKMRDSFSNQQYEIPLKVINDYQIYELELEKIFSRSWI
FT                   FLGFEEEIPNKGDYMVRYIGPDPFIVIRGDDNKIRAFFNSCRHRGSMICTSEYGNAKKF
FT                   TCPYHGWSYDNKGKLIGVPLRDRIYKNLDMEKWGLIEINVEKYENLIFGSESPRTSLSE
FT                   YLGEAKYYLDIIFKLTGGMRPVNTPLKFTTDFNWKIGAENFSEDRLHTVVTHKTVADFG
FT                   FASPVSRFGYITPGTNEVSIADLKDTEGKVIGAFGFRFTPSEHIPGYFGFRINSTFKDP
FT                   RGNLLKKISHTVFTIFPNLSGFIAADSSDGSRKDRAPVSLLRVWQPLGPDKTLIQTWVI
FT                   APKNTSDEIAKRVYEITVSHFGPSGAAEQDDTSIWRGITQVARGYFSKMNTTNLKAEPD
FT                   LPPLEGWEGPGIVRPMQFHEECQRTFWRRWIMEILGDEK"
FT   gene            complement(657927..659363)
FT                   /locus_tag="LS215_0749"
FT   CDS_pept        complement(657927..659363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0749"
FT                   /product="UbiD family decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34811"
FT                   /db_xref="GOA:C3MMX1"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMX1"
FT                   /protein_id="ACP34811.1"
FT                   /translation="MEIRRFIEEVEKLNLLREVKGAHWNLEIGTITDLNAKRNKYTLLF
FT                   DEIVDYPKGFRVLTGTLLDSRRVGLALGLTSNLNDLQLVTKLRERLNYANREYKSYDPI
FT                   EVSDAPFLENVYTRENINLFKFPAPKWHELDGGRYIGTADAVITKDPDSDWINVGAYRV
FT                   MLVDKNKLAIFIEASHHGRLHIEKYLKQARKAPIAISFGPPLSLFIFAGMEVPYGVSEY
FT                   NFAGAVVGERMKVFRGEVTGLPIPAESEIAVEGYITGEVTDEGPFGEFMGYYAGGRMKS
FT                   PVIEVKRVYYRKDPILLGTAPSISPYDYSYLRCPIRSAMIWDFLERAGVPNVKGVWAHE
FT                   VGFSRAFIVISIKQTFAGHATMVGHLVATSPLASYGGRYVIVVDEDIDPSDLNQVIWAM
FT                   CTRSDPATTIDVIKNVNSTPLDPIAERRENVKEYVSSRAIIYAVKPFDKLIRNQFPTEV
FT                   RPSEELVEKVTKKFNHLFSP"
FT   gene            complement(659380..660417)
FT                   /locus_tag="LS215_0750"
FT   CDS_pept        complement(659380..660417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0750"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34812"
FT                   /db_xref="GOA:C3MMX2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMX2"
FT                   /protein_id="ACP34812.1"
FT                   /translation="MKAMKIVEFGKPLELSEVGEITKTKSNQVLIRVQAAGVCHTDVSV
FT                   RSGVIYKRISANPPRLPLTPGHEIAGIVEEVGDEVTGFTKGDKVLINPWQGEGNCFYCK
FT                   IGEDQYCDSPTWLGITTDGGFQEYVLSNHNYVYKIRNLSPYEAAPLACAGVTSYRASKL
FT                   ARLNPSSYVAIIGAGGGLGSIGVQIIRALYGSIIIAIDVNDEGLELASKFGADYTLNSR
FT                   RKEVYQELLKITNGRGVDAIIDFVGSENTIKSYYTFLAKLGRYIKVGTFGGGLPNEAGL
FT                   KIHSMGWQFIGTLTGNRKEFLEVISLAENGRIKPVVTKLRLEEANEALDNLERNKVTGR
FT                   QVLIP"
FT   gene            complement(660427..661758)
FT                   /locus_tag="LS215_0751"
FT   CDS_pept        complement(660427..661758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0751"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34813"
FT                   /db_xref="GOA:C3MMX3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMX3"
FT                   /protein_id="ACP34813.1"
FT                   /translation="MKPNDKLTGKHVKWILASFFTWTFDLYDLFSILLVTPYIAGLFFP
FT                   SKVALLSIAATYAGFLTSFLMRPVGAAYFGNNIADKLGRKKAIVYGIIGLAITATLQGA
FT                   LPTYEAAGIIAPISLIILRLAEGFFVGGITTGSHTIGPESVPERHRGWVGGIGFSAAGA
FT                   AYLIASAWFYLTALLFPGSSYLVWGWRVMFFGGLLPLAVLGFVSYLVPESEMWQRAKEK
FT                   LKPIKTPVRELFSSRYRRLFGIALMITVGWALMYYLTQGLFPTFLSKVNGLSKAEIGIT
FT                   MLIASLGMLIGPTLGGEISQHIGRKLMSIIGGVIVIAISPLYLYLGSLPASALSEIILA
FT                   TFLISLLSDFGGGIVMVYLNELYPTNIRGTGVAFTWNTGFAIGGAAPTIISLILAEVGG
FT                   VSRFPMLMFSALIFTAAIILIGSILTRETKGSISKELELMEKEG"
FT   gene            complement(661973..662626)
FT                   /locus_tag="LS215_0752"
FT   CDS_pept        complement(661973..662626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0752"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34814"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMX4"
FT                   /protein_id="ACP34814.1"
FT                   /translation="MRYFNSYPVKLVSLYLIHENCWSKYYLEDDMVNILNLIPYEEKNL
FT                   LRVFLVSTEKSYKQIAKLKFEGRIRDIFNVYRYYNKILVDLARDYENSIFSIITGNNGI
FT                   VLNTAKYNGGEIWNFLMYEHKINKTLKELDEVAEIENVNISDFIPISTTLSDHELKALS
FT                   LAYEYGYFDYPRRIRSGELAKMLGIKQSTLIYHLRNAERKVIGSFLKKNRSFEE"
FT   gene            662700..664451
FT                   /locus_tag="LS215_0753"
FT   CDS_pept        662700..664451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0753"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34815"
FT                   /db_xref="GOA:C3MMX5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMX5"
FT                   /protein_id="ACP34815.1"
FT                   /translation="MWERKRYINRRGILLYMRNMVEIIRDKKIILRPNLENYEEVRKNF
FT                   SWSKVREELNYNGDVNAAELAIHKKGELGDKYGILWVSEEEEKRKYTFRDLERRGATFR
FT                   RVLEDNGIRSGDRVVIMSKRVPALYFSFIAIGMLGSVILPIFSTFGEDAIRYRVENSGA
FT                   KVAIVHESLVEKFRNIHGIKILKITDDGIEGESNRGVEISYTKRSINDPFLILYTSGTT
FT                   GKPKGIWHSQDILTFYYVSGKYHFDMHPQDVFWHTGDPAWVAGFAGVWTAWVNGIPLVS
FT                   YEGRFKAETWYSNIQEYRVSVISTAPTALRLLKKEGLELAKKYDLSSVRFVHAGGEYVD
FT                   PDTVKAGIEIFGVPVHDGYGQTETATYVIANFISTPIKIGSMGKPLPGVEAVIVDENGN
FT                   PLPPNTQGILALKPDFPAMARGIWGDEERWKRNFKNGYYLTGDTAYVDEDGYFWYLGRS
FT                   DDVIKVSGYRVSPIEIESVIATHPAVAEAGVIALEDPVRGHKIKAYIVLKKNYEPSEEL
FT                   KQQIQNYVRERLAAHMVPREIEFVSELPHTLSGKIMRRVLKAMESGREVGDISTLENPE
FT                   IVKKSKK"
FT   gene            664519..665283
FT                   /locus_tag="LS215_0754"
FT   CDS_pept        664519..665283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0754"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34816"
FT                   /db_xref="GOA:C3MMX6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMX6"
FT                   /protein_id="ACP34816.1"
FT                   /translation="MIKVELENENKIGKILIDRQEKMNAITVAMRREIGEKILDLEKNQ
FT                   DVRVIIVRGVGGKAFSSGGDISEFLSLTPETLLDWGEDISSSERITKPVIAAIDGYTFG
FT                   AGLELALSCDIRIATPRSEFAFPEIRLGMVPASGGITRIVKMLGVSRATYMLMLGKRLD
FT                   VQTALQWGIVHEIVEPEKLDEKTMEIAKDLASLSPLALKALKKVIREIADSPFYAGFDI
FT                   ERKTFGLLRYSEDFKEGVESFLNKKKPKFNGR"
FT   gene            665286..667553
FT                   /locus_tag="LS215_0755"
FT   CDS_pept        665286..667553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0755"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34817"
FT                   /db_xref="GOA:C3MMX7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMX7"
FT                   /protein_id="ACP34817.1"
FT                   /translation="MFKEGLRFVKGEGNYIDDFVLKEVKNYFSASIVRSPYAHAMIRSI
FT                   DKSDAEKLNGVIKVITFNDIRNLLDPFPLSLDINLDFYPMAREKTLYYGEPVAVIIAKD
FT                   DYVAEDAKELLQVDYEPLESVVSIENAINSGPIHPTLKSNVILDKTLVYGKFEYEIKKS
FT                   SILIEERIRFPRYSSSPLETYEILARYNGEEYEIFSNFQGPFTIHYLLTKALKSKVVLK
FT                   GPRDIGGSFGIKSAIYPYMALIAVASRVVKRPVKWIETRSEHITSSSVGAERESLIRIY
FT                   GDKDGIINAIEMDLIDNLGAYPRPPEPGNLLRNHGNLTGAYDIKGLKIRYRAVLTNTVP
FT                   TGLNRGYGGPHLYFALETVIDSFAREIGMDPIDVRLKNVFKKTPYETLTGGKYNGFSCY
FT                   SVLKRMKEIYEKIEGEKRGKVGIGVSLVVEPSGTNIGYLDLARESKDYLPKSAAQDVVI
FT                   VQIDPYGKVKVMVNGTNEGQGHETIISEIVSKRLGVNPDDVEVLYSVDTSRPWVVSSGS
FT                   YSSRFTPIVVQALNNALDQLENRLLSAASEILGVQKSELKIENGRVRTISGNKSISVRH
FT                   LIGTFYWDPAKLKGIEGGLVAVGYYQSPYADDIKEGKINSSISYGCMGHVVEVLMDETE
FT                   IPRISRYVVVHDAGRILNENFARGQIIGSTFHGIEVSLYASLEYNEEGIPITQTFAEYG
FT                   AMTAMESPKVEIEHLESDSNHLAGLGEGGTMAAPPAVFNAIRSLVEVKNIPLFLELTSK
FT                   RK"
FT   gene            complement(667639..667794)
FT                   /pseudo
FT                   /locus_tag="LS215_0756"
FT   gene            complement(668346..668738)
FT                   /locus_tag="LS215_0757"
FT   CDS_pept        complement(668346..668738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0757"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34818"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMX8"
FT                   /protein_id="ACP34818.1"
FT                   /translation="MKDKEFLFDASALYSLLDYVDKIDLKKIHILTLTFYEVGNVIWKE
FT                   YYIHKKVKDPITLSMLFHKLMRKLNVVEDPPLEGVMRIAVERGLTYYDASYAYVAESLG
FT                   LILVSNDKELIRKTNAISLKDLIKSM"
FT   gene            complement(668728..668952)
FT                   /locus_tag="LS215_0758"
FT   CDS_pept        complement(668728..668952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0758"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34819"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:C3MME7"
FT                   /protein_id="ACP34819.1"
FT                   /translation="MSDVISVRVKKELKKRAEELGINIREVVEKALKEAIREKEKEELK
FT                   DIVMRIKELMRDVSEDDWVRAVRESRDER"
FT   gene            complement(669049..669189)
FT                   /locus_tag="LS215_0759"
FT   CDS_pept        complement(669049..669189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0759"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34820"
FT                   /db_xref="InterPro:IPR041165"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMY0"
FT                   /protein_id="ACP34820.1"
FT                   /translation="MKYLILRGKLFPSLTNLVKSRDKQKPLFISNLGYGDVRLIGINST
FT                   S"
FT   gene            complement(669654..670022)
FT                   /locus_tag="LS215_0760"
FT   CDS_pept        complement(669654..670022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0760"
FT                   /product="putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34821"
FT                   /db_xref="GOA:C3MMY1"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMY1"
FT                   /protein_id="ACP34821.1"
FT                   /translation="MFTLLKNFKLTDSGCFTEEPIKDFPVLLIKGEVKEGRLVSLDEVI
FT                   RTHSPRIVLPKQNFQTYMKFLKIIGNPYVIFLDKSSLGWNNFDDMVRLVSSYESALPVC
FT                   KDTEKGTCDKYNYLALFI"
FT   gene            complement(670151..670501)
FT                   /locus_tag="LS215_3031"
FT   CDS_pept        complement(670151..670501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_3031"
FT                   /product="putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_3031"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34822"
FT                   /db_xref="GOA:C3MMY2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMY2"
FT                   /protein_id="ACP34822.1"
FT                   /translation="MGNSALSFGIDVPNLDLGFVHSHDAETLIQRIGRFGRKGEGEAEI
FT                   HVFLKSSYKAIKELKEGEIDYYELVDIIYRVYDKRIDDGLDKINFSVEREKILFRTFLY
FT                   AYYIAQGSSLRI"
FT   gene            complement(670504..671406)
FT                   /locus_tag="LS215_2995"
FT   CDS_pept        complement(670504..671406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2995"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2995"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34823"
FT                   /db_xref="GOA:C3MMY3"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMY3"
FT                   /protein_id="ACP34823.1"
FT                   /translation="MLNFLQTSVIKSYIVSMTTKTFGYDQARSIFETLKLMGFREKQGN
FT                   EYYKEFEGEFIIQGKIVGGGEKRIRTEFLVAVITGDTSKEVFKNLEKYVPVKPIMVLTV
FT                   PEYPYLFMTTLGRYSEASKLIEASVKRSLNEHLGIPRTVIRDIFNDFARFFNGYLFIDE
FT                   FHLYTGITRSSLNALIKMYKFFNLQPVGGYKTIIYSSATPIGNFKKIIEAKTSERGSKI
FT                   RKRTKVLFHLVSGDPQEELVKESVNYVNDKSLEKKTGVILDRVYYLVEFCKKVNKTTGL
FT                   IWGLGSGFYKCEKTNEITT"
FT   gene            671481..672317
FT                   /locus_tag="LS215_0761"
FT   CDS_pept        671481..672317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0761"
FT                   /product="long chain fatty acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34824"
FT                   /db_xref="GOA:C3MMY4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMY4"
FT                   /protein_id="ACP34824.1"
FT                   /translation="MTSKSSGDFFKELEKYQNNKPNISVNIEDYATMHFTSGTSGLPKG
FT                   VIHKHRGITYKATCFYAYHHANLLLDSNFKTFNDFLNYVYSNETVLIFIPLFWIMGHDL
FT                   GLAYSTFSGAKVILLTRWDIEAVLKAIKKYKVTTIYGPFDIYYELVNYKNIGNYNLRSL
FT                   RTCTGTSFNKTITRELRVKFRELTGCTLREHAYGLTESHSTCTITGGFHKDDMDILRAE
FT                   KVGGVFCGIPMPSTQIRIVDETGKDSKFGEIVIKSPDLTDGYFNNPTETEKSFKIG"
FT   gene            672369..672698
FT                   /locus_tag="LS215_2996"
FT   CDS_pept        672369..672698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2996"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2996"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34825"
FT                   /db_xref="GOA:C3MMY5"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMY5"
FT                   /protein_id="ACP34825.1"
FT                   /translation="MGRKKYMIKVSGVSVSPDFIEYIISKHLAVEKVGVIGVSDEEKGQ
FT                   VPIAFVKLRYNITESELLEWCKRNMAWYNVPKRIILLPSLPLTESGKVRREELIKIYNE
FT                   IYNKR"
FT   gene            complement(673333..674055)
FT                   /locus_tag="LS215_0762"
FT   CDS_pept        complement(673333..674055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0762"
FT                   /product="cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34826"
FT                   /db_xref="GOA:C3MMY6"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMY6"
FT                   /protein_id="ACP34826.1"
FT                   /translation="MQNLDEILNSFNYFDFTIPLSHDVVAWPTHPAIRINKFRSVDRDL
FT                   YDAHEIYMTSQDYTHFDTPSHMIKGGKSIDKYEARRFILKAVILNLSYKKDMEIREEDL
FT                   RQFEEVIRKSEAVVLYTNFRKEPKEFRYDWAYLGISGAKYLSKFNLKLVAIDSPSIAGW
FT                   SGDVPAHPHIITVKEAIDVHLNLLEKDILIVEGLYNVNKAVGEEKYVEGILIALPLNII
FT                   GLDGGPCRVIFLKPKNKL"
FT   gene            674145..675263
FT                   /locus_tag="LS215_0763"
FT   CDS_pept        674145..675263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0763"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34827"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMY7"
FT                   /protein_id="ACP34827.1"
FT                   /translation="MIKLYGITWDDPRGYDSLVYISQKYKDFSIQWDKRSLYDFTVYPL
FT                   DKLAKSYDLVVVDYPSAGDIAESKMYVPIDEVLSKKELEFIQRISIGKTYESYLYNGHL
FT                   WALPIDAATQVSAYREDIFRKLSLRVPKTWRQVIKLKCKIGMPLSPIHAHSSFITMCAN
FT                   YFLDPFFIKLNQYDMKKIYTILDIMKFISDKCGELCLKSDPIKLLNYMAEGEEICYIPL
FT                   TYGYYNYSRDNYRKNVINYANIPSFTKIPYGSTLGGAGLAISTRNKYIEETINFIKWLY
FT                   EFDVQKMYWQHYGQPADIRIWINEELNRATRNSYINTIYTISLSYVRPNFPGFVKLHEE
FT                   SGKILVDFLMGRINRDETIKELLNLNISYIKT"
FT   gene            complement(675446..676171)
FT                   /locus_tag="LS215_0764"
FT   CDS_pept        complement(675446..676171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0764"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34828"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMY8"
FT                   /protein_id="ACP34828.1"
FT                   /translation="MPVMREMNDNYALVYLRLKHEGCWSELTEYNNFMATTITAKPNRA
FT                   KKFIIAYDDVKLNGNYKLKNFLRDLKKSDRVKEIYSINKINAKREVYRILLKESYENMV
FT                   RGILDNYTVFDIKDLIVNGEERLALIVPVSEIIELKKDMESIGKVLKFIYKKIRLDDIF
FT                   LSIFSLSKRERESMKLAYLYGFYEMPKKVTLDELARLLGISKPTIEDYIRRAERKIIKS
FT                   FSYQLYYYDMLLEDLLEDL"
FT   gene            complement(676274..677014)
FT                   /locus_tag="LS215_0765"
FT   CDS_pept        complement(676274..677014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0765"
FT                   /product="ABC transporter related"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34829"
FT                   /db_xref="GOA:C3MMY9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMY9"
FT                   /protein_id="ACP34829.1"
FT                   /translation="MSEKTQPVVKMVNIHKWFGNLYALRGIDLEINRGEVIGLVGDNGA
FT                   GKSTLMKILAGYHKPDKGEIYVEGKKVEFNSPHEAREMGIEMMYQDLSLINTMNIMRNF
FT                   FLGREITGRFGFLKFNKMKEEAKNAIEDIGLKIPNLELRADELSGGQRQGLAFARSYYF
FT                   KKKVLILDEPTNNLSVKETNKVLSFIRSLKELNISVVFVTHNLFHVHEAADRILVISRG
FT                   RKIGDFPKSQISVTELASLITHGS"
FT   gene            complement(677007..678008)
FT                   /locus_tag="LS215_0766"
FT   CDS_pept        complement(677007..678008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0766"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34830"
FT                   /db_xref="GOA:C3MMZ0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMZ0"
FT                   /protein_id="ACP34830.1"
FT                   /translation="MTSNKRQKLFLKIISNKEFASIFTLIVLWILFYILNPSFLSLSNL
FT                   SVLFTVIPIYGITVLGVTVLMIAGEFDLSVAATFALVPLVIQLLISNGISAIVATIIGL
FT                   LLAVLIGFLNGIIIVKTGIPSFIVTLGTLFVWLGIALQISGGQPHPFILPSIATRILSG
FT                   SIAFNGLINSQLIWLIVFGVIFYLILERHQWGNWIYATGGNKDVARAMGIKVDYVKIWL
FT                   FILCAVLAGFSGMMESTLYGQAIANQGGNLELDTIAAAVIGGTSLFGGEGSVLGGIIGT
FT                   IIIWSIENGLVLAGVSSYVYETLIGALIIIVVMVHRYAKKISKNIRLGELNE"
FT   gene            complement(678024..679055)
FT                   /locus_tag="LS215_0767"
FT   CDS_pept        complement(678024..679055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0767"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34831"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMZ1"
FT                   /protein_id="ACP34831.1"
FT                   /translation="MADKSRRNFIIGMAGLGALAAAGWGVAGWSLSQVSGTKVTQATSA
FT                   FGEGVKIIFVGHWGSENVFGNVVERGYDDACALTGANCIKMYRPKTDADLQEIISNLQV
FT                   AINQTPDVLITTDIYTAVQPYLHQASQEGIIVILTNVNAPTQADFEYTGAISFIGQSLV
FT                   TAGYTQAQALSKYFPSNSHAVIIDEGPGQVWAQQRNQGIEEFLKQYGCTWDVIESSFDL
FT                   SQVTSQITAYLEAHPDTKAILSNGYGGAVAMDVFPKLGIQPGQIPVATFDITPQVLNAI
FT                   IAGYVTLTIDQQPYLQGFLPVIQGILTKKYDFTGWNVDTGEYVITKDVAQKVEPLVNEG
FT                   IFY"
FT   gene            679163..679924
FT                   /locus_tag="LS215_0768"
FT   CDS_pept        679163..679924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0768"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34832"
FT                   /db_xref="GOA:C3MMZ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMZ2"
FT                   /protein_id="ACP34832.1"
FT                   /translation="MMDFRGKVILVTGSSSGIGRSTVELFAELNANVIGIDINDEWGKE
FT                   LESKLRSKGLDFTYFHSDVSKIEDLKRVVDYISQKYDKLDVLVNNAAIAEWKYFEELTY
FT                   EDCERVIRVNLFPAIFLAKFALPLLKKSQNASIINVGSVTAERGEDNLLCYAASKGGVH
FT                   AITISLARVLAKYNIRVNAVIPGPIDTPINWVRTRGPEKEKWEQWIKQVVLLSRWGKPE
FT                   EVASVIAFLASDLATFITGSLIAVDGGYLIR"
FT   sig_peptide     679163..679249
FT                   /locus_tag="LS215_0768"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.789) with cleavage site probability 0.686 at
FT                   residue 29"
FT   gene            679929..681104
FT                   /locus_tag="LS215_0769"
FT   CDS_pept        679929..681104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0769"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34833"
FT                   /db_xref="GOA:C3MMZ3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMZ3"
FT                   /protein_id="ACP34833.1"
FT                   /translation="MQKGALENIRGLELGIYLNGPYIGRLLAELGAEVIKIEPPWGDPM
FT                   RNSPPFINGDSLHSIYYNVNKKFITLNLKTDKGRELFLELVKKSDIVISNFRPGTLEKL
FT                   KIGYDDLVKVNPKIILVSSTGYGYNSPYKDLPAFDPIVQALSGMMDSTGYPDRPTRAGM
FT                   AILDFTTAAYAVIAVLAALMYRERTGRGQFIDMSMYDVSLTLSMQSLTYIFLGHHPRVG
FT                   PTSLVFSPEYLYEAKDGYVYVIIPTDEAWRNLAKRMGREDLIDNPKYKTVADRVVHRGE
FT                   VNKIVQDYFRNLTKDEIVKIVIECGGAAAPVRELKEQFEDPHVKARNMFVEFLLNGNKI
FT                   IVPSSPFKMSETPGIVKWPGLLKGYHNEEVYRELLGLSKDEIEKLKTEGVI"
FT   gene            681106..681528
FT                   /locus_tag="LS215_0770"
FT   CDS_pept        681106..681528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0770"
FT                   /product="MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34834"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMZ4"
FT                   /protein_id="ACP34834.1"
FT                   /translation="MEYKVGYKFTTKRRTITDADIILFAGLTGDWHPAHLDDIYAKNSI
FT                   FGKRVAHGFLTLSILQGLLAQHKIVEDIIALLGINNVKFKSPVFVGDTIWSECEITDSR
FT                   ESKSRPNNFIVTIHCIGKKQDNSDVLEYEVIELMKY"
FT   gene            complement(681639..682595)
FT                   /locus_tag="LS215_0771"
FT   CDS_pept        complement(681639..682595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0771"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /EC_number="1.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34835"
FT                   /db_xref="GOA:C3MMZ5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMZ5"
FT                   /protein_id="ACP34835.1"
FT                   /translation="MWKIFFYHGKFHKLFINDENPNKEEIKIIPKYIGICGTDKNIYLG
FT                   KKKVNEPLVIGHEISGITVDGNKVVVFPNYWCGKCKNCKKGFYNSCRNKISIGVNTNGG
FT                   LAEWINVPKQYVFKIPEDLDLRLGALVEPTAVAFSALRKINTNIEDIIVIGGGSIGSLI
FT                   SIVAKVLGFKPIILEKDPRKMERLKQKGLPATYDIEEDFDTQIAIIDTVNSRESIALSL
FT                   KLLQGAVANSQLIITGLDEENIILNRDIIVRNEIIVQGSIIYTPADFSRSIQIIDKNRE
FT                   IFSKIIDKIADSENINDWFKAYVIDEPNLKVLISLNN"
FT   gene            complement(682603..683865)
FT                   /locus_tag="LS215_0772"
FT   CDS_pept        complement(682603..683865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0772"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34836"
FT                   /db_xref="GOA:C3MMZ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMZ6"
FT                   /protein_id="ACP34836.1"
FT                   /translation="MANNLRWYIILIVFCLIIVDYIDRGLITVILPVIKPEFHISSFEA
FT                   GIIGDGFTFGYLIMNPLVGYFLDKYGPKKIFSRFAVFWGLIQAINVFAFSAFYFIVTRV
FT                   LLGIAEAVGFPGVTKIVANWLRRDEKARGGTISDSGVNLGIVFGSLFMIGMFSIFPEEL
FT                   AWRLGFLISGVLAIVLGLGLGYLLFDLPELHPKISRQELDYILANRDNVSQRKKVPLTS
FT                   WFSNKNYWGYMQGLGAQAGIFFGLFTWLPLYLYYARHFSLSFTLTYTALIWSFGFIGEI
FT                   IGGFIIDKIVKNNPNLGFKVGFAVSSIAVTLGLAATIFVSSPIEAVEILMITFFFLRWS
FT                   GIQWAAPSFLVPAELSGQFGGHIGFWETLWGIVIPVVFGATVEVTHAYFLGMEILVGVG
FT                   LIYFIGTVLVTDYKVLGIKEE"
FT   gene            complement(684353..685123)
FT                   /locus_tag="LS215_0773"
FT   CDS_pept        complement(684353..685123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0773"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34837"
FT                   /db_xref="GOA:C3MMZ7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMZ7"
FT                   /protein_id="ACP34837.1"
FT                   /translation="MDLGLKDKVAIVTGGSQGIGKGVVNVLKEENVNVINFDIKEPSYD
FT                   VDYFKVDVSKKEQVIKGIDYVISKYGRIDILVNSAGIESYGAIHAVEEDEWDRIINVNV
FT                   KGIFLMSKYTIPYMLKQDKGVIINIASVQSFAVQRRVAAYATSKHAVLGLTRSIAVDYA
FT                   PTIRCVAVCPGSIRTPLLEWAAEKEVGKDHVEDKIREWGEMHPMKRVGKPEEIGYLVAF
FT                   LASDLASFINGECVTIDGGLRALIPLSSPKIGTK"
FT   gene            complement(685251..686435)
FT                   /locus_tag="LS215_0774"
FT   CDS_pept        complement(685251..686435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0774"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34838"
FT                   /db_xref="GOA:C3MMZ8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMZ8"
FT                   /protein_id="ACP34838.1"
FT                   /translation="MGKEVLMPKLGLTMTKGKIVQWKKKEGDRVQEGEDLVIIETEKIT
FT                   TAVKAAASGILLKIYAKEGEEVPVGQIIAYIGEIGEKPPSLSTRPTLVSEQQQGQPTRI
FT                   EEAKAISEVRASPRARRLAKEKGIDLVKIKGTGPGGMITEDDVIRELENIEKGVKFTAT
FT                   GLRVKEVIPMTAIRQEISRRMVQSLQTMAQVTLNIEINADSLVKIKNEVESKYSMKITY
FT                   TDVLVKVVAKLIRSHPFLNATLEGDQIKIIEDVNIGIAVALDQGLIVPVIRNADIKPIT
FT                   EIVKESHELADKARENKLNPDEVTGGTFTISNLGMYDIDSFTPIINPPQTAILGVGRIR
FT                   KAPVVIGDNISIGYVMWLSLTFDHRVLDGHTAAKFLKELTEILEDGNKLRAFLS"
FT   gene            complement(686417..687436)
FT                   /locus_tag="LS215_0775"
FT   CDS_pept        complement(686417..687436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0775"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34839"
FT                   /db_xref="GOA:C3MMZ9"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR011391"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR039065"
FT                   /db_xref="UniProtKB/TrEMBL:C3MMZ9"
FT                   /protein_id="ACP34839.1"
FT                   /translation="MTSIGIIINPESGRDIRRLVAKATFVSNYAKIDAIKRFLYGLNIT
FT                   NSIEEVVFMPDFYGISLDIIRDIKDDVKFKLRTLDMRIENTADDTINASKYMVENRVSV
FT                   IISAGGDGTLRAIYKGAGDKVPVLGLSLGTNNVLGALYEPTILGMIMGLLLEKNNIILN
FT                   VVERIKTIKLFVNNEFKNLALVDLTFMDGWYVGARAIWDEYSLRYAFISKGELGDVGIP
FT                   SIVSLVRPITFQDDLGLMVKFGLGKIKVNAAFAPGLVKEVFIDGINILKLGQEVHIPSD
FT                   NYVIAFDGEKEMIVNSNDEIMTRIDRDGPLLVSISKSLNYINTYYKEEMGELRWAKRY"
FT   gene            complement(687444..688418)
FT                   /locus_tag="LS215_0776"
FT   CDS_pept        complement(687444..688418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0776"
FT                   /product="Transketolase central region"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34840"
FT                   /db_xref="GOA:C3MN00"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN00"
FT                   /protein_id="ACP34840.1"
FT                   /translation="MRQITFTEAITEALRQEMERDPSVILIGEDIGVYGGAFGVTKGLV
FT                   EKFGSDRVIDTPISEAGFIGAAVGAALAGLRPVVELMFVDFFGVAMDQIYNQMAKLRYM
FT                   SGGQLKVPLTLRAPIGAGISAAAQHSQTLYSIFAHVPGLKVVVPSTPHDAKGLLISSIH
FT                   DDNPVVFLEHKVLYGIKGEVPEEEYTIPLGKADIKREGSDITIIGIARTVWNSLEAAEQ
FT                   LSKEGISVEVIDVRSIVPFDKETVIKSVKKTGRVVIVDEDYDRCGFASWVSSIIADEAF
FT                   EYLDAPIKRITTPNVPIPFSPPLEQYILPDSKKIINTVKSILG"
FT   gene            complement(688431..689429)
FT                   /locus_tag="LS215_0777"
FT   CDS_pept        complement(688431..689429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0777"
FT                   /product="dehydrogenase E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34841"
FT                   /db_xref="GOA:C3MN01"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN01"
FT                   /protein_id="ACP34841.1"
FT                   /translation="MVQDIPKSKLLDMYKKMLLIRYHELTAKELFAIGKIPGFVHLYVG
FT                   EEAVAVGVMSTLRDDDYITSTHRGHGHCIAKGLDVKRMLAEIMGKKTGVCKGKGGSMHI
FT                   FDYSKGMLGANGIVGGGAPHAVGAALAFKLKGLDRVAAAFIGDGAMNQGVVLESLNLSA
FT                   IWKLPVVFIVEDNMYAMSTRSLAPAKLQPSHSAAKSYVERALGFGIPAVEVDGMDVLAV
FT                   YEVAKEAVEKARKGGGPSLLHCKTYRFFGHFEGDSLVYRDKEEEEMWRKRDPITLFRDK
FT                   LVSNDIVNQEELDKIDREAKTEIEQALKFAEESPYPEVEEALTDVFTDNSY"
FT   gene            complement(690140..691363)
FT                   /locus_tag="LS215_0778"
FT   CDS_pept        complement(690140..691363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0778"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34842"
FT                   /db_xref="GOA:C3MN02"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN02"
FT                   /protein_id="ACP34842.1"
FT                   /translation="MKVVIIGAGPAGVYSALTLSKNAKVTLIEKEEKLGGTCVLYGCIP
FT                   TKSILSQLIISRQASNMSLNTFREYALASINTISKSLEQLLNSHGIEVIHANGFLRSSM
FT                   VHASNTSLTADKVLVSTGTRRERLGKVKFTEDLAYTNEDYNKVVIVGGDAGGIELAWMM
FT                   KKLDKEVHLIDKNDLLLQNIDNTLSEVVTNFLSHIGIKLYLGKKVSKIDETSVTLEDNQ
FT                   TISGDAVFVTFGRKPNIEGFEEIPHEKYIYVDEYLRTQIPNIYAAGDIIGTFTAHEAIY
FT                   GGIIAAKNMLGEKREFLVEGIPKVIYIYPQIAYVGTTIGNCVTFNTLNLTRTVVEREGE
FT                   GFLKICERDNRVIGGVAFMPYAEDVISLISVLIRYQINLKDTIDLVMPHPSYLEAITEA
FT                   LNMLQSKE"
FT   gene            691614..691907
FT                   /pseudo
FT                   /locus_tag="LS215_0779"
FT   gene            complement(691923..693599)
FT                   /locus_tag="LS215_0780"
FT   CDS_pept        complement(691923..693599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0780"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34843"
FT                   /db_xref="GOA:C3MN03"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN03"
FT                   /protein_id="ACP34843.1"
FT                   /translation="MMAKVFIKGLPSTMMDDFQLNVINLLQHAAENYGEREIKSRKLDG
FT                   KLEVFNYKTIYERVKRLANALESLGVKPTDRVGVLGFNTHRYFEAYFGISGIGAVMVEM
FT                   NFRLSSEELSYIAKHSKVKVIFTDEQLIPIVEKVNDKVNSDKVVIMTDKERTPSTKISK
FT                   VYHYEDLLKSSSPNYDFPIIDEKSACFACYTSGTTGMPKGVYYSHRAIVLHSMAVIQAV
FT                   PVNTNDALLQLVPMFHANGWGWPFTATMVGAKQVFPGQYSLDNLKLIIDLLINENITIS
FT                   NGVPTLWIAIHNYLLSLKDKPKFNNLKVLIGGSEPPLALIRGLREFGIEVIHGYGSTET
FT                   TPLSHLNIIKYYLGLSQEEYEELKSKQGIPVFPIQRKIVTPDGRDIPWDNKTIGELLER
FT                   GPWVVKEYYNDPRTFESFIGEGYEIWWKSGNAVTVDQYGYIKIADRLKDLIKSGGEWIS
FT                   SVDMENFLMAHPKVLEATVVGVPHPKWQERPLAFVVVKPEYKGNVTKEELLEHLLKRLA
FT                   KWQLPEIIFTDSIPKTSTGKFDKKLLREHYKEYFIKREIIE"
FT   gene            complement(693947..695920)
FT                   /locus_tag="LS215_0781"
FT   CDS_pept        complement(693947..695920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0781"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /EC_number="1.1.1.157"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34844"
FT                   /db_xref="GOA:C3MN04"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN04"
FT                   /protein_id="ACP34844.1"
FT                   /translation="MPIFSKVGVVGAGTMGHGIVEVAAISGYQVYLSDVSQDILNNALE
FT                   KIRWSLQKLKESGKLKESIDTIISRIKPTTNLNDFADADYIIEAVVENSEVKRKIFSEL
FT                   DGIVKPNAIFATNTSTIPISTLAEATKRQDKFIGLHFMNPPVLMPLVEIIMGNKTSQQT
FT                   LEITIEFAKSIGKDYVIVKKDVPGFLINRINGRTFAEAILMYDEGYQKEDIDAMTRFRL
FT                   GMPMGFLELLDFTGIDVSYNAALEAIKRGEKEPPHFKVLKKMVEEGRLGVKSGKGFYTY
FT                   KSKIYERPKIVPTDSMYLINPLSIIAPAVNEAAWLIRNNISSAEDIEKGMVKGMNWPQG
FT                   PLTFADKFGIDNIVNFLEQRYHDTGNDYYNPDSLLKEMVEQKKLGVKSGEGFFKWNYEK
FT                   VDFGPVRYEKLHDYAKITMRRAEKLNALNEAMWTGLTQAFNKAKEDKDVRAVIIMGEGR
FT                   AFCAGDDIEMMHYWENTASVIEWSQKISSPLIDTLTDYPKPIIAEVNGLAFGGGMELLI
FT                   LFDIVIASEDATFAIPEGLIGALPPLASSIGVGFISRKIARYALTGEWLSAKQAKELGL
FT                   VDTVVPPEQLEITGVEIVEKVKRVAPLSSMSIKRAINSIRNSYLDNLQIASQELTILST
FT                   TEDFKEGMKAFIERRQPRYKGK"
FT   gene            696003..696131
FT                   /pseudo
FT                   /locus_tag="LS215_3015"
FT   gene            complement(696262..696771)
FT                   /pseudo
FT                   /locus_tag="LS215_0782"
FT   gene            complement(696974..698047)
FT                   /locus_tag="LS215_0783"
FT   CDS_pept        complement(696974..698047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0783"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34845"
FT                   /db_xref="GOA:C3MN05"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN05"
FT                   /protein_id="ACP34845.1"
FT                   /translation="MVERETEAKSSATGVTNPYHRTEHCDKIHEYRCDKEVGVIGIDIS
FT                   KEHLITSRGRVRKYENNKKGYEEILKMKPCTIVLEPTGVYAIKPSQYFKEKGIKVLQVS
FT                   PNVLSREKELRGKKTDFYDAEKLENMVNKAKEYDYNPLKELVTLYLFLKDIETKYKNRL
FT                   KRALFLVSDNDKVSKDRLEKLAKGDFTQEVLYQLEYTPLVLEEIKILAKNLLEIQERLK
FT                   EVRRMIEGQVPQDHVLLTIPGVGKLAAGIIIGIVGDVKRFPKPESFVAYCGLDPVVERS
FT                   GRAVVSRGISKRGNKYLRSLFYFLAMRSYSRNPTLLKFYETHKDRLKGRKLYVALARKL
FT                   ARVVWSVWYNNKPYEPK"
FT   gene            698882..699106
FT                   /locus_tag="LS215_0784"
FT   CDS_pept        698882..699106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0784"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34846"
FT                   /db_xref="GOA:C3MN06"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN06"
FT                   /protein_id="ACP34846.1"
FT                   /translation="MTSEWWIKNVPRDYIAYWNLNNKTIKDTSATAIAALSLLKLSYWE
FT                   FAKNTIESLVENYLINSKIPRALTNVCYF"
FT   gene            699367..700512
FT                   /locus_tag="LS215_0785"
FT   CDS_pept        699367..700512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0785"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34847"
FT                   /db_xref="GOA:C3MN07"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN07"
FT                   /protein_id="ACP34847.1"
FT                   /translation="MDKESFIRNFNEISFNMKGKSMLIKNGDLLDSVAIPASLVEESRR
FT                   LNVPIMAVVGSKISGVSLGYFQDLDTEVNLEEAKRRGIQVVRRLGVGGGTIYSDKNSSM
FT                   ALYMAIPSDFFPNMDKAFCQIGSATAHAYYKLEVKGAWYDHIGDVRVGSPKSHKKITGF
FT                   GFTTIGNTLVLNMVIGIGKLNVEEMVKVLRIPPEKFKDKTAKGPQDYVSSVEEETGYKP
FT                   SMEEVYNAFVSSFGETLRLDLEEHELSDEAKKIREEYRKIASSEEHLYLRSSGKRFANI
FT                   PPNHVLGFARYKARKLLVVHLLTDKKVIKDIMISGDFYCSPTQYLFDFENSLKGIEINN
FT                   LEEISKKVSELYSRNGWEMPMVSQEDILTVIKMAIGDAKSK"
FT   gene            700602..702146
FT                   /locus_tag="LS215_0786"
FT   CDS_pept        700602..702146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0786"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /EC_number="1.3.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34848"
FT                   /db_xref="GOA:C3MN08"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN08"
FT                   /protein_id="ACP34848.1"
FT                   /translation="MEPLPWWKEEHKSLAEEVENFVEENRGRAEEALWKNEYPMDLHKK
FT                   IVEKGWWGVVIPREYGGMGGDYTSVAIISEYISNLGSVGGVFATTLFGGLYQILRFGNE
FT                   EQKAKSLPKFAKGTVGAVCITEPYVGSDAAGAETIAIKEGDKYIINGKKRFITNAGMAD
FT                   IYVVYAVTDPSSKARKSYSHLSAFILEKGMKGFHVEKINELQGFDGLLNGYLDLDHVEV
FT                   PVENRLSEEGQGWWILVSGLNFERLVIGAQQVGLLRELARYVAFYTRRRVQFNQPTFEY
FT                   EANQYKLADIIIDYRITRLLTYYTAYLMDQGVDPVIDANVLKAFSTEAVEKASRDAIQA
FT                   MGGDGWTKFYPVEAIYRNAKLGTIGGGTSEVLKRFIVRYALTAMADDLKTPIRISHPEL
FT                   KVPITVSEKSITKEKLQGGEEGEMEILRVLARDYLVNPGLFMELNDIKRFIECDEKQLV
FT                   EIINSLEAKGLVKVLRDRDKPRLVKATYDGLRKAYPREYYMYFPRWVKEKMSEYIF"
FT   gene            complement(702149..702829)
FT                   /locus_tag="LS215_0787"
FT   CDS_pept        complement(702149..702829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34849"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN09"
FT                   /protein_id="ACP34849.1"
FT                   /translation="MILKNKLHELFESIDVRGIEDLPKKGLKIGIKFGNCYFTVILDKS
FT                   KISVVENKLDNLDNEIITDEESLNQLLEGKVSLIDLIIQGKLYISGKLSNLLKLVEVFR
FT                   AKAINLGFEGSSLYNVLKAVFEGICNKNEDILRHIKNFNVTFQFSDFEGSICCLIINDG
FT                   KFIVKNGKCEGKPTASISAKREVWNKIFNGEESVGTVAMNGEAKIEGNLIQAFKLKTII
FT                   DKIF"
FT   gene            702911..703912
FT                   /locus_tag="LS215_0788"
FT   CDS_pept        702911..703912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0788"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34850"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN10"
FT                   /protein_id="ACP34850.1"
FT                   /translation="MPESITKNLFKLSIKLPDLAIESLNAYLLTLNDKNILIDTGSPSY
FT                   GSISSLVEELENLGMKISDINEIIITHFHIDHIGLAYLLSKLAKVKIIIGNVEYNFIKR
FT                   FRYRYDEMIKILKLNGASQQLLDIAFDFTSGFRANIYSRVGELNNVETVNDSQQLYNLK
FT                   FLFTPGHTIGHICIYDEENKLLLSGDTLLADITPNVSLYEENCNPLNEYLKSLKRISSL
FT                   EVKKSLPAHGRIIENTEERIRELIKHHEERLNEMLEMMGNRELAAYEIASKIKWKLKYN
FT                   GWDELDPSQKYLAMGETLAHLKYLEDINAVRKRISDGMIKYIKQKENIKISL"
FT   gene            complement(703902..704270)
FT                   /locus_tag="LS215_0789"
FT   CDS_pept        complement(703902..704270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0789"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34851"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN11"
FT                   /protein_id="ACP34851.1"
FT                   /translation="MNLNEIIQTYYEYFNKEKLPYIKCTNCGHVFYYPRAICPKCLSKK
FT                   LLIMESKGEGEIYSETKFVNEKGQVTIVGLIKLEEGFMIYANILTNRLEDVSMNKKVKV
FT                   KFKEVIKEQKFPFFTTIS"
FT   gene            complement(704267..705436)
FT                   /locus_tag="LS215_0790"
FT   CDS_pept        complement(704267..705436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0790"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.176"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34852"
FT                   /db_xref="GOA:C3MN12"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN12"
FT                   /protein_id="ACP34852.1"
FT                   /translation="MLLGFSSRYEKVYQGLALDLIAETVKEALDMAKLEPKDIDGVITT
FT                   WLPWIFDGTLAIGFPENYISEYLGIRPKFTDLVQYGGASALEMFYRAYKAVKSGEADRV
FT                   LCVIGGKGTLMKKQLREGGLERFSEVELLNILRNNPFDEFIRVYQEMDPISFYAMVAAR
FT                   HSKLYGTTDEQRALLAVQQRYNANSNERALFRGPLTVKDIINSRVVSTPLHLLEITYPI
FT                   DGVLAFIVGKGTSQLRSMDVISYGDAIWPEFFAERDVDIVYTPTIESAKKIDFNLNKID
FT                   AFEIYDAFTIMVLTELEDLGLTEKGKIGKFVEENDLTIKGSIPVNTGGGSLNMGQPAYM
FT                   SGIIVLEEAFLQFNNMAKGHQVSGADYILVNGLGGWNTHATTLVIGEKK"
FT   gene            705590..706777
FT                   /locus_tag="LS215_0791"
FT   CDS_pept        705590..706777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0791"
FT                   /product="Propanoyl-CoA C-acyltransferase"
FT                   /EC_number="2.3.1.176"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34853"
FT                   /db_xref="GOA:C3MN13"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN13"
FT                   /protein_id="ACP34853.1"
FT                   /translation="MVDVAIVGTGHSKFGNRTDVNLQELAWEAVKQALEESNLDQKDID
FT                   MFVVGNAGGWSSEPLSAIVIGEYCNLAPKGTMRVEAACATGSAALRIAYQAIKSGDAKM
FT                   AMVIGVEQMHQSPNPVAVEMMGRAGNYFWEFENFGLTFPGYYGLYATRRMAKFGMKEED
FT                   LGQIAIKNHYYGSFNPYAMFQKQIKMDEYMKSRVVAYPLKVYDACPITDGAAAIILASE
FT                   EVAKKITDSPVWIVSQGFKSGTANLSKRDDFISIDAARLAAEEAYKKAKIDFENSWKYF
FT                   DVADVHDCFTIAEIMAYEDLGFAKRGEGHLLAREEQTYIGGKIPINVDGGLKAKGHPIG
FT                   ATGVSMAVSITRQLLYRAHKGTQVEVRNGMGITHNVGGTGHYAYVTIFSTKKPSV"
FT   gene            706783..707328
FT                   /locus_tag="LS215_0792"
FT   CDS_pept        706783..707328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0792"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34854"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN14"
FT                   /protein_id="ACP34854.1"
FT                   /translation="MGVTEIRGKQFNEIDKKALEQIDLLIKNSGMPIMRDLKNTNLLWV
FT                   DVRELTQRFMIPIGRIYKFFDQLSKGKIVGTKCPKCGSIYFPPQDDCTKCKVSGLDTIE
FT                   LSGEGELLTYTIITVKPVSFMHYQDYIVGIARLKEEINILAWVNEKPEDIKVGMKVKVN
FT                   IVRREPEGYFIYELRKVQ"
FT   gene            707420..707878
FT                   /locus_tag="LS215_0793"
FT   CDS_pept        707420..707878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0793"
FT                   /product="MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34855"
FT                   /db_xref="GOA:C3MN15"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN15"
FT                   /protein_id="ACP34855.1"
FT                   /translation="MSSTKTSPLTFDDFEIGMKFVSPRITVTDAHIVLFAGLSGDFNPL
FT                   HVDDVFAKKTIFGSRIAHGLLTITLLSGHMGMLVAGTAIAFLEMHTKFLKSVRVGDTIY
FT                   GEAEVIDKKPVEKYNGGVVTIRSLIKNQNNEIVVESESKLLVTRVRMY"
FT   gene            707946..709628
FT                   /locus_tag="LS215_0794"
FT   CDS_pept        707946..709628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0794"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34856"
FT                   /db_xref="GOA:C3MN16"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN16"
FT                   /protein_id="ACP34856.1"
FT                   /translation="MVSPIYDYQLTIDKIIEWAAYAYPDQEIVYAPPKAPKVRLTYSKL
FT                   YERARRMGSVLSQFKIKQGDKENLGTRIGVMDWNTSRFLELYYAIPMSGAVMHTVNVRL
FT                   SPEEMAHTINVAEDEIIFTNEDFLPLLSSLLPKLPTVKKVIVMSDKNEDINVKLSNVEV
FT                   YEYEKLSREGDPNYTPPELDENTIATLVFTSGTTGLPKGTYFRHRDMVLHSIVVNAGVW
FT                   NAPPLNLTHKDVWLQIPPLFHAHGWGSPYSSLLLGMKSVYPGRYDWNYIIRIIKEEGVT
FT                   YTAGVPTMLYLIINSPELANYDLRGFKFIVAGQAIPKGLYEEAKKKGILISQGMGMTET
FT                   APLMGGLTFKPKMENWSEEKKEEYILYRAGRPAPLVFIRVVDPDMKDVPKDGKTMGEIV
FT                   VRAPWMTRGYYKDPKKTEETWRGEWLHTGDLAIWDEEGYIAYIDRVKDVIKSGGEWIPS
FT                   TRLEDLISTHPGVAEVAVIAAKHEKWVERPVAIVAPKQEYKGKLTENDIMQHLNKFVSQ
FT                   GAIPKWWVPDKIIILEVELPKTSTGKTDKKALRDKYSNILSQN"
FT   gene            complement(709629..710741)
FT                   /locus_tag="LS215_0795"
FT   CDS_pept        complement(709629..710741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0795"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /EC_number="5.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34857"
FT                   /db_xref="GOA:C3MN17"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN17"
FT                   /protein_id="ACP34857.1"
FT                   /translation="MKISDIKTYRVKIPLRESIQFSWEPFPNTHFEFILIEVVNSKGIK
FT                   GYSATQFTAQTEVAIRGLKPLLKGLDVEDFLANDRLLELGSWFFGRIGAIEVALLDLLA
FT                   KEENLPLYKLFRGNRKRIRVYASTGRLAKAEEIINLIKKYYDIGIDIVKIRFHRITIND
FT                   DLNIVKEIRKEFGEQIKIAVDANQAWGLVSPFWNRYDALKVAKELERYNIEWLEEPLFK
FT                   DDIEGYAWLRRNTSVKIAAGELEHNFWIFKKFIEENALDIVQADAIYSNGISECIKIAL
FT                   MAQVNGLLFLPHAWDPGLGWLANLHLTASLPESLTPYLETPLDPLWWFNDVIQFAFKEG
FT                   IEIQNGYVRVPEKEGLGIELDMEKIKKFIT"
FT   gene            710851..712131
FT                   /locus_tag="LS215_0796"
FT   CDS_pept        710851..712131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0796"
FT                   /product="General substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34858"
FT                   /db_xref="GOA:C3MN18"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN18"
FT                   /protein_id="ACP34858.1"
FT                   /translation="MGYFDNVPTSIKVKSFFVSSAGFFLDGYDLSVISFAVYFIANEFK
FT                   LISIQTGLITSASLIGMIFGAMLFGWLSDKMGRSRIMGIDLIFFAVFGLASALSQNFLE
FT                   LFISRLLLGIGIGGDYPVSSTLMAEFSPSISRGRYLTGSVSMYWIGTLLSALVTLFLLP
FT                   LGPYFWRWVFLVGAIISIPIILIRIRLSESPRWLISKGIIKDNNLLRQDDENKGVEGYL
FT                   DLFKGEVLYVTIFVSSVWFLFDVASYGIGLYYPFILRQFAFPSNYEVLYGTMLIAIGAI
FT                   IGYTIAEFFIDSLGRRVVLLVGLGSMAFLLILGGLVKVTGALLVPYFMSFVALEQWAGA
FT                   VTLFYPTELFPTSIRSSGQGFATSVSRIGAVLGVTYFPAMTKLLGFSASLLVFGIICTL
FT                   AFIISLLMAKETKKKSLEETSIGLKTI"
FT   gene            complement(712124..712987)
FT                   /locus_tag="LS215_0797"
FT   CDS_pept        complement(712124..712987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0797"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34859"
FT                   /db_xref="GOA:C3MN19"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN19"
FT                   /protein_id="ACP34859.1"
FT                   /translation="MGYVDSHVHIWVEEILSEEMKRRISGIAKNAENRTNVNDVIKEMD
FT                   EANLDYVVNIVYPSREMWGSNEEIVIRAIDFFRKYSDRFSIVGGVQVNHLSESETKYWI
FT                   ERQYEAGVSGFKIHPPHMWLKPNAYRQEEGGLKQLEILYEFAQDHKMPIIIHTGTSYFP
FT                   FARNKYGDPVFADDLSVDFPKLSIILAHAGRPIWVNTAFQLTRIRRNIYLDLSSIPPRK
FT                   VLEYLPRLEEIKDKCLYGSDYPDIGVKGIKENLLEFLHMQISKEAMDKIVQINPKNFFK
FT                   PLSYTR"
FT   gene            complement(713165..715009)
FT                   /locus_tag="LS215_0798"
FT   CDS_pept        complement(713165..715009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0798"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34860"
FT                   /db_xref="GOA:C3MN20"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN20"
FT                   /protein_id="ACP34860.1"
FT                   /translation="MELYSLSKIRKFIKEVEENPLKFWWETRNMIKWIVEPRDVAEGEP
FT                   PKIRWYIGGKSNICWNAIDVNLDENKDKVAFYYMNENGFTKVITYWDLFYEVNRVSYLL
FT                   KELGVKKGDTVSLLMPNIPEALYFALAIYRLGGIIAMHYLGLSPQIFAERLNDSGSKIL
FT                   VTASKGFRNGSEIRIKDYVDKVLSEYKTPVEKVIVVGRGFSDFNLVQNRDLLYEDVVPK
FT                   GKIYVKPEEIESNDPVIIAYTSGTTGKPKGIYSSLAYIVASTWALKAVLGFREGEDVIW
FT                   ILSDLGWLTWGGNIHFIPQKRLTGVIFEGFIGYKRELFSRVIERFNVNLVWMPTTLLNM
FT                   LKSLGEKSVKAGDISSLRLILNTGEPLNAGTWQWLRENMPDVFIADSYWMTEYGFPIAA
FT                   TPFGLGEIPYKPGSAGLKFFGVKVVDDDGKPLPPNQKGYIVLSMLNPAMGRLWNDPNME
FT                   RFIKIYTSRFPNYVYTGDYGFYDDDGYLYVLGRVDDIILAGGNRVGTMEIEGILVSNPN
FT                   IAEAAVVGYNRNNSYRVAAFIVPKADINISVDSVRNYLRDKGYLVDDIFIVRRLPKTKS
FT                   AKIMRRLLRALLSNEQLGDISALDDINVLNELREVINK"
FT   gene            complement(715085..715867)
FT                   /locus_tag="LS215_0799"
FT   CDS_pept        complement(715085..715867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0799"
FT                   /product="Acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34861"
FT                   /db_xref="GOA:C3MN21"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN21"
FT                   /protein_id="ACP34861.1"
FT                   /translation="MKGKLNVNQVFAMPGNAPLYLKPPAYYRDCPILMGVFKGNSDGIS
FT                   ETIPDNLDLVTLGDNKPLFLYFQAYYPFSSLYGSYNEVVLAPLVIYQNQPHLFVSYIYV
FT                   DNDAALTAGREIWGFPKKFANMKLEIKGESVEASLERPTGRKLISAQMRIERQAKLEEL
FT                   QSSGIGSSPTLLLKIIPNPDAESKPSIELVKVEVKMMPRVSTSDNSLELWTGKLLLNFV
FT                   EESLTDPLFKFGPVELVSAYFGRFDMILPPGKVIYKYI"
FT   gene            715968..717365
FT                   /locus_tag="LS215_0800"
FT   CDS_pept        715968..717365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34862"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN22"
FT                   /protein_id="ACP34862.1"
FT                   /translation="MISEKERELLRRVWNESLMKQLAHVRSRRFGLGYRYDTGEAIRKG
FT                   NLVIEYPKGLLEFKSQKKPIPLSDVENALITWAAAGPNGLILADLGVSNNVATFIYATG
FT                   RTIPGPDNDQALDLIYIIDDGVYFYKPPQASKIYEIESEEDLGKIVDWYKNYSIKLANG
FT                   RTDLAGTLPFAMVFNKNFNENGSSLLLPIYDASRVIVNILFHYFEYERVPIIDDNTGQL
FT                   ADQNGAMKRLVDKGILSSQIPMTMDLLDRAIGAVAGVVVGTSVQNVRLMSEAIGLGDWI
FT                   FGGIYDYTIMGAFAPQFRGLEEAGAVVCQPPEKSKRIWPYKVGIKNVKMSFSIIEGCKD
FT                   SSYKNGRELVEAFLDIKYGKYKEPNNLEYDGIWSPNRDPNLVAWKRDIYEMLRRDEKIK
FT                   VKEDIKEAVISFIDYSVAKYGMFPRVDPIWIPMAIQVHHLDIDFYKKYYKEEVLTENIL
FT                   RHFEIWH"
FT   gene            717379..717768
FT                   /locus_tag="LS215_0801"
FT   CDS_pept        717379..717768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34863"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN23"
FT                   /protein_id="ACP34863.1"
FT                   /translation="MKFPSLEWAEKLCNEINNIEIDEIRSWNWDILFILRNVKNNDMKF
FT                   KVNIKAGKCLGVEEDGGADYIIEGDYDIWKSILLGELDLAVALLAGKLKLIKGDRLNLL
FT                   RHIRAAVNIASIIRAKGLTNDLEIM"
FT   gene            717816..719363
FT                   /locus_tag="LS215_0802"
FT   CDS_pept        717816..719363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0802"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34864"
FT                   /db_xref="GOA:C3MN24"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN24"
FT                   /protein_id="ACP34864.1"
FT                   /translation="MKYEELVRNFSWNEVKNYFGKDFRDKLIRDSSDTAVFRVDSKWDK
FT                   ESLSYSQLKDKAQRLSAFLRHQFKVKKGDVVACLASKKVEQVVYLVSSWILGVIYEPLF
FT                   TAFGPAAIEMRTRDRKPKVILAQDDQYDKIKDMFNNIITFPGKTGNSVSLDEAISYDML
FT                   RREEWEKISYDDPSGLQYTSGTTGRPKGALQNFRTLYSLYVYIKYGIGLREDDVFWTPA
FT                   DPGWAYGLGVGIISPIIFGKTVIFFDKLFSPEDTLKFIEDFKISNFAFVPTAYRMIMGT
FT                   VKEPKKFNLRITRASSAGEPLNPEVIRWFKENLGFMIKDHYGQTESGMVVYNGWGYEAD
FT                   VKPGSMGLPAPGYQVTVIDGVIAVNKNCEGFYFLGYINDEERTKKVFKGDWYLTGDAAE
FT                   IDKDGYFWFIGREDEVIKVSGYRASPFEIESVLIQHPAIMEAAVIGVDDPVKGKIIKAY
FT                   VVLKPNYKPSSDLANEIINFVREKYSRHAYPREVKFVTSLPKTESGKIQKYKLKELG"
FT   gene            719482..720579
FT                   /locus_tag="LS215_0803"
FT   CDS_pept        719482..720579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0803"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34865"
FT                   /db_xref="GOA:C3MN25"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN25"
FT                   /protein_id="ACP34865.1"
FT                   /translation="MNIIRLLYFEGADPQIFNLASILSYAYSTGELKEMPPTLIVMEGF
FT                   SRPFSYLGYYQDVDKEVKLDNVTKYNVELVRRWKLGMGNIFMDKITGGWAIIFPQKVFK
FT                   NSAEAYDILVGKVFLDTVKNLGVTNAEYVSPNDIRVKGKKLCGTGVSILNDKREVVFFN
FT                   GFTNLWKPDPELPFKILNIPPEKFADKAIKKPEEYFAAIEIDGNSTPKLGDFREALVKA
FT                   VSKEFNTKLETEELSDEEENIWRKYLNILKSEEFIFRRSTGKFITKNRGYEYRFAQKKY
FT                   RKLVQASLALDDNNRIKDVMITGDFGLVPPDLDEDITKELIELTCDDFEVAKNRVLKLM
FT                   KNGYEIIGASPEEFITPVFMACRGY"
FT   gene            720663..721448
FT                   /locus_tag="LS215_0804"
FT   CDS_pept        720663..721448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0804"
FT                   /product="PaaX domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34866"
FT                   /db_xref="GOA:C3MN26"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN26"
FT                   /protein_id="ACP34866.1"
FT                   /translation="MKLKTLIFTILGDYNLSKKNGAIRARSLVKLVGPFGFTNSAVRTT
FT                   LHRLKREGLITSVNRGSYTFSQETLLKFETAIRRVKEWRFGHWDGKWRVVVYNFGEDNK
FT                   ALRNKIRRELKWLGFGTLASSTWVSPNPLEDVVNEMIEKYWKDGGKVYLFIAYFPQDPQ
FT                   IIIRTCWNLSEIELKYKEFISKWIGLLNKIDKLSPAEAFVNKITILHEYRKFLHIDPGL
FT                   PEELLPNNWIGYEAYKLFKNIYDSLTPLANKYFESVYEE"
FT   gene            721469..722845
FT                   /locus_tag="LS215_0805"
FT   CDS_pept        721469..722845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0805"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34867"
FT                   /db_xref="GOA:C3MN27"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN27"
FT                   /protein_id="ACP34867.1"
FT                   /translation="MEITYVSLATLLYEKGKTNPSKAFLIGEKMLTYNDVIEEISSIAS
FT                   NFSPGETVVHLMYNSIPSILAYLAAFWAGSKIIALDPLTSAEDLKFILEDTKPAVVITD
FT                   DEIYNREKDILKGYKVITQLQKKEEIREPYEYKDNEAGLIYYYAGIAGKTMQVLHSPRR
FT                   VIKNIEESYNTSQIQEVRSVLTVPLAHVLGNSMFGITIKSGGTVYVMKKFNVKELINAI
FT                   QTYRINYLSTVPMIYDSLLSENADLSSLELCISSAAPLFSNTLKSFKEKYGKDILQAYG
FT                   CTECLGVTYQPKEYAGILTIGKPLPSVEIKIVKDDGKEAKIGEVGELWVKSPWVMLGYK
FT                   DQSETKKVFEGDWLKTGDLVTMDERGLLYFRGVKKRMLKYKGYPIFPRDLEDILKTHEM
FT                   VIDAKVLGEDESNLGQKPVAYVIVKERRSGLEEELLNFVNSKVAFYKKLKKVYIVDKLP
FT                   "
FT   gene            722857..723255
FT                   /locus_tag="LS215_0806"
FT   CDS_pept        722857..723255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0806"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34868"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN28"
FT                   /protein_id="ACP34868.1"
FT                   /translation="MSVTQQDLIAYIESHPMSKLLELKVEEITEDCVVVKFPFKELISI
FT                   PGDMVHGGISMHVLDTVCWSVARLVSDTQVLTLELKFSFLEPLKGKEFKVIGKILKKGK
FT                   RTIFAEGEIYNDKGKLCVKALGTFMKVS"
FT   gene            complement(723297..724220)
FT                   /locus_tag="LS215_0807"
FT   CDS_pept        complement(723297..724220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0807"
FT                   /product="peptidase S15"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34869"
FT                   /db_xref="GOA:C3MN29"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN29"
FT                   /protein_id="ACP34869.1"
FT                   /translation="MRNDGEYNFKRLNVEFYSEGVKLKGWLYLPEGSEKFPAIVMAHGF
FT                   SAVKEMYLDSFAEVFAKAGFVVLVYDNRNFGESEGEPRQEIDPWQQVKDYRYAISHVRL
FT                   RPEVDPERIGIWGTSYSGGHVIVVGSLDSRVKAIVAQVPLVSGSENLRRLVKSDMIPQL
FT                   RAMFAEDYERRMKGEKPLTIPVVCKSPPEMCALPTADAYEWFTETGKKRAPNWKNEVTL
FT                   RSVEYLSMYEPINFIRGVSPKPIMLIVAQNDVLTPTDLALEAYERALPPKELEILPGGH
FT                   FDAYVKEFERSSKIARDFFLQHLGKK"
FT   gene            724798..724953
FT                   /pseudo
FT                   /locus_tag="LS215_0808"
FT   gene            724992..725417
FT                   /pseudo
FT                   /locus_tag="LS215_0809"
FT   gene            725624..726478
FT                   /locus_tag="LS215_0810"
FT   CDS_pept        725624..726478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34870"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN30"
FT                   /protein_id="ACP34870.1"
FT                   /translation="MCIALTILSEEHLDKIYENSIELPENVNIPCDFRFSEVAEIRLRS
FT                   VEQCVKEGKKVELSLLLDLLSVGNVNIRERAWDLLPTNKIARDLTVDLLAHEDHSVRFT
FT                   AWSRNYNVLPNEILKDRIRYFIRLLISHYYIALEAWNLLPKLAKLIPKDYLIELLKFDD
FT                   EYYRALAWWKIADRVLSTDEVKEYLTYYIALLKSERENHRLWMWKLVPKFIKISDKKEI
FT                   MNNLNYFLELLKSEDEDIRIEALLNEEDIKQYSKYLLEPLHSKEKSIRVRAWRLVIKLL
FT                   TDF"
FT   gene            726875..727276
FT                   /locus_tag="LS215_0811"
FT   CDS_pept        726875..727276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0811"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34871"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN31"
FT                   /protein_id="ACP34871.1"
FT                   /translation="MGVRVRIRLEAITGKSTEIVALLNSGAESPEPSIALPTEIAEELK
FT                   LNELKAETTYSEEATTYVEVKLYKKAIKGTLLDNGEELTSVILDVAVAEGLIEPLLSDS
FT                   AIDAFNIEIISFSKGLWRIRGENKIRKNV"
FT   gene            727518..727775
FT                   /locus_tag="LS215_2997"
FT   CDS_pept        727518..727775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_2997"
FT                   /product="transposon"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_2997"
FT                   /db_xref="EnsemblGenomes-Tr:ACP34872"
FT                   /db_xref="UniProtKB/TrEMBL:C3MN32"
FT                   /protein_id="ACP34872.1"
FT                   /translation="MRLYYWGTMISKTKLRHLTALILNYVFSALNLSPRFHTIDEVAKA
FT                   LSAYYLGLSLRRVEALFHVPVQYYWRKLADYSSPPSCSGG"
FT   gene            727830..728159
FT                   /locus_tag="LS215_0812"
FT   CDS_pept        727830..728159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LS215_0812"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LS215_0812"
FT