(data stored in ACNUC7421 zone)

EMBL: CP001404

ID   CP001404; SV 1; circular; genomic DNA; STD; PRO; 2812165 BP.
XX
AC   CP001404;
XX
PR   Project:PRJNA18651;
XX
DT   30-APR-2009 (Rel. 100, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Sulfolobus islandicus Y.N.15.51, complete genome.
XX
KW   .
XX
OS   Sulfolobus islandicus Y.N.15.51
OC   Archaea; Crenarchaeota; Thermoprotei; Sulfolobales; Sulfolobaceae;
OC   Sulfolobus.
XX
RN   [1]
RP   1-2812165
RX   DOI; 10.1073/pnas.0808945106.
RX   PUBMED; 19435847.
RA   Reno M.L., Held N.L., Fields C.J., Burke P.V., Whitaker R.J.;
RT   "Biogeography of the Sulfolobus islandicus pan-genome";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(21):8605-8610(2009).
XX
RN   [2]
RP   1-2812165
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Sims D.R., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Anderson I., Whitaker R.J., Richardson P.;
RT   ;
RL   Submitted (30-JAN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 369cf346b3b5e4eba4c004f93b29862b.
DR   BioSample; SAMN02598411.
DR   EnsemblGenomes-Gn; EBG00001224520.
DR   EnsemblGenomes-Gn; EBG00001224521.
DR   EnsemblGenomes-Gn; EBG00001224522.
DR   EnsemblGenomes-Gn; EBG00001224523.
DR   EnsemblGenomes-Gn; EBG00001224524.
DR   EnsemblGenomes-Gn; EBG00001224525.
DR   EnsemblGenomes-Gn; EBG00001224526.
DR   EnsemblGenomes-Gn; EBG00001224527.
DR   EnsemblGenomes-Gn; EBG00001224528.
DR   EnsemblGenomes-Gn; EBG00001224529.
DR   EnsemblGenomes-Gn; EBG00001224530.
DR   EnsemblGenomes-Gn; EBG00001224532.
DR   EnsemblGenomes-Gn; EBG00001224533.
DR   EnsemblGenomes-Gn; EBG00001224534.
DR   EnsemblGenomes-Gn; EBG00001224535.
DR   EnsemblGenomes-Gn; EBG00001224536.
DR   EnsemblGenomes-Gn; EBG00001224537.
DR   EnsemblGenomes-Gn; EBG00001224538.
DR   EnsemblGenomes-Gn; EBG00001224539.
DR   EnsemblGenomes-Gn; EBG00001224540.
DR   EnsemblGenomes-Gn; EBG00001224541.
DR   EnsemblGenomes-Gn; EBG00001224542.
DR   EnsemblGenomes-Gn; EBG00001224543.
DR   EnsemblGenomes-Gn; EBG00001224544.
DR   EnsemblGenomes-Gn; EBG00001224545.
DR   EnsemblGenomes-Gn; EBG00001224546.
DR   EnsemblGenomes-Gn; EBG00001224547.
DR   EnsemblGenomes-Gn; EBG00001224548.
DR   EnsemblGenomes-Gn; EBG00001224549.
DR   EnsemblGenomes-Gn; EBG00001224550.
DR   EnsemblGenomes-Gn; EBG00001224551.
DR   EnsemblGenomes-Gn; EBG00001224552.
DR   EnsemblGenomes-Gn; EBG00001224553.
DR   EnsemblGenomes-Gn; EBG00001224554.
DR   EnsemblGenomes-Gn; EBG00001224555.
DR   EnsemblGenomes-Gn; EBG00001224556.
DR   EnsemblGenomes-Gn; EBG00001224557.
DR   EnsemblGenomes-Gn; EBG00001224558.
DR   EnsemblGenomes-Gn; EBG00001224559.
DR   EnsemblGenomes-Gn; EBG00001224560.
DR   EnsemblGenomes-Gn; EBG00001224561.
DR   EnsemblGenomes-Gn; EBG00001224562.
DR   EnsemblGenomes-Gn; EBG00001224563.
DR   EnsemblGenomes-Gn; EBG00001224564.
DR   EnsemblGenomes-Gn; EBG00001224565.
DR   EnsemblGenomes-Gn; EBG00001224566.
DR   EnsemblGenomes-Gn; EBG00001224567.
DR   EnsemblGenomes-Gn; EBG00001224568.
DR   EnsemblGenomes-Gn; EBG00001224569.
DR   EnsemblGenomes-Gn; EBG00001224570.
DR   EnsemblGenomes-Gn; EBG00001224571.
DR   EnsemblGenomes-Gn; EBG00001224572.
DR   EnsemblGenomes-Gn; EBG00001224573.
DR   EnsemblGenomes-Gn; EBG00001224574.
DR   EnsemblGenomes-Gn; EBG00001224575.
DR   EnsemblGenomes-Gn; EBG00001224576.
DR   EnsemblGenomes-Gn; EBG00001224577.
DR   EnsemblGenomes-Gn; EBG00001224578.
DR   EnsemblGenomes-Gn; EBG00001224579.
DR   EnsemblGenomes-Gn; EBG00001224580.
DR   EnsemblGenomes-Gn; EBG00001224581.
DR   EnsemblGenomes-Gn; EBG00001224582.
DR   EnsemblGenomes-Gn; YN1551_R0001.
DR   EnsemblGenomes-Gn; YN1551_R0002.
DR   EnsemblGenomes-Gn; YN1551_R0003.
DR   EnsemblGenomes-Gn; YN1551_R0004.
DR   EnsemblGenomes-Gn; YN1551_R0005.
DR   EnsemblGenomes-Gn; YN1551_R0006.
DR   EnsemblGenomes-Gn; YN1551_R0007.
DR   EnsemblGenomes-Gn; YN1551_R0008.
DR   EnsemblGenomes-Gn; YN1551_R0009.
DR   EnsemblGenomes-Gn; YN1551_R0010.
DR   EnsemblGenomes-Gn; YN1551_R0011.
DR   EnsemblGenomes-Gn; YN1551_R0012.
DR   EnsemblGenomes-Gn; YN1551_R0013.
DR   EnsemblGenomes-Gn; YN1551_R0014.
DR   EnsemblGenomes-Gn; YN1551_R0015.
DR   EnsemblGenomes-Gn; YN1551_R0016.
DR   EnsemblGenomes-Gn; YN1551_R0017.
DR   EnsemblGenomes-Gn; YN1551_R0018.
DR   EnsemblGenomes-Gn; YN1551_R0019.
DR   EnsemblGenomes-Gn; YN1551_R0020.
DR   EnsemblGenomes-Gn; YN1551_R0021.
DR   EnsemblGenomes-Gn; YN1551_R0022.
DR   EnsemblGenomes-Gn; YN1551_R0023.
DR   EnsemblGenomes-Gn; YN1551_R0024.
DR   EnsemblGenomes-Gn; YN1551_R0025.
DR   EnsemblGenomes-Gn; YN1551_R0026.
DR   EnsemblGenomes-Gn; YN1551_R0027.
DR   EnsemblGenomes-Gn; YN1551_R0028.
DR   EnsemblGenomes-Gn; YN1551_R0029.
DR   EnsemblGenomes-Gn; YN1551_R0030.
DR   EnsemblGenomes-Gn; YN1551_R0031.
DR   EnsemblGenomes-Gn; YN1551_R0032.
DR   EnsemblGenomes-Gn; YN1551_R0033.
DR   EnsemblGenomes-Gn; YN1551_R0034.
DR   EnsemblGenomes-Gn; YN1551_R0035.
DR   EnsemblGenomes-Gn; YN1551_R0036.
DR   EnsemblGenomes-Gn; YN1551_R0037.
DR   EnsemblGenomes-Gn; YN1551_R0038.
DR   EnsemblGenomes-Gn; YN1551_R0039.
DR   EnsemblGenomes-Gn; YN1551_R0040.
DR   EnsemblGenomes-Gn; YN1551_R0041.
DR   EnsemblGenomes-Gn; YN1551_R0042.
DR   EnsemblGenomes-Gn; YN1551_R0043.
DR   EnsemblGenomes-Gn; YN1551_R0044.
DR   EnsemblGenomes-Gn; YN1551_R0045.
DR   EnsemblGenomes-Gn; YN1551_R0046.
DR   EnsemblGenomes-Gn; YN1551_R0047.
DR   EnsemblGenomes-Gn; YN1551_R0048.
DR   EnsemblGenomes-Gn; YN1551_R0049.
DR   EnsemblGenomes-Gn; YN1551_R0050.
DR   EnsemblGenomes-Tr; EBT00001793293.
DR   EnsemblGenomes-Tr; EBT00001793294.
DR   EnsemblGenomes-Tr; EBT00001793295.
DR   EnsemblGenomes-Tr; EBT00001793296.
DR   EnsemblGenomes-Tr; EBT00001793297.
DR   EnsemblGenomes-Tr; EBT00001793298.
DR   EnsemblGenomes-Tr; EBT00001793299.
DR   EnsemblGenomes-Tr; EBT00001793300.
DR   EnsemblGenomes-Tr; EBT00001793301.
DR   EnsemblGenomes-Tr; EBT00001793302.
DR   EnsemblGenomes-Tr; EBT00001793303.
DR   EnsemblGenomes-Tr; EBT00001793304.
DR   EnsemblGenomes-Tr; EBT00001793305.
DR   EnsemblGenomes-Tr; EBT00001793306.
DR   EnsemblGenomes-Tr; EBT00001793307.
DR   EnsemblGenomes-Tr; EBT00001793308.
DR   EnsemblGenomes-Tr; EBT00001793309.
DR   EnsemblGenomes-Tr; EBT00001793310.
DR   EnsemblGenomes-Tr; EBT00001793311.
DR   EnsemblGenomes-Tr; EBT00001793312.
DR   EnsemblGenomes-Tr; EBT00001793313.
DR   EnsemblGenomes-Tr; EBT00001793314.
DR   EnsemblGenomes-Tr; EBT00001793315.
DR   EnsemblGenomes-Tr; EBT00001793316.
DR   EnsemblGenomes-Tr; EBT00001793317.
DR   EnsemblGenomes-Tr; EBT00001793318.
DR   EnsemblGenomes-Tr; EBT00001793319.
DR   EnsemblGenomes-Tr; EBT00001793320.
DR   EnsemblGenomes-Tr; EBT00001793321.
DR   EnsemblGenomes-Tr; EBT00001793322.
DR   EnsemblGenomes-Tr; EBT00001793323.
DR   EnsemblGenomes-Tr; EBT00001793324.
DR   EnsemblGenomes-Tr; EBT00001793325.
DR   EnsemblGenomes-Tr; EBT00001793326.
DR   EnsemblGenomes-Tr; EBT00001793327.
DR   EnsemblGenomes-Tr; EBT00001793328.
DR   EnsemblGenomes-Tr; EBT00001793329.
DR   EnsemblGenomes-Tr; EBT00001793330.
DR   EnsemblGenomes-Tr; EBT00001793331.
DR   EnsemblGenomes-Tr; EBT00001793332.
DR   EnsemblGenomes-Tr; EBT00001793333.
DR   EnsemblGenomes-Tr; EBT00001793334.
DR   EnsemblGenomes-Tr; EBT00001793335.
DR   EnsemblGenomes-Tr; EBT00001793336.
DR   EnsemblGenomes-Tr; EBT00001793338.
DR   EnsemblGenomes-Tr; EBT00001793340.
DR   EnsemblGenomes-Tr; EBT00001793342.
DR   EnsemblGenomes-Tr; EBT00001793344.
DR   EnsemblGenomes-Tr; EBT00001793346.
DR   EnsemblGenomes-Tr; EBT00001793347.
DR   EnsemblGenomes-Tr; EBT00001793348.
DR   EnsemblGenomes-Tr; EBT00001793352.
DR   EnsemblGenomes-Tr; EBT00001793354.
DR   EnsemblGenomes-Tr; EBT00001793359.
DR   EnsemblGenomes-Tr; EBT00001793360.
DR   EnsemblGenomes-Tr; EBT00001793361.
DR   EnsemblGenomes-Tr; EBT00001793362.
DR   EnsemblGenomes-Tr; EBT00001793366.
DR   EnsemblGenomes-Tr; EBT00001793367.
DR   EnsemblGenomes-Tr; EBT00001793369.
DR   EnsemblGenomes-Tr; EBT00001793371.
DR   EnsemblGenomes-Tr; EBT00001793373.
DR   EnsemblGenomes-Tr; YN1551_R0001-1.
DR   EnsemblGenomes-Tr; YN1551_R0002-1.
DR   EnsemblGenomes-Tr; YN1551_R0003-1.
DR   EnsemblGenomes-Tr; YN1551_R0004-1.
DR   EnsemblGenomes-Tr; YN1551_R0005-1.
DR   EnsemblGenomes-Tr; YN1551_R0006-1.
DR   EnsemblGenomes-Tr; YN1551_R0007-1.
DR   EnsemblGenomes-Tr; YN1551_R0008-1.
DR   EnsemblGenomes-Tr; YN1551_R0009-1.
DR   EnsemblGenomes-Tr; YN1551_R0010-1.
DR   EnsemblGenomes-Tr; YN1551_R0011-1.
DR   EnsemblGenomes-Tr; YN1551_R0012-1.
DR   EnsemblGenomes-Tr; YN1551_R0013-1.
DR   EnsemblGenomes-Tr; YN1551_R0014-1.
DR   EnsemblGenomes-Tr; YN1551_R0015-1.
DR   EnsemblGenomes-Tr; YN1551_R0016-1.
DR   EnsemblGenomes-Tr; YN1551_R0017-1.
DR   EnsemblGenomes-Tr; YN1551_R0018-1.
DR   EnsemblGenomes-Tr; YN1551_R0019-1.
DR   EnsemblGenomes-Tr; YN1551_R0020-1.
DR   EnsemblGenomes-Tr; YN1551_R0021-1.
DR   EnsemblGenomes-Tr; YN1551_R0022-1.
DR   EnsemblGenomes-Tr; YN1551_R0023-1.
DR   EnsemblGenomes-Tr; YN1551_R0024-1.
DR   EnsemblGenomes-Tr; YN1551_R0025-1.
DR   EnsemblGenomes-Tr; YN1551_R0026-1.
DR   EnsemblGenomes-Tr; YN1551_R0027-1.
DR   EnsemblGenomes-Tr; YN1551_R0028-1.
DR   EnsemblGenomes-Tr; YN1551_R0029-1.
DR   EnsemblGenomes-Tr; YN1551_R0030-1.
DR   EnsemblGenomes-Tr; YN1551_R0031-1.
DR   EnsemblGenomes-Tr; YN1551_R0032-1.
DR   EnsemblGenomes-Tr; YN1551_R0033-1.
DR   EnsemblGenomes-Tr; YN1551_R0034-1.
DR   EnsemblGenomes-Tr; YN1551_R0035-1.
DR   EnsemblGenomes-Tr; YN1551_R0036-1.
DR   EnsemblGenomes-Tr; YN1551_R0037-1.
DR   EnsemblGenomes-Tr; YN1551_R0038-1.
DR   EnsemblGenomes-Tr; YN1551_R0039-1.
DR   EnsemblGenomes-Tr; YN1551_R0040-1.
DR   EnsemblGenomes-Tr; YN1551_R0041-1.
DR   EnsemblGenomes-Tr; YN1551_R0042-1.
DR   EnsemblGenomes-Tr; YN1551_R0043-1.
DR   EnsemblGenomes-Tr; YN1551_R0044-1.
DR   EnsemblGenomes-Tr; YN1551_R0045-1.
DR   EnsemblGenomes-Tr; YN1551_R0046-1.
DR   EnsemblGenomes-Tr; YN1551_R0047-1.
DR   EnsemblGenomes-Tr; YN1551_R0048-1.
DR   EnsemblGenomes-Tr; YN1551_R0049-1.
DR   EnsemblGenomes-Tr; YN1551_R0050-1.
DR   EuropePMC; PMC5127849; 27965637.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01139; sR2.
DR   RFAM; RF01140; sR20.
DR   RFAM; RF01145; sR14.
DR   RFAM; RF01148; sR13.
DR   RFAM; RF01150; sR11.
DR   RFAM; RF01304; sR5.
DR   RFAM; RF01312; sR9.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001404.
DR   SILVA-SSU; CP001404.
XX
CC   URL -- http://www.jgi.doe.gov
CC          http://www.life.uiuc.edu/S.islandicus
CC   JGI Project ID: 4005359
CC   Source DNA and archaea available from Rachel Whitaker
CC   (rwhitaker@life.uiuc.edu)
CC   Contacts: Rachel Whitaker (rwhitaker@life.uiuc.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Meta information:
CC    Organism display name:  Sulfolobus islandicus Y.N.15.51
CC    GOLD ID:  Gi01319 http://genomesonline.org/GOLD_CARDS/Gi01319.html
CC    Sequencing Status:  Complete
CC    Phenotypes:  Acidophile
CC    Diseases:  None
CC    Habitat:  Fresh water, Hot spring
CC    Oxygen Requirement:  Facultative
CC    Cell Shape:  Coccus-shaped
CC    Motility:  Nonmotile
CC    Sporulation:  Nonsporulating
CC    Energy Source:  Lithotroph
CC    Temperature Range:  Hyperthermophile
CC    Biotic Relationship:  Free living
CC    Isolation:  Hot spring at Yellowstone National Park.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2812165
FT                   /organism="Sulfolobus islandicus Y.N.15.51"
FT                   /strain="Y.N.15.51"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:419942"
FT   gene            467..763
FT                   /locus_tag="YN1551_0001"
FT   CDS_pept        467..763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47200"
FT                   /db_xref="GOA:C3NJ33"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ33"
FT                   /protein_id="ACP47200.1"
FT                   /translation="MVIRRMFIKSTLAVSFSISYLLYIIAKISFGSGKLAFIIALLQLY
FT                   PYFLIDYLPTVQVVSLFFQSLLLLLFAIFILLITYMLFLFYKLYKMVKTSILK"
FT   gene            838..2025
FT                   /locus_tag="YN1551_0002"
FT   CDS_pept        838..2025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0002"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47201"
FT                   /db_xref="GOA:C3NJ34"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ34"
FT                   /protein_id="ACP47201.1"
FT                   /translation="MNVIRETLKGGKGEVIKNPKVFIDPLSVFKEIPFREDILRDAAIA
FT                   IRYFVKNEVKFSNLFLGLTGTGKTFVSKYIYNEIEEVKNEDEEYKDVKQAYVNCREVGG
FT                   TPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIKAIIYLDEVDTLVKRRGGDI
FT                   VLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEY
FT                   GLIKGTYDGDILGYIAAISAKEHGDARKAVNLLFRAAQLASGGGMIKKEHVDKAIVDYE
FT                   QERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISEL
FT                   DMFGIVKIRIVNRGRAGGVKKYALVEDKEKVLRALNETFEDSIGIGDFVDDVGEN"
FT   gene            2006..2326
FT                   /locus_tag="YN1551_0003"
FT   CDS_pept        2006..2326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0003"
FT                   /product="conserved hypothetical M protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47202"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ35"
FT                   /protein_id="ACP47202.1"
FT                   /translation="MMWEKIKRLEERLYELRKEIEEVEKELEELPSGHLEVKTINGNVY
FT                   YYLRYWEDGRLRSKYIGKFASDIKEKLLKSEQLRRRLTQLKEEEKKLSNIIDKIEKIIT
FT                   DY"
FT   gene            2400..3233
FT                   /locus_tag="YN1551_0004"
FT   CDS_pept        2400..3233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0004"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47203"
FT                   /db_xref="GOA:C3NJ36"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ36"
FT                   /protein_id="ACP47203.1"
FT                   /translation="MIPVIIASAQTSVSQALSGIATSIIDAIPSIIVFIIILIIGYIIA
FT                   NIVSYSIRAFLGRIFREEHVRASVDIIAGTIKALIILIALSIALSFLQLGAASGYVQQI
FT                   ANYLPKLAGAIVLLTIGLTLVNILVDYMQRQIGARSQDDLITAIFNVLRFGLYAAIITV
FT                   AAALAIFSVIPYVDPYVFYAVILGAVILYAAYALIDKVLVPFANSNPDLAYVANYGRLI
FT                   LYIIVLLIAIAIIVEPFGNVTSIIYALSWGLAIAFAIALIPLVIALVKKFLAEIK"
FT   gene            3281..3580
FT                   /locus_tag="YN1551_0005"
FT   CDS_pept        3281..3580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0005"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47204"
FT                   /db_xref="GOA:C3NJ37"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ37"
FT                   /protein_id="ACP47204.1"
FT                   /translation="MSGIFSKGLEELKNNGWLILEDGKKIKKEFKFKDFKQSIDFLKDI
FT                   QPSADALDHHPDVCIYYNRVIVELTTHDMGGLTDLDYKLAIKIDELYKMKTSNL"
FT   gene            complement(3648..4226)
FT                   /locus_tag="YN1551_0006"
FT   CDS_pept        complement(3648..4226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47205"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ38"
FT                   /protein_id="ACP47205.1"
FT                   /translation="MSSTKRSFTALFASRDRAEKEEKMSEKITPIFSLGNFVMDKLGNV
FT                   TQYTFFYYYDPENYYASLTREMLDKEIEVVKGNMQSFLDVEKIIINDRSTRAKVVSTDI
FT                   FLLDITHPVIEFIITFRGKLRKGLNVYENFYEEEITEYPYEAIWRFPGKILNVKMKGQI
FT                   SILENFLKIKVNKGVKVGGRERIEFFLTS"
FT   gene            complement(4154..4867)
FT                   /locus_tag="YN1551_0007"
FT   CDS_pept        complement(4154..4867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47206"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ39"
FT                   /protein_id="ACP47206.1"
FT                   /translation="MKCSTKSIREIRGFSFLVPNCDSTLLREKFESFRKLSNEENKTYI
FT                   IRIADSNYFKFEVLMLPKSITLLTISTVRGTNNINLRDFEMVDELQTLACCAYQKEELK
FT                   TATSNFLSPTAQIAEAEVVDLISTDEEFECQTECNNISWNEIKLPESTEGKWTTTELAS
FT                   TGKLYLKALSGQAKFLTISTERPQNSIKFTSMERLGALCCFLTELKRKLNECPALKEVL
FT                   QPYLQVEIGRKRRKR"
FT   gene            complement(4901..5728)
FT                   /locus_tag="YN1551_0008"
FT   CDS_pept        complement(4901..5728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0008"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47207"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ40"
FT                   /protein_id="ACP47207.1"
FT                   /translation="MKCARSYKMLILPKRLIDILSESMSLKEAYTQYKNRNLNYALKLL
FT                   DELITQDPDLKEAYSLKGKILFELGKLQEAYENFQKAEDKIGMAKVLIAQGLYRDALTY
FT                   LDDNSKESSKLRGLIYLKLENYEKALDETKTIEDEDPLIYKIRGISELKLGRYNDAIID
FT                   LSFAIEKYPTDAELYFYRALAQRGLGNYKEAESDLEMAINLNPYYAEVYFSLGELKESR
FT                   GLLQEAVDMYSKTININPLYRSAYVRRAKSLMKLGREDEAYADIRKANELDSS"
FT   gene            complement(6219..7049)
FT                   /locus_tag="YN1551_0009"
FT   CDS_pept        complement(6219..7049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0009"
FT                   /product="AIG2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47208"
FT                   /db_xref="GOA:C3NJ41"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ41"
FT                   /protein_id="ACP47208.1"
FT                   /translation="MYLFVYGSLRYGFELNHLVAKSRFIGLGYIEGYEMYDLGNYPGII
FT                   KGDGIVWGEVYEIDENLIKLLDEVEDYKGSPDDLYVREKARVYFDQKRKYYLDNVYFYR
FT                   YNREIANDMEKIEDGDYSAWSGMPIIVNYFAYAENTNEKILRQRGVDIMLSEIPAYMKG
FT                   YRLIFNVPCKYGYCANLLEDENGIICGYLQKVFLHTLNSLDKAEQHLIKYIREVVKVYD
FT                   RNGKEYFAYAYVSSHKDDREKPSEEYLKMIREGLMRGWGNECVSTGLYDEAGIS"
FT   gene            complement(7052..7336)
FT                   /locus_tag="YN1551_0010"
FT   CDS_pept        complement(7052..7336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47209"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ42"
FT                   /protein_id="ACP47209.1"
FT                   /translation="MKPAEYKKLIDMLTRRGFDVRENGEELLAIFYPPTIEEAGGEGEI
FT                   PNQRYYVIKFKIRNGLAYYDSTTLMENDKPIKVLNIDEVELWLESFLGE"
FT   gene            complement(7317..7691)
FT                   /locus_tag="YN1551_0011"
FT   CDS_pept        complement(7317..7691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0011"
FT                   /product="protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47210"
FT                   /db_xref="GOA:C3NJ43"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ43"
FT                   /protein_id="ACP47210.1"
FT                   /translation="MAHPVAITLIIIAVLIAILVITGYISDPIIDIPTLALLGFLTYRV
FT                   INVVIKTRGRNLYSYEGKIGKAVDDIKSGQEGYVIVEGEYWRALALEDIKKNEDIVVVK
FT                   REGMKLMVRKKVSDIETSRV"
FT   gene            7727..9055
FT                   /locus_tag="YN1551_0012"
FT   CDS_pept        7727..9055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0012"
FT                   /product="Peptidase A5, thermopsin"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47211"
FT                   /db_xref="GOA:C3NJ44"
FT                   /db_xref="InterPro:IPR007981"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ44"
FT                   /protein_id="ACP47211.1"
FT                   /translation="MYKVLLIIILLLPLSMPLTIHTISQPSSLAFPSGVTSYPLNTVIY
FT                   TDFVMGKINISYLNIGSSYLPGGEYFTTGNASLQLNAMVLGKYWAQNVILFHQISNNTF
FT                   YATPIVNLWNLSGPFSNTTGNSLVYQGLGVICYQGPTFKVNLPLSISLFMEIVNSTLDF
FT                   GYNINEERGIYFRYPLIGLFQLGGLSLLGLPNDLELVWGGPGGGSVVFMNVSSVANLYY
FT                   FNGNGLSIVPNAYSIGFDTAEAAFGVKIYSTFPSLFSPIAIETSGLNVPSVLWPIPPHV
FT                   LVNQTSDRITVKLSISNKSLSGQAVYLETGFPPSVVSSTLTNSSGIAVFPNNNYSFYVV
FT                   YFPGNFTLSSAYYFSSPILNSLSSKFHSYYQDLLNFLNSAQNSFKKGIKSILSKQETSI
FT                   TTTTLTSTTSSSPQFGVNLYIILYILAFVIGMVISAILIRFKL"
FT   sig_peptide     7727..7819
FT                   /locus_tag="YN1551_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.483 at
FT                   residue 31"
FT   gene            9080..9883
FT                   /locus_tag="YN1551_0013"
FT   CDS_pept        9080..9883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0013"
FT                   /product="band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47212"
FT                   /db_xref="GOA:C3NJ45"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ45"
FT                   /protein_id="ACP47212.1"
FT                   /translation="MAINVGDIVGIVFLIIIIIIFIAMSFRVVREWERAVVLRLGRFLR
FT                   IKGPGIIFLIPFVDRPLIVDLRVNTVEVPPQTILTRDNVTVSVDAVVYYKVVDPQKAVL
FT                   SVYNYNVAVLNLAQTSLRDIVGQMELDELLSKREEINKRIQEILDVTTEGWGIKVTAVT
FT                   IRDIRLSQDLLSAMAKQAEAERLRRAKVILSEGERQAASILADASTYYKDNPSALQLRF
FT                   LETLSDISQRGGLIIVVPAGNEIYPTLGTSAALSTLSKKLQTETK"
FT   gene            complement(9914..11005)
FT                   /locus_tag="YN1551_0014"
FT   CDS_pept        complement(9914..11005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47213"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ46"
FT                   /protein_id="ACP47213.1"
FT                   /translation="MNINEIIKKVNELATKDVDERGKINMATNLIFDDITSNNSELKIG
FT                   ILEEIIDPDHIACAVDGSKYEIELSDVTLILARAVKILGKKKDKKSVPSEIAEDFKIIE
FT                   NYYDKNVISNKSILFMLSLETGLIEKCEDCDVIFVDGPIVDPPTYYEEDVEIENILSLD
FT                   KLALYRSTVLRRLKGKNKLIMGIVKNFSHRILIKEFLNSYPALIKARENYIISNIMYKY
FT                   RLEKSEFNKPIFLGWINWDSLINNQIILDDLKGISKAYNQYKKAFNYSLSIYSLYYQYN
FT                   ITSPIVRIDMLSEKEPDFTPIKYLNTWAMQGIREVTLLNKLADELSEINSQDAKKYALL
FT                   FNLARENYLDMNDKLAELMMRKT"
FT   gene            complement(11002..11691)
FT                   /locus_tag="YN1551_0015"
FT   CDS_pept        complement(11002..11691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47214"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ47"
FT                   /protein_id="ACP47214.1"
FT                   /translation="MDLDEFIEKLTQYKQNLDVEKLREEDRKITEMIEELEVSKQSLKE
FT                   SLKKLRSLEKKINELNKYEDNLEEIKADIERLGKLNSAEEIIRYVEKIKGKIDSLEKDV
FT                   EQDLNKIIDDKIKNIEEINDRLKLYAKILYHFLKIQKDVKTFSIPKEKSLSKLNEVEIQ
FT                   AKQHLNELYEIIVNELGKLNLNENEINILIILIDKGEIKISKDNLEEAIKVMKMLVERN
FT                   ISIKVKV"
FT   gene            complement(11678..14716)
FT                   /locus_tag="YN1551_0016"
FT   CDS_pept        complement(11678..14716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47215"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ48"
FT                   /protein_id="ACP47215.1"
FT                   /translation="MSCYKRISETASDSSYIYQIFSCISENPLYINRLRFFKQVKDEID
FT                   RISKTKQSPEIISLVADWGQGKSTFLDIIEEYAKSKNISVIKVPFVELLSKTEDLLTFR
FT                   NNIYLIDEVESSVDYFAEYQNEIKDFWSKVKELANSTGNSIVYLSMTPSAYSKIFGTGG
FT                   LIYNLFSETYPSLLERIRKVSIENPSKLEFLLMLKCMLKMANVKDFKILQYMDLPYWVI
FT                   DQERRKYVRFFNDILCDNLPNIDRIFNELARSEKGISLNSEGETIKLDTLTKMENELDS
FT                   QESSNLYRVLMSRIFTDEKLIIKQLEGHVVKGVLLPYLKWIEIFPKGQEYVEDFLLTYY
FT                   QDDFHVFISDNIESVVYESIDTSKLKENIKKLTLFSKTEAYALSWNFFESVANTNIGGL
FT                   VVEFKSREIRDKALQFVNTYITDREKELESLEYFMEVLGIKIDSANRTRDYIRFLKIVD
FT                   RNDKITIILAKPSNEDEIKSLIKEIKESDDIIHGIILIEPQIGKEELSKTLDELSIPLI
FT                   ELKITTPKKRQLLYLLFSKIYGQSRIRLDSIELRLGDLKNSISSLLLKIKDNLNLKQLP
FT                   IPKNKRLIQSFNWIIFYPSIKMANADEVFDKVNDIINEKFRMYGSKQFHLEDIETSNTF
FT                   IEDVITYFYNNYIIKIRTNYIDFEDLAGDSLSSFSKLFAGLIRQKYKQEAEDVVFNYIM
FT                   YYVNPQDTRRKDNKNNPLAFAYQIFNPDKKIGQNPTLDFLVYSSIVSGEVAKYLNKDSI
FT                   YMKINDQIRKIKEKLDNPYSAYGYFITAKKRGAAVRSLEEMREAIETYEKSCTENKDIR
FT                   LCYDYLYLSNIYLELLRETEKSVIETDKIVEEISKKLEVVEKAKRYIKINEKIEEIEKV
FT                   REIVRELKDNFKIHMDKLAKRIQEINERGETESFKRYLDYLLTTIHVEDNSNLYFILFK
FT                   LLKEALNGIAIVGEELKGTIVDEITSLSKVGIQLNNIETIVNELEKISPELPKLRENVE
FT                   RNTQKITQLIQEIKEVLEEHGFG"
FT   gene            complement(14721..16334)
FT                   /locus_tag="YN1551_0017"
FT   CDS_pept        complement(14721..16334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0017"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47216"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ49"
FT                   /protein_id="ACP47216.1"
FT                   /translation="MLMEKGEIIGIVLQKSEANELQGLIRADEEINIGQLLLIDDSEKL
FT                   SLVRVENYEFLNEFFDERGDIAKSILKEPSIYEILDMNTIIKATLHLIKKYDHSTTPKP
FT                   GSFVRKLPEIKSEKDLLSFYGIKSKKGLIEYGALAGSEIPLLLDLNAITMHIGVFGETG
FT                   SGKSYNMRYLIKLLSNIKIGDNITALPMIVIDANGDYIDLASTNLDIVSTGRGWIKRYI
FT                   LKDPKEQNDIKLTIDLSIFTPRELSEFIMSLKYGEASYNTLQLNFLEQVLANHDSKEYN
FT                   TLLGTAIGIENLRNEILTMAQNKDIGITTSTARGIASALEIFKNKVINRLQLVNSSASL
FT                   TENTLEVIWRNRGLAIIDFSAEGSPGIDVLTKQLIVSYITRLIFNYLTKSKYNGNQRFL
FT                   GFVIEEAQNYIPSVDYPVNANLTKDVLVTLATQGRKFGASLILVSQRPAFIDKYVLSMI
FT                   NTFFFHRIYHEDVRYVMSASGGLPESLTRNLTSLETGHVIVSGLMSIMKSPALIRIPWD
FT                   ARLGSYAGNVERIDLILSEG"
FT   gene            complement(16379..16945)
FT                   /locus_tag="YN1551_0018"
FT   CDS_pept        complement(16379..16945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47217"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="InterPro:IPR040777"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ50"
FT                   /protein_id="ACP47217.1"
FT                   /translation="MSSACERLYEYLKPDFTRISKKDNTDDLFRHPVVMRWHHYFLENW
FT                   NSDKEIGLLLPCTVVKPYSLSPTHKIAYATLNKYNLEEKVQVYSVSEPMLLVPKELEEC
FT                   YPFNNYDYPPRLMSKEEKEEFIMLLTKPLIKVSMLHNRLIGILPRHHYEIVKRAAEISN
FT                   LKITIYPYGRLAFKTIANVITSISS"
FT   gene            complement(16917..17801)
FT                   /locus_tag="YN1551_0019"
FT   CDS_pept        complement(16917..17801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47218"
FT                   /db_xref="GOA:C3NJ51"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ51"
FT                   /protein_id="ACP47218.1"
FT                   /translation="MKIILGIPDLKIPVWTFKQPLMVNQLNWNNLSWENETWVDSGGYQ
FT                   IMVKGIKVEIEKVVEKYKILDATQYMSLDIPSNPCHKPSELNYKYFEYLYAVFDKKIVP
FT                   VIHAYDVESIKKSIDFYSQYTDLVAFGGIIPPTLNKSGNKKLAVTIYHLVRKLWKGKIH
FT                   VLGAGSPFMRKVYFNANSVDTSTYRIKGIHGMVIIPGKGERYVGERKIVWGTRRASEEE
FT                   LETLLSFLDRTNYPFPIRLDNWVDRSLINAWVLLNSEYEINNPLIEYSKKLDSFPEDEI
FT                   EEEVNELCMRATI"
FT   gene            18044..18724
FT                   /locus_tag="YN1551_0020"
FT   CDS_pept        18044..18724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47219"
FT                   /db_xref="GOA:C3NJ52"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ52"
FT                   /protein_id="ACP47219.1"
FT                   /translation="MSKGAEILILFTVFVFTLNIISNAYVVNVKILSPFPVTLLFSDSH
FT                   GVKLVSSNQTLNVNSSNLRIQAFVLAPYSYSILINGNNTNELNVNLSNYSEFNLTVIVI
FT                   PSYAFLKVDVVGKGTVYIELNNGTIIAVRNSSVVKLYNGSNVLLEASGDLLNWSNGGNT
FT                   MTIWYTVNGNSTITAFFGNSSILLKSGTVKPIVNYTEVGLSLFAIGFFVLYKIYSRKDQ
FT                   DTNV"
FT   gene            18766..20697
FT                   /locus_tag="YN1551_0021"
FT   CDS_pept        18766..20697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0021"
FT                   /product="protein of unknown function DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47220"
FT                   /db_xref="GOA:C3NJ53"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ53"
FT                   /protein_id="ACP47220.1"
FT                   /translation="MNERLRNSQSGYLRKAVNHPINWYTWSNEIFEIAKREDKPILIDV
FT                   GAAWCHWCNVMDEDTYSNPEIVKIVNENFIPVKVDRDEMPDLDRLLQNAAMAITGESGW
FT                   PLTIFMTPEGKVFFGGTYFPPEDKYGRIGFKKLLLEILRIWREDRNQIFSSSIDPNMLI
FT                   ARNTGGVLSSSVLDDTFSYITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGK
FT                   KLGLFTLRKMYYGGIFDQVGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYTATN
FT                   DIEILDALRNSVDFVLRELYMDGKGFANSLDADSEGMEGKYYTWTEDELKGALGNDYGI
FT                   AIRVFDLKNTVEVEGRKVLLRTTELRELSKVTGLQANEIIEKVSEIRAKLLTYREQNRK
FT                   MPYRDDSTYTYPNAKLTESILFSSLILNKGIEEAKLVLSKLGKSVSRRLDGGKAGLPED
FT                   YAAALLASISAYEVLSEEKYYDLAIELGRNIGGIRPNNFTDMPNESANSMYIRALFKLS
FT                   LLSDEFKVDEGKIKPLIPSLTAENSQFIAGIVNTISSYINGMAHIVVVDEKDGLAERLH
FT                   RTALLTYYPFKLIERVDDSRTDYVSSVIRAMIKYNAGKSRAYVCIGNTCSMPVSEEEKI
FT                   KQLLKTKL"
FT   gene            20709..21428
FT                   /locus_tag="YN1551_0022"
FT   CDS_pept        20709..21428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0022"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47221"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ54"
FT                   /protein_id="ACP47221.1"
FT                   /translation="MGRLDNKKVAIIGVSEGLGYATAYFALKEGAQVCINSRNENKLKR
FT                   MKKTLSKYGNIHYVVGDVSSTDSARNVIDKCASLLNGIDHLVVTVGGYVEDTIDNFSGL
FT                   EEMLTNHIKIPLYVINSSIRFLKEGSSVVLVSSMSGIGKASPDQLSYAVAKAGLAKEVE
FT                   ILASELLGRGIRVNGIAPTTISGEFEPERNWKKLRKLGDDMAPPEDFARIIIWLLTDES
FT                   DWVDGVVIPAHGGARLK"
FT   gene            21429..22070
FT                   /locus_tag="YN1551_0023"
FT   CDS_pept        21429..22070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0023"
FT                   /product="transcriptional activator, TenA family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47222"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ55"
FT                   /protein_id="ACP47222.1"
FT                   /translation="MSIVSNVENLIESVGELWNRYVKHEFVLKMRDGSLPLDIFRYYLI
FT                   QDGKYVEDMLMALLIASSKGPIDKVTKILNLVFSTLNKGLEIHSKLYSELSISKDEIVK
FT                   TRYNLINYAYTRHLYFYANLDWNKFLVAWTPCMFGYSIIGDYVVESPHQLYKTWASFYA
FT                   SNEYKKRVEAILHALNEVNITEGLLSIFVDSVRFEIGFWEASLRKDPMVY"
FT   gene            22073..22735
FT                   /locus_tag="YN1551_0024"
FT   CDS_pept        22073..22735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47223"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ56"
FT                   /protein_id="ACP47223.1"
FT                   /translation="MSWIRDTSFLMECVKNGSIKIEINVSNYSMSFNLLNGKYNLSLFS
FT                   SDNIRISYDGNRLIDMHNLRVLKDHDARVHISNMINNIKGNMSNEINNLAIMYNIPVKI
FT                   LNDNLEAIFNLNFSLLSCLDYGLDYFLIHLTNDFAKQSSQFDVIKKLKLILANEKGCIK
FT                   AILALSNTYESDSFLFSNDCISFQVNVNGFSKFLMDYRTLNAKYTEVIDYLKQRLSQ"
FT   gene            complement(22729..23442)
FT                   /locus_tag="YN1551_0025"
FT   CDS_pept        complement(22729..23442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0025"
FT                   /product="protein of unknown function DUF91"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47224"
FT                   /db_xref="GOA:C3NJ57"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NJ57"
FT                   /protein_id="ACP47224.1"
FT                   /translation="MYSVLLNPSNTEIYSFLTERIYRELVVIFATCKVNYKGRAESVAS
FT                   ESPRLIILKPDGTVIIHESVKREPLNWQPPGTKIEIMNDYPLKIVAQRKRPKEVIEIDL
FT                   KEVFYITSAEVKDGDFVIKGREIDIVNTIIQNPSMIEEGFVPLTREYNTPYGKIDLVGL
FT                   DKKGNFVIIEVKRSKAQLSAVSQLYRYYLHIRETKEDKVRGILVAPDLTTHARELLQKL
FT                   GLEFIRYDIQKYSSY"
FT   gene            23494..24552
FT                   /locus_tag="YN1551_0026"
FT   CDS_pept        23494..24552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0026"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47225"
FT                   /db_xref="GOA:C3NJ58"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ58"
FT                   /protein_id="ACP47225.1"
FT                   /translation="MEYYDLILYLLVFGANMLIILQTYNEIKMRKTVKGSFIGKVSIIV
FT                   PIKGIDTGLERNIESLLSQDYPYPYEVIYVVEKGDEVENVLKKYNVKIVYSDFNCDSCS
FT                   GKIRAQISGLLRASNDVIVFADSDTWYPRYWLRNLISPLDRYEATTTFSWPSPSRITLS
FT                   NLIRAGFWTLGFESQSLQSSRFLWGGSMALRREFFDNEVLDELSKEWCDDCTLTRIIKR
FT                   RGGKIGFVMSAIPLNVYDEDSLIRWSSRQIITILAYSPRGAKAYLVAGTFFTLILIYSL
FT                   VYLNIITFTPYLLWIVKNVIRGAKYPKQALIASLMTIVAIPYALFLVVFNWNRREVYWR
FT                   GKRYIVKPLREK"
FT   gene            24676..25239
FT                   /locus_tag="YN1551_0027"
FT   CDS_pept        24676..25239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47226"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ59"
FT                   /protein_id="ACP47226.1"
FT                   /translation="MQSTSVEIYLNIYSFRHELEHFTIEEERDEWSIVKDKANEKYIVK
FT                   EFADYGILIYPVYDLKDDILSSFSIQLPSVGKLKEILYTPEKWIDRLDLRINDNSIEVT
FT                   SLILDYLTGIDIINSLISSFGFQYAQLDDNSLIIKIRISRPLNRTLLDSHIRAIYHMLK
FT                   LYYSVKKAQEEIASKVTLSYIKSI"
FT   gene            25264..26316
FT                   /locus_tag="YN1551_0028"
FT   CDS_pept        25264..26316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0028"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47227"
FT                   /db_xref="GOA:C3NJ60"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023819"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ60"
FT                   /protein_id="ACP47227.1"
FT                   /translation="MLWLVMTTGKCNLKCDYCGGSFPANVVPYGVKYDINLLKRLVEND
FT                   KESTIIFYGGEPLLNYKFIMTVLDNVIAKRYGIQTNGIAVRLLPEKYWRKINVALLSID
FT                   GREETTDKHRGKGIYKAVLRSAKYLKDLGVETIARMAVTQDSDIFADVMHLIDLGLFDK
FT                   VHWQLDVIWSEEWDFKSWSFSYLHGIKRLTEYFLSELRKGRVVKIIPILGVISAHFFDG
FT                   YKGSPCGAGYSSVTVTPDGRILSCPIAVREKWAELGNVNLGYRLLEDPLPDDCKRCEFK
FT                   RYCGGRCLYAQKERYWGEEGFKVVDEVNKEYLRTVLSIIPEIEKLIRDGNIRLSDLYYN
FT                   PLLDSTEIIP"
FT   gene            26342..27037
FT                   /locus_tag="YN1551_0029"
FT   CDS_pept        26342..27037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47228"
FT                   /db_xref="GOA:C3NJ61"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ61"
FT                   /protein_id="ACP47228.1"
FT                   /translation="MSVKFEESSRLLETIKSMLASATSSILIVTYSIDQEAASEILTRA
FT                   ASGVNTVLVTADKDWARWLKNQSEAYKKDEEKRLYRELRRNESIYVQIIYFTSIISIAI
FT                   AIIDIILYFMMGSLIYYDVPLSLIAIGFLIYYGIRKRREALSQISILRESVQNFVQEVS
FT                   QIRDKIKEKLKIIEIDSQVSFSIVSCDDKTILFSAPLKFSMDKPSVHVVMEISKQLADQ
FT                   LVNLILKIS"
FT   gene            complement(27167..28210)
FT                   /locus_tag="YN1551_0030"
FT   CDS_pept        complement(27167..28210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0030"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazolephosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47229"
FT                   /db_xref="GOA:C3NJ62"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NJ62"
FT                   /protein_id="ACP47229.1"
FT                   /translation="MIKEYYGAETFILNKDFAYILVIGTTDVSLIPGLTIAGATPELTH
FT                   FTPAADAEYVLLGKCKSINTIPVSPTGIPTPALLTRASLSFINPLKIVVNAGSRILPKI
FT                   PYIDLQGEPGKDIRKQALSMEKVNNIMENSIKLGEELSNEYELIMIGESIPAGTTTAMA
FT                   TLLALGYDAMDKVSSASPDNPKELKRKVVEEALRNLPTDSLQRLAKVSDPVLLGVAGTS
FT                   LGFKGKILLAGGTQMTAAAAIINEFDKNKLKDITIGTTKWIVEDKFADMLSLAKQVGVK
FT                   VLASMLDLSISAYEGIRAYEKGYVKEGVGAGGSAIMALVRGVSNNTLVRKIDELYSELV
FT                   GSNNLHI"
FT   gene            28274..28603
FT                   /locus_tag="YN1551_0031"
FT   CDS_pept        28274..28603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47230"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ63"
FT                   /protein_id="ACP47230.1"
FT                   /translation="MIESGTLVSLEEFKSNQKLKESVKNGIKGLVKLLFQEAGKIIKFT
FT                   SNDDLIFQLMKLGLISATLAQELLDILKIVNNLDSVDDEILHSMLVRIMEVIEEAINSI
FT                   DKYMG"
FT   gene            complement(28609..29739)
FT                   /locus_tag="YN1551_0032"
FT   CDS_pept        complement(28609..29739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0032"
FT                   /product="aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47231"
FT                   /db_xref="GOA:C3NJ64"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ64"
FT                   /protein_id="ACP47231.1"
FT                   /translation="MRLRDPREFRENLPVTRKYVYLNHAAVSPTPLPSLFEAYRYLYEV
FT                   ANRGSIAANEEEEDELYHIRSKIANLIGAYPDEISLIPNTSYGVNLVAHGLEWKKDDNI
FT                   VTDNLEFPTVVYPFLKLAKKGVKVNVVKTNPYNFEEDIISNINKNTRLVAISHVSFNTG
FT                   LKVDVRKIVKAARENDALVLLDIIQSAGAVRINVEELDVDFAIAGGYKWLMSPQGSGFI
FT                   YVKRGLIEDPPFYGWKTSADYLDFNPNKFTLEKGPRRFEIGTVDIAANLSLAKSCEIIS
FT                   ENMELIESSVTYLSQFAIRLAKDHNMEVITPEEKRAGIVVVKVKKPKEVVKELLREDIV
FT                   VSPRGEGIRISTHFYNTEEEVQKTIEKILEIERKLN"
FT   gene            complement(29711..31423)
FT                   /locus_tag="YN1551_0033"
FT   CDS_pept        complement(29711..31423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0033"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47232"
FT                   /db_xref="GOA:C3NJ65"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ65"
FT                   /protein_id="ACP47232.1"
FT                   /translation="MDYYTLYDLSLEKPETYWETFANKLSFFKKWEKVIEKNKQLPIAK
FT                   WFVNGTTNIAYNALNHTGKALIFYKEHKYKGDEITFNELNNMSSMIAGLLLDKGVRRGD
FT                   RIAIYMPNSIYTIATILAAARIGVIYTLVFAGLGINAIVSRISNLEPKLVISTDKTFRR
FT                   GKEIKLYNNLANIIFPRDPQFDYPREYKEFEKIESNEPLKIMYTSGTTGKPKGIILPHG
FT                   AWMVGDYTVFELMFSLKSNDIVLTTADVGWITFSRIMYGTLMHGSTLAFIEGAPDYPTD
FT                   RLPKIIDELQPKVLFTSPTLLRTLQKLDVKLPRVEFIATAGEIMDETAWKYALRFSDKV
FT                   VDVYGQTELGYVIGYPYALDSVEPKIGYAGLPFPGAVIDTVDEYGKSLRGHVGHLIARG
FT                   PFPTQFIGIWKDEAKFLSYFEKFNGHDTGDLAIINEKGYVKIVGRDDDMIKIAGHRITS
FT                   GEVESVINSLEGIVESAAVGIPDKIKGEKLVVFYVGNIDEKTIVTKVREMLGPIYVIDK
FT                   IYKVERLPKSRSGKIVRRVLRDLLLEKEIDETILEDPEILKEIKSEIKRSERI"
FT   gene            complement(31481..31957)
FT                   /locus_tag="YN1551_0034"
FT   CDS_pept        complement(31481..31957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0034"
FT                   /product="Nucleotide binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47233"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ66"
FT                   /protein_id="ACP47233.1"
FT                   /translation="MHIIFDTSAFLAGLQLSLDRVYTTQEVINEIKDKYSRFNLEIAIS
FT                   SGKVIIMKPSTRSVEKVTKVLNLTKERKLSNTDISVIALALDLQPSIVFTDDLSVQNIL
FT                   KHVGIQFSSIKINKKVEKSFKFKYVCIDCKKEFDIDYRECPYCGGKVVKRRIME"
FT   gene            complement(31941..32690)
FT                   /locus_tag="YN1551_0035"
FT   CDS_pept        complement(31941..32690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0035"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47234"
FT                   /db_xref="GOA:C3NJ67"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NJ67"
FT                   /protein_id="ACP47234.1"
FT                   /translation="MRVKIVSKPTSQLNNIIEKIKNISTKLGFEVVDKDFDYVIAVGGD
FT                   GTLLRAVKQNKPVIAVKAGRRGLLMDVPVDKFEEALLRLKKGDYEEEEYMLLEMIYNDK
FT                   VELGFNEVGILYDRPEAIKVGISFDTERVSVEGDGVLVSTPQGSSGWGMSATNSLLYKD
FT                   LSAIEIIFVNPIFYYLRSVVIPPKPLTLRLEDKGYPQTARAVVDGEVVTLIKTNQEITV
FT                   RVSQRKAKILRFFKLDLIGEVLHAYHI"
FT   gene            32795..33862
FT                   /locus_tag="YN1551_0036"
FT   CDS_pept        32795..33862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0036"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47235"
FT                   /db_xref="GOA:C3NJ68"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ68"
FT                   /protein_id="ACP47235.1"
FT                   /translation="MKGIKIIVARVIYAIHWFYLAPLIPFLASKLNLSLQIVGLIPFSF
FT                   FLGSGIMQVPSAYLSTKIGLRNTLLLGLIIMSISPLLISFSSNFIELLIFYLTDGIGAS
FT                   MFFSTGGGILASLNRDSPGLALGIYNASFAVGGLIGLNWYTMFGNYLSFYGLSILTFLS
FT                   LIINLNNPNLKPGWKIIRDNRIVILGISIAGIWGVYYVIGELYPTFAYYYLHLNLVDSS
FT                   LFTSLLLISSVIGGSLTFLADRKIKKFNLLIISSLLGSVPSLLLYTKVYLLGIVITGIF
FT                   NELAISVLYSIIASLQRDANATMGLAVVNSLNILIGMNFEPLASYSGYYMWIVVNIIGL
FT                   VLFSLIMLVRQNISI"
FT   gene            complement(33840..34193)
FT                   /locus_tag="YN1551_0037"
FT   CDS_pept        complement(33840..34193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47236"
FT                   /db_xref="GOA:C3NJ69"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ69"
FT                   /protein_id="ACP47236.1"
FT                   /translation="MTDQTQLGIVILALPLPILTYLWFRYYNIIITEGTKYVGENYREE
FT                   EIFLLPSSTKTVKIDGKVSILVYGVNPWITIRVNGGPKQKIFKIRLLNESGNLELINES
FT                   KVFQVRVKLRYSA"
FT   gene            34278..35276
FT                   /locus_tag="YN1551_0038"
FT   CDS_pept        34278..35276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0038"
FT                   /product="Thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47237"
FT                   /db_xref="GOA:C3NJ70"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ70"
FT                   /protein_id="ACP47237.1"
FT                   /translation="MNEYDMVIIGGGPVGLFGTFYAGLRDMKALLIDAQDELGGQLVSL
FT                   YPEKIVYDVGGLAGIQAYELAQRLIEQAKMFGPDIRVNEWADMIEKTSDNMWIVKTDKG
FT                   SYKTKTIFIAAGIGKIVPSRLGAKGEIEYENKGVYYTVRRKKDFEGKRILVVGGGDSAV
FT                   DWALNLAPVAKSVTLIHRRDQFRAHERSVKELFRVANVYVWHELKEIKGDGNKVTQAII
FT                   FDNRTKEEKVLNVDSVIISIGYKGDLGNIPKWGVNMKGRDIVVNGKMETNLLGVYAGGD
FT                   IVQLEGSPKLALIAVGFAHAAIAISVAKKYVEPSASLFAGHSSEMDKFKPK"
FT   gene            35298..36038
FT                   /locus_tag="YN1551_0039"
FT   CDS_pept        35298..36038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0039"
FT                   /product="protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47238"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ71"
FT                   /protein_id="ACP47238.1"
FT                   /translation="MKTERLNAYFPGVRSYYIIGEIAIVTPKRVNVDYNLVAQKIMQAH
FT                   PKIKAVYLKKKVKGELRTNELEFLSGERISSTIYKENGVLFYVDIVTVYVNPSLSGDRL
FT                   KNVELVEEGSIILDAFTGYGAIALNIAHKKRAYIVAGDVNINGLYMLKKSLSLNKIKGM
FT                   IDIVQYDAHYLPFRDKVFKLSFGDNPTLIIDFKEELCRVSENVVFYILCESKDKANSSL
FT                   GKTEWVKINDYSKNLFIFKGVVRC"
FT   gene            complement(35961..36446)
FT                   /locus_tag="YN1551_0040"
FT   CDS_pept        complement(35961..36446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0040"
FT                   /product="Protein of unknown function DUF371"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47239"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ72"
FT                   /protein_id="ACP47239.1"
FT                   /translation="MIAIDKIKIKGHYNIRGLHKTTLEITKDHYLTTRGDCIIGILANK
FT                   GARDLSESFKKIARNDERFIYAVIRVKELFDIIHGRGSSKFTFENQNKIIFRKSTFIEG
FT                   STVMIRSDKASRDINREIINLLKTEVEGEVHILASDNPLEDKEILRIVVDLNPLSFT"
FT   gene            complement(36406..36699)
FT                   /locus_tag="YN1551_0041"
FT   CDS_pept        complement(36406..36699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0041"
FT                   /product="protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47240"
FT                   /db_xref="GOA:C3NJ73"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ73"
FT                   /protein_id="ACP47240.1"
FT                   /translation="MYSQEIKDLIKKTRAERADIRIGKYGVTEGMLNEIKRRLNEHKVI
FT                   KIKIGIKEIDDRKEFAKRVAEMVGAKLIEVRGYTFILAKIDSNRQDKDQGAL"
FT   gene            complement(36659..36973)
FT                   /locus_tag="YN1551_0042"
FT   CDS_pept        complement(36659..36973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0042"
FT                   /product="RNAse P, Rpr2/Rpp21 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47241"
FT                   /db_xref="GOA:C3NJ74"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="InterPro:IPR016432"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NJ74"
FT                   /protein_id="ACP47241.1"
FT                   /translation="MRIKNKIKKRIIELIELAYITARKGDLELAREYIKLAEMYSRKGR
FT                   IKIPLKYKRMFCRKCYTPLITGVTERRRIRSKILIRTCLICNWQRRYVLSRNKGSNKEN
FT                   "
FT   gene            36995..37666
FT                   /locus_tag="YN1551_0043"
FT   CDS_pept        36995..37666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0043"
FT                   /product="Suppressor Mra1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47242"
FT                   /db_xref="GOA:C3NJ75"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR023503"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ75"
FT                   /protein_id="ACP47242.1"
FT                   /translation="MLKYSMHLNIVLLEASLELVPKEIVNHPAVIKNAKRRDKKPEETL
FT                   LDISLHYHAMKSLENSHKRGRPDILHQALLVILNDPVIKGDLFIHTIQSKIIKVNPNMR
FT                   PPKNYLRFMGLMEQLLKYGRIPINGDESLMEVTNLTLEEIAARYNLILLSEKGEKINPE
FT                   ELCKLDEKWILGIGTFPHGDFSEKILSLAKKIYSISEFQLETQQVLCRIFSACNSILGW
FT                   P"
FT   gene            complement(37647..38222)
FT                   /locus_tag="YN1551_0044"
FT   CDS_pept        complement(37647..38222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47243"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ76"
FT                   /protein_id="ACP47243.1"
FT                   /translation="MPRVNIAAEADLIEQLESEAKKRGYTIYSLTNAALKALLKLLKEG
FT                   EDANTLESLVDYYTISKALDIVPVTSWFLENLTKLAYEKDSKQYENMCEEVGEQIGSFL
FT                   RSKASTLDELFDFYNAIKIILPIRNVAIKNAGDVIEFRITGTGFSLISTLCAGKIFSKI
FT                   AEAYDLSIQDVDVVPGGIVTIKAKANLK"
FT   gene            complement(38298..38477)
FT                   /locus_tag="YN1551_0045"
FT   CDS_pept        complement(38298..38477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47244"
FT                   /db_xref="GOA:C3NJ77"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ77"
FT                   /protein_id="ACP47244.1"
FT                   /translation="MRKHKLRWWIYLSQKKSEIKSWANLIKTLFADNNWYLGVFIVLLI
FT                   LFIIFDLIAFTPHS"
FT   gene            39051..39935
FT                   /locus_tag="YN1551_0046"
FT   CDS_pept        39051..39935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0046"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47245"
FT                   /db_xref="GOA:C3NJ78"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ78"
FT                   /protein_id="ACP47245.1"
FT                   /translation="MISVKVLRRLSIIFLFSSIFLIPIFLLEFIVGILFKSYILIADSY
FT                   HTLIDFLISLLFYFTLVKINTRSRRFPWGLYNLESLVILATSIFIVYLSANLILSMFDS
FT                   SITFSISPWYSIILFASSIYSLALYFVERRYAEIQIVKNDMVHSFLDSIAEVVSGITLI
FT                   VQNMVLIDVVTLAILTFTLSDVIREIKDSILSILGASIDSPMKFQLINELRSKNIPIIN
FT                   LYLKRCGSFYAVYAYIGLPKDITLEKAYKIKRKTKRIIKKYDNIACIDVILVPLTEIKK
FT                   KKILEQVNTLYSR"
FT   gene            complement(39903..40769)
FT                   /locus_tag="YN1551_0047"
FT   CDS_pept        complement(39903..40769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0047"
FT                   /product="protein of unknown function DUF191"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47246"
FT                   /db_xref="GOA:C3NJ79"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ79"
FT                   /protein_id="ACP47246.1"
FT                   /translation="MVTIRVGALADSGDLYPFIPLMEGKVRPEGFNLEFEVIPTVQDIN
FT                   EAVLKKEVDVSVPSAAMYPYIQDDYYILSNAVATAVDGITGMPILAIKEMSENEIKRSR
FT                   LIVHGPNTTAFTLYKLLMGKYGRLVIIRRVLDEIKALGKEGDVLVAVHEIKMMYTLKKL
FT                   GINVVRIGSMWDMWKAISNNTPMPMGMVVISKEVGKDFALKFKETYEKSKKYAEKHLDE
FT                   IIPRDVQIMRESQKVDLDEEIVRKTIWADIQEYNVPVDEVRRGLEFFFKISEERGILPR
FT                   VKSIDLL"
FT   gene            40873..41403
FT                   /locus_tag="YN1551_0048"
FT   CDS_pept        40873..41403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0048"
FT                   /product="protein of unknown function DUF84"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47247"
FT                   /db_xref="GOA:C3NJ80"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NJ80"
FT                   /protein_id="ACP47247.1"
FT                   /translation="MVTIALGSKNPVKINATKEALDVLKLNWDLIGIEVDSGVDKQPFC
FT                   DQTYVGARNRALNVIRVTNADIGLGIEGGVCNVYGKFIANAVVYVITKEGLENFAISSS
FT                   FTLPSSMVSLILQGKELGEASDIIFKTNNSKTKEGAIGLLTNNVINRKMLYVQPIVLAL
FT                   YPIYNTMINNTPF"
FT   gene            complement(41384..42037)
FT                   /locus_tag="YN1551_0049"
FT   CDS_pept        complement(41384..42037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47248"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ81"
FT                   /protein_id="ACP47248.1"
FT                   /translation="MNPLLLGIDGLSYTSFMKCNPRTLFTLFSSTYRGVVLNKKPQFPQ
FT                   TSWMSVLELKDIKDMSAVNLNNEKPRLLKETNAVAINLPITNPTYGKLSLPYDTSVNAE
FT                   EEINKVTQIVLELIEESPVIASITAIDRLLHKDPTEKCKIYSLVDSAVRKILNKVDDFI
FT                   IFSLYGEPKGENEDGNHEDYGVFLATIPRPSEHDTVKLQEIGELFIKLVKKEYY"
FT   gene            complement(42050..42457)
FT                   /locus_tag="YN1551_0050"
FT   CDS_pept        complement(42050..42457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0050"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47249"
FT                   /db_xref="GOA:C3NJ82"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ82"
FT                   /protein_id="ACP47249.1"
FT                   /translation="MNDELNDPELQKILSKKANQILNSLKEKVEEPVKHLNSKNFEEFI
FT                   TKNKIVVVDFWAEWCAPCFILAPIIEELANDYPQVAFGKLNTEENQDIVMRYGIMSLPT
FT                   VMFFKNGEPVDQILGAVPREEIEVRIKALLE"
FT   gene            42514..43428
FT                   /locus_tag="YN1551_0051"
FT   CDS_pept        42514..43428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0051"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47250"
FT                   /db_xref="GOA:C3NJ83"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ83"
FT                   /protein_id="ACP47250.1"
FT                   /translation="MPKLIIVGSGITGLITALKYSGDVIILEKNTIVANNSKASLWSII
FT                   PPLCSNHREDCEKGMRFYEEICEKYGIYCKKTHILRVSSKKIGGKIVDRKEIRGFEPQL
FT                   NIEEAEFFENGLFVEGDELFSILETEFNIKSNSEVTDILVKDNEIKSLLTSKGEVKGEF
FT                   YIFATGYLTPKLFSKLGIEVNLFKGHLIITKKTSLNGILIVNDRIAVEGKNLYLNGDSK
FT                   QNSSMTIDYDEISKTINEIGRVLKIDTTNLEIRVGFRSVSKDREPIVKKIYSNAILITG
FT                   YRFGFALAPVLAEKAIQMIKYGH"
FT   gene            43418..44131
FT                   /locus_tag="YN1551_0052"
FT   CDS_pept        43418..44131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0052"
FT                   /product="Protein of unknown function DUF516"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47251"
FT                   /db_xref="GOA:C3NJ84"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NJ84"
FT                   /protein_id="ACP47251.1"
FT                   /translation="MDIKLVYSTSDPVGLTIKKLGYSFEEIDEDVTDFHYKNGEAIVIF
FT                   SRHESKASIPSLTVHYPGNPSEEVMGGEPKKLGIAYPRLLTSILREIKKIDLDIEKTME
FT                   ATHHGPTYQNVPVIFVEIGSDKTYWTNERIVRTLVDSTLKGIDKVDETDCRDYISGFGG
FT                   PHYSKLFTKLADESCIGHVISKHYVDKLDDKVIIQAIANSVNNINKVVIDSLNLKQRER
FT                   IIAALKSFDIHIQLR"
FT   gene            complement(44096..44728)
FT                   /locus_tag="YN1551_0053"
FT   CDS_pept        complement(44096..44728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0053"
FT                   /product="Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47252"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ85"
FT                   /protein_id="ACP47252.1"
FT                   /translation="MTIIIFIRHGQSTSNVSKILSHDINTYPLTEEGVTQAKDAGKELM
FT                   KLKVEKIYTSPVLRAYQTALIIGETLGIFPIVDQRLRERSLGELNNTTFDPNDHWKLKV
FT                   FKKQMEIKGLESWEDMTKRMKSFLESVINKDNNVIAAVSHSDPIRAIVTYILDMDDISG
FT                   WGVRIPNASLTILRCENNIDSCKVLSIGSPLLTPQILSKLNMNIKAF"
FT   gene            44797..45774
FT                   /locus_tag="YN1551_0054"
FT   CDS_pept        44797..45774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0054"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47253"
FT                   /db_xref="GOA:C3NJ86"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ86"
FT                   /protein_id="ACP47253.1"
FT                   /translation="MVSLFKRNKHSTNSTTDLRILFSSDLHASYTVVKKFINAGKIYKV
FT                   NALIIGGDIAGKTLIPIIDLGNNNYNIQDKIVTSSELNSFIERFKSEGIYYAILSKNEY
FT                   EEASQNKKAQDELFKKAIIATIREWMKIAEERLKDYKIPIFINLGNDDPEYLFEVLKES
FT                   EIFKVGEGEVFDFNGYEIVSYGYVNPTPWNTFREKKEEEIYNDLSKIVSKITNYSKAIY
FT                   NFHAPPYNTNLDNAPLLDENLKPIVRGGEIVYTHVGSKSIRRIIEETNPLLGLHGHIHE
FT                   SRGFDKVNNTIVINPGSEYNSGLLHAALVILEGESIKAHQFILG"
FT   gene            45986..46312
FT                   /locus_tag="YN1551_0055"
FT   CDS_pept        45986..46312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47254"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ87"
FT                   /protein_id="ACP47254.1"
FT                   /translation="MIIFYAIGERDRAKELVRIITKTRWKTISKHAIKIASSSIGPSVV
FT                   IFKPTMAGLAVALWLKQRAEELGMTSAVGWFQPINQIPPQVEDAIRTDLNKILVKKLEV
FT                   PWSP"
FT   gene            complement(46314..48077)
FT                   /locus_tag="YN1551_0056"
FT   CDS_pept        complement(46314..48077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47255"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ88"
FT                   /protein_id="ACP47255.1"
FT                   /translation="MKVRVFNIGGITQDYSLDLEKGVTSYEAPNAYGKTSLVRALISLL
FT                   TSSIKAEDLLNVFADSGYIEVELDNKLYYRRIKRIKNGLSEDKNLIMDDDRALLLTYFS
FT                   PENKLVTQILSGDGNVEWFISATSKINEIKAKKEELQKLLTAEINARDDLQKKYNNIRE
FT                   IQAKIRAIDEEIDKLEKERESSSNIVAKTTYTITLTRQNKINEIVNKIKVKKDELANLE
FT                   FALKKIEEEIQNKESKVSPDIKTQLQKELEEINEKLKLKTSDRSELEIELKVLERVLEE
FT                   VDESDKHHLDTCNVCGSKVDPSIWKERAEIISRELRDKTSLLDSLRNDIIGLQKRKEEI
FT                   DLRLKEFQTLENEIAKLKAKKEELINRIGSVKFQIDDLERQKRETEERFNKSESLSGAI
FT                   ATSDDSTSILKRIEELRKKREEYEYELQLLGVPSSVLEELKEKEEHIEQLQKKVDELQV
FT                   EYIRRLTKAREEFNRISNQLLRKFEFDMEAEIDGNYRLIIRRKGAIIDIKKLSSSERTT
FT                   LALILVLSALRAYFKTPYFIIDESAMTFDQKRFNRLLEYLTEIADYVIVTRSSENTEIK
FT                   TLPPKQIEISS"
FT   gene            48285..49208
FT                   /locus_tag="YN1551_0057"
FT   CDS_pept        48285..49208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0057"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47256"
FT                   /db_xref="GOA:C3NJ89"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ89"
FT                   /protein_id="ACP47256.1"
FT                   /translation="MRKVVLDSDTASDDTIAILLASRYFQLLGVTIVAGNVNYNQEVKN
FT                   ALFTLEYIGKQDVPVYLGSQRPILGNWRTVEEVHGSNGMSDWDYPEPTKRPEKEHAIDA
FT                   ILRLSKEYDGELEILAVSPLTNIALAYLKDPSVVKRIRKIWIMSGAFSKGNTTPIAEFN
FT                   FWVDPEAAKIVLDAGFDITVVPWEVAETSGSLNERDWEIISKLNTKLSKFFINVNKTLK
FT                   EYTTKNQGISGSTHPDSLTVSIAYDRSIISESSLKYIDLELCSKSRGAMLIDWYSLHKN
FT                   KPNAEIVLKADSNKFKNLLFRTLSEF"
FT   gene            complement(49182..49592)
FT                   /locus_tag="YN1551_0058"
FT   CDS_pept        complement(49182..49592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0058"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47257"
FT                   /db_xref="GOA:C3NJ90"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ90"
FT                   /protein_id="ACP47257.1"
FT                   /translation="MEVDLANLLRQRNLKVTPQRIAILKLIMRGGHYSGEQIYEELKKT
FT                   EPSISLSTVYNTLETLKESGILNSFEANGITWFEINRKPHVNVFCTDSNRIIDLDVEMD
FT                   NFMDKLVKNGLDVKNVNIIVYADCSKLGKGSE"
FT   gene            49696..50181
FT                   /locus_tag="YN1551_0059"
FT   CDS_pept        49696..50181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47258"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ91"
FT                   /protein_id="ACP47258.1"
FT                   /translation="MQNFREISIDIVLSHRIRNYDQIILEGSRKRDSCAFFIYGYCKKI
FT                   SSKSKVLASWISNGKIVPHPLFCYLCPFYSLRDDDKTVTIDLFDIYLTYKNLKTQIERE
FT                   LEFIESRLSEFSFSTSIALRRRREDLIAFLDDISTKIKILMEIIRVSEREHGDGRYI"
FT   gene            50159..50836
FT                   /locus_tag="YN1551_0060"
FT   CDS_pept        50159..50836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0060"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47259"
FT                   /db_xref="GOA:C3NJ92"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ92"
FT                   /protein_id="ACP47259.1"
FT                   /translation="MGTEDIFNDPKSYKKWYELHNKLYENERKVVRSFNLKDCLDLGSG
FT                   PDIFHEEIRGKIVSLDISLLMLKESKSDEKVLADALHLPFRDDSFKCIFSSVTVCFIED
FT                   VKGFIKEIARVAKERAVICFIARDSPWGEYYEKLGKSGHKYYSYAHFISRRELYVVIND
FT                   FMKISRIRSTLKDMSETETDETYNDDRGSFICVEAIPKKSEPLSLSLNRHSGADPADPI
FT                   SKL"
FT   gene            51125..51724
FT                   /locus_tag="YN1551_0061"
FT   CDS_pept        51125..51724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0061"
FT                   /product="cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47260"
FT                   /db_xref="GOA:C3NJ93"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ93"
FT                   /protein_id="ACP47260.1"
FT                   /translation="MINIFAIILLSLIVVYTSITSLLKETTNSSFALIISSALASILTF
FT                   FASPKEKDNLGKRGLYVHIISDFLGYIIGFVIGILILISGIHELDPVGAIILVILNFAL
FT                   AIPLLKESFLIFMEGSPVKIDNIMGELTKISPGIHHLHVWSICDHVKVATLHVKASPNL
FT                   TIAEADKIRGSICSLLREKYGISHVTVQFETTNDDD"
FT   gene            complement(51721..52740)
FT                   /locus_tag="YN1551_0062"
FT   CDS_pept        complement(51721..52740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47261"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ94"
FT                   /protein_id="ACP47261.1"
FT                   /translation="MIRKIYDKLAESHNEIKNQIYNIASYLRQEIQEKVNEFWTEYTRD
FT                   NELSEICRFVAIDGGSFSKPMRIGIVYAVGAESVIGDNKGVKTLSEDGQIGIFKPGNDA
FT                   QERISLLMEALELSVALRDGSKGDYILMDGSLNKKIGNKVDIQQISDEELKLVKNVDIN
FT                   SIISIKDERKMRDLLMLLNQFLVSRIIEQYDGKVLWISKTSRGRDLFGTDYPDITVFEL
FT                   FTEKRGFSKLIIKNIDIRKISEIPELEILRKMEYTTFYTRLDNGKRVVRIDMVGRVDEK
FT                   IVKEIMDHLSGVSIKGYPFPLLKAHIDVRFSRMDREKIIKLMGSKLHKDIEWWPSQFY"
FT   gene            complement(52737..55333)
FT                   /pseudo
FT                   /locus_tag="YN1551_0063"
FT   gene            complement(55330..56478)
FT                   /locus_tag="YN1551_0064"
FT   CDS_pept        complement(55330..56478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0064"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47262"
FT                   /db_xref="GOA:C3NJ95"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032885"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ95"
FT                   /protein_id="ACP47262.1"
FT                   /translation="MMVQILHISDTHLGKRQHSLAEREKDIYDVFSQLIDIAIKERVDA
FT                   VIHSGDLFDVSNPTTNALVIAVKILKKLKDANIPFLSIPGDHDTPKRKGYIIPHNILTE
FT                   LDLIKILNYDKPYIIKDIEIYGIPHIPTVSKNVLVSTLSSLKPKSSRSILLLHQGVKQI
FT                   LPYDGSWQMELGSLPKGFGYYALGHLHTRWRLIQDDGSIIAIAGSPDIMREEEIEGYEK
FT                   FGKGAYLIDFSKDLPTLTTINTTVRPQKVVTINTKNLKNDISKIKSDLLKNNKGENNKP
FT                   ILHIIVEGERMRKDLLYRELLPLNDIALYYRIYKDETIQSVDNLTYTLPQDRGLDKIII
FT                   EYLTKYEKFNEDEANLILQMIKNVDSEDIVNEILKRLTGVNL"
FT   gene            complement(56478..57980)
FT                   /locus_tag="YN1551_0065"
FT   CDS_pept        complement(56478..57980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0065"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47263"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ96"
FT                   /protein_id="ACP47263.1"
FT                   /translation="MIIGYVIGQATTQEALILAERPVRLGTYVVLEYDNVKALGLITNV
FT                   TRGSPMLDDNMNDIEIVQRLKQFNNSIPVYTKAKVKMLCDMNNHFLMPDIPPFAGTPAR
FT                   EAEDEELKSIYSQDGQIRIGSLIGKNVEVKLNINSFARHLAILAATGSGKSNTVAVLSQ
FT                   RISELGGSVLIFDYHGEYYDSDIKNLNRIEPKLNPLYMTPREFSTLLEIRENAIIQYRI
FT                   LRRAFIKVTNEIRKKLKEGQIPFSTLNSQFYELMRDELETQGNSDKKSSAKDEVLNKFE
FT                   EFMDRYSNVIDLTSSDIIEKVKRGKVNVVSLTQLDEDSMDAVVSHYLRRILDSRKDFKR
FT                   SKNSGLKFPIIAVIEEAHVFLSKNENTLTKYWASRIAREGRKFGVGLTIVSQRPKGLDE
FT                   NILSQMTNKIILKIIEPTDKKYILESSDNLSEDLAEQLSSLDVGEAIIIGKIVKLPAVV
FT                   KIDIFEGKLLGSDPDMIGEWKRAEENERIAKGFADFGTEIGD"
FT   gene            complement(58076..58624)
FT                   /locus_tag="YN1551_0066"
FT   CDS_pept        complement(58076..58624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47264"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ97"
FT                   /protein_id="ACP47264.1"
FT                   /translation="MALGKETEMGLKELFKANAEDFMSLMLVAEKLEQLGKKEEAKALR
FT                   EKALVELGHAKAIFETLLKNQELRGVVGEMAKEEQEQHISEYNKVAMTAKQEGHEDIEK
FT                   MLCSFADQEAKIAETIAKVSKVLNEMAKEEQEQHISEYNKVAMTAKQEGHEDIEKMLCT
FT                   FAEQEAKISETIKSVAKAL"
FT   gene            58882..60387
FT                   /locus_tag="YN1551_0067"
FT   CDS_pept        58882..60387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0067"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47265"
FT                   /db_xref="GOA:C3NJ98"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ98"
FT                   /protein_id="ACP47265.1"
FT                   /translation="MISVKEMRALEINSSALGVSTLILMENAGRSVKDEIVKRFNVKDK
FT                   VAYVYVGHGGKGGDGLVAARHLADEGAKVTVILLGENKHEDAILNLNVIEEMDYSITLV
FT                   EIKDMDELKPISADILIDAMLGTGFSGKPREPFRSAIKAFNNSKGFKVSIDVPSGINAD
FT                   TGEAYEDEYVKPDLVVTFHDIKPGLLKYNFNTVVTKIGIPVEAQIYVGPGDLIVNVRSR
FT                   PYYSKKGDSGRVLVIGGSYTFSGAPTLAAMGALRAGADLVYVASPEDTARIIAGYSPDL
FT                   ITIKLRGKNFSPDNFEELKSWIDRADVVVIGPGMGLAEETIEASKLIVNYVKEKNKLAV
FT                   IDADALKAISGFDLYENAVITPHAGEFKIFFGEEPNKNIRDRISQVIRYAKKCKCTVLL
FT                   KGYVDIISDGKRFKLNKSGNPGMTVGGSGDTLTGIIATLMAQKIEPFIAAYLGVFINSL
FT                   AGTLAYNRLGAHLTPTDIINEIPNVINNPLDSFKRKLYKRVLS"
FT   gene            complement(60379..60828)
FT                   /locus_tag="YN1551_0068"
FT   CDS_pept        complement(60379..60828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0068"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47266"
FT                   /db_xref="GOA:C3NJ99"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJ99"
FT                   /protein_id="ACP47266.1"
FT                   /translation="MNVGEEAPDFEAESTLGKIKLSDFRGKKVILYFYPKSFTSGCTRE
FT                   LQRFTELYDEFKKLNAEVIGVSVDKIDTQKKFAEKYGAKFPIVADAQKTISKLYSVLNE
FT                   RGTSAQRVTFIIDENGKIVDILKNLKKAEEHADKSLEIIKEQNST"
FT   gene            60909..62444
FT                   /locus_tag="YN1551_0069"
FT   CDS_pept        60909..62444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0069"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47267"
FT                   /db_xref="GOA:C3NJA0"
FT                   /db_xref="InterPro:IPR007566"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NJA0"
FT                   /protein_id="ACP47267.1"
FT                   /translation="MRIIPRTMSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGV
FT                   HEVMWDAEGKDVDTHVVRKLLSNYPDYFREHILGKDVFLTYRLPNPKVEGADRKVFAET
FT                   MESIPITYDLAEKFYGNGITVPVFEVILPMTTSNLEIISVARYYEKAVANEDELELYDG
FT                   VKVKDLVGEIYPKVIEVIPLVEDRDSLQNIDNIVEGYYKVIKPKYMRVFLARSDPAMNY
FT                   GMITAVLSVKIALSELYKLSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYT
FT                   YTIQSAFKYDYDYDKVKSAISSINNSRIGPAKILEKYEEDVLRKITILYTERYQPIIEN
FT                   LANAINDVSVLLPRRRARKLHIGLFGYSRSAGKVSLPRAISFVGSLYSIGIPPELIGIS
FT                   SLSNLDEKEWDIFKQNYVNFKHDLQTAARFFNWESFELIKDIWKISEDTIAKIKEDIDY
FT                   AESVIGIKLGGIDYDSRKHILMSSLFLLSFKEKILQESKKYLYEMALIRRSLG"
FT   gene            62441..63250
FT                   /locus_tag="YN1551_0070"
FT   CDS_pept        62441..63250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47268"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJA1"
FT                   /protein_id="ACP47268.1"
FT                   /translation="MRILVNGLLPLDSGKTTFSLSIIRLFNQVGIRLFPFKPIAGHNAW
FT                   YSFNTLIRSEELGILVGNDALKYYDETKYDIRRINPFAVLFVPIDLEKLSYNVSLYNMI
FT                   MEYGFPYLIRLSDCINGIDQYFVNSSADIYVPKSMLKFTRNLALKFNAKSYDKMREIID
FT                   ASPQLVDNCTIDVFRNYENVIIESYNDSASPTYNSADVDYVFTVSPTKAFLIKGEEFKK
FT                   ALSLFSIPAWNVRVSTLIKYLKIGKSFEIDVGERVAKDEILDILLKS"
FT   gene            complement(63240..63908)
FT                   /locus_tag="YN1551_0071"
FT   CDS_pept        complement(63240..63908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0071"
FT                   /product="protein of unknown function DUF1641"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47269"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJA2"
FT                   /protein_id="ACP47269.1"
FT                   /translation="MTNGEFYALDNLLKDEKLNSLNKILDVINTTDRLGILDVIKGILE
FT                   DENTIGKIIGSLTSDDVLELLASWDKIIKTTKLFINDDNIYNIQFLINLIDKVRSRGIL
FT                   DPIIGLLEDEESLGKIINSLINDFTLSLINHWDEITNDLSRIDLTNFKYYTLLVSATGE
FT                   ALKTENVKPITSIWEIYKLLKDPDIQRGLGVAASVLKHIGKLYVPDKGLAFEAEKNSKT
FT                   "
FT   gene            complement(63915..65159)
FT                   /locus_tag="YN1551_0072"
FT   CDS_pept        complement(63915..65159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0072"
FT                   /product="FAD-dependent pyridine nucleotide-disulphideoxido
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47270"
FT                   /db_xref="GOA:C3NJA3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJA3"
FT                   /protein_id="ACP47270.1"
FT                   /translation="MKLIRMTKVLVLGARFGGLSAAYTLKRLAGNKAEIKVINNTRFSY
FT                   FRPALPHVATGVIDEDDVKVDLTKALPEKRMNFQQGTVEKIDASGGLVYYTKPDGNKTE
FT                   EDYDYLIIALGAHLGTELVKGWDKYGYSVCELDYALKLREKLKDFKGGTIAIGSGLFYQ
FT                   GKTPKPKVPENYVPVADAACEGPIFEMSLMLSGYFKKKGMLNKVKFVVFSPGEYLSDLS
FT                   TMSRKIVREMYKQMGIELVENFRIKEIRENEIVDEAGKTIKADLTILIPPYTGNPALKN
FT                   STPDLIDDGGFVPTDLNMVSIKYDNVYAVGDANSLTVPKLGYLAVKTGNVAAQHLATRL
FT                   GVQVKVDQYYPTIICVADNPFEGFGVAVKDDTWYGGTTSIAAPSPINHMKKELFHKYFI
FT                   WTKGDMALEKFLASW"
FT   gene            65293..65886
FT                   /locus_tag="YN1551_0073"
FT   CDS_pept        65293..65886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47271"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJA4"
FT                   /protein_id="ACP47271.1"
FT                   /translation="MQQLIDKFLEVKGRKIHYIESGDGSPVLLFHGARFNARTWVETNT
FT                   VDSISNIGYKAISVDFPGFGSSEKIEGISLSEFINLFMNSLGISKAILLGASMGGKAVL
FT                   EFSLKYTESVYGLVLVGAVGVEEFEDQISKLNKIPLLLIWGSRDTVSPKRNYELILDKV
FT                   KNAKLEIVGKNHACYLDDPNTFNEKIVNFLKGMK"
FT   gene            65883..66524
FT                   /locus_tag="YN1551_0074"
FT   CDS_pept        65883..66524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47272"
FT                   /db_xref="InterPro:IPR017139"
FT                   /db_xref="InterPro:IPR019254"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJA5"
FT                   /protein_id="ACP47272.1"
FT                   /translation="MSDKEELSAKLRIILRDIRYLTILKHLKIANVDYGKSIMLNTRIP
FT                   LAEIVEILDDLERLGLIERVHGATLKNTEAKFKLSSEVHKHHTYYRLTREGDHLLRHLE
FT                   DRMLIDAYMEIVKNDNLALNILRLADELNADHALTYAKLTHKRLEEITPKIEELVKMGL
FT                   LEEKNSKIIKFADRKAKPKKETRTHHKYYGLSRIGELVVREMKRRGILPK"
FT   gene            complement(66513..67460)
FT                   /locus_tag="YN1551_0075"
FT   CDS_pept        complement(66513..67460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0075"
FT                   /product="LAO/AO transport system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47273"
FT                   /db_xref="GOA:C3NJA6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJA6"
FT                   /protein_id="ACP47273.1"
FT                   /translation="MLNNNLPKLIEEALNGNELAIARLLTKIEYMTDEGISALGALSKR
FT                   SGNAHVIGITGIPGAGKSTLIGGLIQEYVSRGHRVGVIVIDPSSPYTMGSFMGNRLRFQ
FT                   DKTMLKNVFVRSIGSRGYLGGISAEALMLTEALDGLGYDKIIIETVGAGQTDTEVEQSV
FT                   HTILVVTIPGAGDDIQALKAGIMEIGDIYVLNKTDRPDAELTFNTLKFAIDSSEISYRD
FT                   GWKPLIVKAVAIKNEGISEIVNKIEDHLNYLKQKELFKKRIIDRRAKIVELIARRKIDE
FT                   IISEIVKKNYNTIINEDITEAVPKVIHNVKELLR"
FT   gene            complement(67450..67875)
FT                   /locus_tag="YN1551_0076"
FT   CDS_pept        complement(67450..67875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0076"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47274"
FT                   /db_xref="GOA:C3NJA7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJA7"
FT                   /protein_id="ACP47274.1"
FT                   /translation="MMITTKRIKVIVAKLGLDGHDRGAKVVARALKDAGMEVVYTGLRQ
FT                   TPEQIVKAALQEDADVIGISILSGAHLELIPKVIEIMRQNGLNDVGLIVGGVIPPDDIK
FT                   KLKDMGVDEVFLPGSSLKEIVEKVKKVARQKRGIDVE"
FT   gene            67987..68274
FT                   /locus_tag="YN1551_0077"
FT   CDS_pept        67987..68274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47275"
FT                   /db_xref="GOA:C3NJA8"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJA8"
FT                   /protein_id="ACP47275.1"
FT                   /translation="MFKMWYLHISIAIIALILSSLVVLEFVRMRKEFRGKLTTVLVLLG
FT                   SFLIAQFGSFLLDFIMWSNDKNPIYIYPSLITVSLSFITILLFYYYITKI"
FT   gene            complement(68261..68668)
FT                   /locus_tag="YN1551_0078"
FT   CDS_pept        complement(68261..68668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0078"
FT                   /product="regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47276"
FT                   /db_xref="GOA:C3NJA9"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJA9"
FT                   /protein_id="ACP47276.1"
FT                   /translation="MEEELTGTARKIYLYLLRQKRPVGIRKIQKDLNLSSPSVVSYHIK
FT                   KLIEDGLVKEVDEGYIVTKVILEDYIRFRSALVPRSIFLTSFLVSSLVILIYLIISHPF
FT                   SADIFSLVVVFIITIISVYDVTRKYKKLKSL"
FT   gene            68738..68827
FT                   /pseudo
FT                   /locus_tag="YN1551_3244"
FT   gene            68875..69414
FT                   /locus_tag="YN1551_0079"
FT   CDS_pept        68875..69414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47277"
FT                   /db_xref="GOA:C3NJB0"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJB0"
FT                   /protein_id="ACP47277.1"
FT                   /translation="MNIVVNVKQYLMVIAGVLVSLAIASLVVYVSHMFITYAIKKPNIV
FT                   ERQSGYAPQMYELTVNARPPNGSYINSYFIYSPLQSSLVINKDPVFHVYPSIIDLNSFN
FT                   NSAIITIYYSAHDRVNIAVTQQIFNVSVINTTVINDEIVSTQVKITFYDASPNTIYLIP
FT                   IWNQYNVTYYVLIYYE"
FT   gene            complement(69498..69974)
FT                   /locus_tag="YN1551_0080"
FT   CDS_pept        complement(69498..69974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47278"
FT                   /db_xref="GOA:C3NJB1"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJB1"
FT                   /protein_id="ACP47278.1"
FT                   /translation="MKDSEYYVWVLVGSIILTIILLSMAPLVPIDEPLVYRASSGVTYN
FT                   LTIPVGVSFSAFIALIIFIISILLVSGYKNDYYNMIIDASGISFAFLNYLNYYLIWYVW
FT                   RPQIQMLPFLVEISYNHAATLQLDIGQIVIVIFLYRLYKRLRKPRSLSGPDEKL"
FT   gene            70064..70369
FT                   /locus_tag="YN1551_0081"
FT   CDS_pept        70064..70369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47279"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJB2"
FT                   /protein_id="ACP47279.1"
FT                   /translation="MSTTKKFYELQDLILAKMSLEKVKLHIEERKDRTIFKWVRKELTG
FT                   FFRKFSNVERFRDLVNSINKGLEEENYELILENVKRSLVIISDEIEQYYQDLQKMQ"
FT   gene            complement(70352..71233)
FT                   /locus_tag="YN1551_0082"
FT   CDS_pept        complement(70352..71233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0082"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47280"
FT                   /db_xref="GOA:C3NJB3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJB3"
FT                   /protein_id="ACP47280.1"
FT                   /translation="MFQDPSFQITVTPLQYVLSIISGILVGFSLGLIGGGGSILAIPLL
FT                   LYFVGLANGIAPGTPEYSYITHLTLGTTALAVGINAYINSYMHFKRGNVRVSEGIVFTI
FT                   PGIIGDIIGAYLSHLMSGALILFLFGFLMIAVAIRMWKSKCNPNKSILSNNSHKLTLRE
FT                   RIKIDKVLPAGFLVGFASGYFGIGGGFLVVPGLLFSTGLDMLRAVGTSLIAVGTFGVAA
FT                   AITYAVYGYVDIVISLLYLVGGVAGGYAGSAIASRMPRQTLRKLFAIIIILVAIYTMYV
FT                   NRVGVVDLLHFL"
FT   gene            complement(71437..71835)
FT                   /locus_tag="YN1551_0083"
FT   CDS_pept        complement(71437..71835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0083"
FT                   /product="iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47281"
FT                   /db_xref="GOA:C3NJB4"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJB4"
FT                   /protein_id="ACP47281.1"
FT                   /translation="MSNLSRREFSYLLIIKRYNDGGEGAKINRIAKDLKIAPSSVFEEV
FT                   SHLEEKGLVEKKEDGVWITNNGTRSINYLIKAHRVIEILLVNIGIDKQTACEYSKQFDY
FT                   LVPGEIIDKLYNYLGRPSYCPHGLEIPL"
FT   gene            71891..72760
FT                   /locus_tag="YN1551_0084"
FT   CDS_pept        71891..72760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0084"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47282"
FT                   /db_xref="GOA:C3NJB5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJB5"
FT                   /protein_id="ACP47282.1"
FT                   /translation="MKDNISALITPFDDKENINVEALQQLLDFLTRSGIKDFWVLGTSG
FT                   EFNMLSQDERILIVSKIREITKGKIYAGINENSLKNSLILAKKYYDIGVDYIFSVPPIY
FT                   HKPSEKGLVTYFNELRNTIDLPLFLYNIPSFAGYNVPLRIVEKLAEEEVLNGMKYSTTD
FT                   FVSFLKYLKGLKGVNKNFKVFIGEDRMILSALIYDADGAVSGISNLVPELVTNLFLEFD
FT                   RGNIQKAIEIQRMVNKLVDVVSLGDYPSGIKIGLRYRGINVGSVRKPLMEDSRAEGEIY
FT                   NALKEIGI"
FT   gene            72822..73472
FT                   /locus_tag="YN1551_0085"
FT   CDS_pept        72822..73472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0085"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47283"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJB6"
FT                   /protein_id="ACP47283.1"
FT                   /translation="MDTLDLIAEEVRKCQKCRLWKYRKNAVPGEGNNKAEIMFIGEAPG
FT                   ENEDIEGKPFVGAAGKLLTRLINEVLGLSRDDVFITNLVKCRPPNNRDPEEDEIIACSP
FT                   YLHRQIELIRPRIIITLGRHSTSYLFQIMNIKMESIGKVRGKFYTWNEYGYKILVFPTY
FT                   HPAAALYNPPIRKILEEDFRKVKEALSSKPITLDNFLYGSGNKGEKGNSDSSK"
FT   gene            73423..74208
FT                   /locus_tag="YN1551_0086"
FT   CDS_pept        73423..74208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0086"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47284"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJB7"
FT                   /protein_id="ACP47284.1"
FT                   /translation="MDLGIKGKKVIVTAASKGIGLAIAKRFLEEGAKVIISSHEESNLI
FT                   KAYNKLREIYGDNVSYIKADLTNPQEVKYLVHEGYRKLGGLEVLAYVTGSPKPGNLFSL
FT                   TDRDWIDAFNLLLLSAVIAVREAGQLMQSGGRIILSTSTTLRQPIDNLDLSNVVRLSLA
FT                   GLIKVASRELGPKGILVNGIMPGWTKTERLLQIVRDRAMRDSKSEEEVLKAIVADVPLG
FT                   RAGEPEEIANVVIFLASNLATYVNGTLIPVDGGSIKGVF"
FT   gene            74319..75806
FT                   /locus_tag="YN1551_0087"
FT   CDS_pept        74319..75806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJB8"
FT                   /protein_id="ACP47285.1"
FT                   /translation="MRITEFYVSNFRSLSEVNLKDLGGFNVVVGYNGYGKTNLFSSIFL
FT                   FIKNLSAGIEKRSVEDRNQEFILLWQGYDVSKPIMIGGKVEFSPEEANKIVGKNQKITL
FT                   EIVNKMRYNNKFVEWNLDTLYINGSPPGEDDLKVAKKLAEYASQAIEYVPIFDQAYFDE
FT                   TLRRMTDMNKSPINLRKYWYDFVNLVAATIPEVKGMEFWDGRRLVLNVYNLPIYVDLAA
FT                   SGFQRVILMLFIIWLSGNKILLIEEPEVNMHPTLQAKIMKLIKNWTDNNILQSFLTTHS
FT                   PYIVEMSADSYVVMRRVNGNSTAITVKPTADLRGTISLLNASLSSILFSRIIILTSELA
FT                   EPSVIVNWLKRLNINVEDNGISVYKVSSDLELQHWLKLKNMLNLDVIFLGLCDKLDMTL
FT                   KDYCVPLSREVENFYSKQALLEVLRRLGIYPDEKEIRDLGKEENLRWIINVLRKRGIEY
FT                   EKLRMSIGELITNADTIEIPKEIEILANKIKSLQPTL"
FT   gene            75810..76055
FT                   /locus_tag="YN1551_0088"
FT   CDS_pept        75810..76055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0088"
FT                   /product="Protein of unknown function DUF131"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47286"
FT                   /db_xref="GOA:C3NJB9"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJB9"
FT                   /protein_id="ACP47286.1"
FT                   /translation="MDLSILFDIGILLIFIGIILLFVGMIREASNSSDRNQKTHVGGVI
FT                   FIGPIPIVFGSSKGIAKWMLIVAVILVILMVIFYIL"
FT   gene            complement(76077..77360)
FT                   /locus_tag="YN1551_0089"
FT   CDS_pept        complement(76077..77360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47287"
FT                   /db_xref="GOA:C3NJC0"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJC0"
FT                   /protein_id="ACP47287.1"
FT                   /translation="MRSTTVAILALITMWGILGSLVISQANTTIINSITIPTSMTYIVK
FT                   LINSTTVANKTITHVYNYTLTYQVTKFVQNVIYVNISGNFTNGSLKLGNDVYIKKGEYE
FT                   VNLLYQPLSIYYPFIEPSLIYNTSYGIITPNETMALVYKGKTFSITNGVNYTSYNYSVN
FT                   INNQQISVNILGNGIVSKLENRSLELILHSFSNLSTIPLNSIVNSQYTSFLNRSYLYAV
FT                   YNYSALSNSLIPEGYLQISYPIVLGNDTITAQITQIQMRAGQQLALPASLLGDSVNFVL
FT                   YINQPQNIPTSFTLNVGAKNITWNNNVFTLVGESKVSTPIGNFIAYQYVRNISQNQVQQ
FT                   VLYFTPNGTLIKEEVVEMINSTTQIPSFSLSFVGNNYISPYETYPNVFNYTNTSLPFKV
FT                   INPNLSFTISIVITIIIVAVLVILRKKD"
FT   sig_peptide     complement(77280..77360)
FT                   /locus_tag="YN1551_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.795 at
FT                   residue 27"
FT   gene            77300..77833
FT                   /locus_tag="YN1551_0090"
FT   CDS_pept        77300..77833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0090"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47288"
FT                   /db_xref="GOA:C3NJC1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJC1"
FT                   /protein_id="ACP47288.1"
FT                   /translation="MTLKFPTWLLRPRLQLLLISYTIHHKLLNINFYRYFMDRPLVAVG
FT                   CLIVEENKVLLVKRKNPPNAGLWAIPGGKVEYGETLEDALKREMREETGLEVAVSNIIS
FT                   IVQVINEGYHYVILDFECKPIGGKLRASSDASEVEYIPFNKLKDIPTTKTTYDMLIMYF
FT                   KGEKPPYSIIQISK"
FT   gene            complement(77814..79226)
FT                   /locus_tag="YN1551_0091"
FT   CDS_pept        complement(77814..79226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0091"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47289"
FT                   /db_xref="GOA:C3NJC2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJC2"
FT                   /protein_id="ACP47289.1"
FT                   /translation="MDFRIRVYNSLGRKLEEFNTINPNLVKMYVCGPTVYDYVHIGHGR
FT                   TFVVFDAISRYLRLKGYTVIRVQNITDIDDKIIKKSQDTGKDWNEIVNYYTKDYLDMLS
FT                   QLKVKIDIHPRVTHHIKEIINFVQKLIDKGHAYVAPSGSVYFDVDTYPDYGELSNTKKE
FT                   EWNQGEEFVKEKKHSYDFALWKAWKPGEPYWESPWGKGRPGWHIECSTMSTRYLGERFD
FT                   IHGGGADLVFPHHENERAQTEALTGEKWVSYWVHSAFVTIRKEKMSKSLGNIIPLNEAI
FT                   KKWGPSVLRYWYLTSHYRSPIDFSEEALEQAKSALQRIKDSMAIIRNIISEGPKFYAKD
FT                   DDIKVYREILNNLDSFHTAMSNDFDTSTALSYIHEIVRLVFSTLQYSRDFLGAMLAFEA
FT                   LSQFNEVFGVMDEEFYPTYDKMYKVIDAVVDIRNQLRQMKLYEISDKIREELLKAGVRI
FT                   LDSKDKSTWRFE"
FT   gene            complement(79239..80129)
FT                   /locus_tag="YN1551_0092"
FT   CDS_pept        complement(79239..80129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0092"
FT                   /product="bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47290"
FT                   /db_xref="GOA:C3NJC3"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJC3"
FT                   /protein_id="ACP47290.1"
FT                   /translation="MDEIYLNWDRMFDEAYRIPIHEIKNDNIVFSGIGGSGIVGEIANI
FT                   LGVELSFKRKFTGKESLVAVSYSGTTSETIVDVENAVKAGSEVIIITSGGILEKFAKEK
FT                   SLKLINVLSGFQTRYAFPYLFTPLIKMTTKKRGIKINETELKEGVVEAKEKIKADAARL
FT                   AELLINRIPVIYSSKYLAIAKRFKQEINENAKHPAFYGEIPEINHNEIESYVHGPSLVS
FT                   VIVESSEIDKITEDVLNSIVIKPYFSNDLKNISSLLALAGVTSLEMAKKINEKPDKLYN
FT                   IPKARQLTSKLFRIN"
FT   gene            complement(80122..80559)
FT                   /locus_tag="YN1551_0093"
FT   CDS_pept        complement(80122..80559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJC4"
FT                   /protein_id="ACP47291.1"
FT                   /translation="MKAVERLDNTMAELNKINESELGINELDLLRFLKNQLSKSKSLFE
FT                   SFSKSIDEKRWDDVLSYTFQISQRVNSIFGYLVQPAVFSMISRSKLSENIENIIDSLAF
FT                   SVSEMIIVLKQNNKSLGIDTITVNMSSNPPSMSISVVIKGG"
FT   gene            80612..81937
FT                   /locus_tag="YN1551_0094"
FT   CDS_pept        80612..81937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0094"
FT                   /product="CoA-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47292"
FT                   /db_xref="GOA:C3NJC5"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017758"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJC5"
FT                   /protein_id="ACP47292.1"
FT                   /translation="MERLIIIGGGAAGMTASSWARRLKPNIDITVFESTKMVSHAPCGI
FT                   PYFTEGLFDDENLFMTYTPEYFVEKRKINVKINSKVEEVDLRSRTITVRENQGNKKYEF
FT                   DYLLLSTGAKPKKLNAEGDRIFYVHHPADASYIRQKLWSFDRIAIIGGGILGIEMAEAL
FT                   RARGKKLVLIHRGKYLLNKMLDEDMGKIITDKVGSEIELKLNESLISVTERGRLIVTDK
FT                   GKYEVDATVVGIGVEPNVDLVKDQLKIGETGAIWADNHMRTSFENVYAAGDSTESINII
FT                   TKKPDWVPFAPVANKMGFVAGNNIGGKDVTFPGVIGTMITKFEEYVIAKTGITENEAKR
FT                   HNIKTVSATVHHKTRARYYPGSKDIIVKLIAEANTMRIIGAQIIGEEEVLGRLNMMAAV
FT                   IQKGFTAEELFFVETGYVPPVNRVWDAITLAARKLYTGISGE"
FT   sig_peptide     80612..80674
FT                   /locus_tag="YN1551_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.812) with cleavage site probability 0.804 at
FT                   residue 21"
FT   gene            82012..83130
FT                   /locus_tag="YN1551_0095"
FT   CDS_pept        82012..83130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47293"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJP1"
FT                   /protein_id="ACP47293.1"
FT                   /translation="MAKKLELPVLLKDIISNYIVNYLTSSSSMSPGAENLVGENDNSGI
FT                   LVSPLNEFIKVVSAESNQSLIYSLDGSSRSFISSKGIISVASVVVSSTISPIFGVYPPI
FT                   SGFPELDLRKPFLALASSAHQSPLLPFFYSSEYVTTLSLDGSFFTSVNSPEEIETEIRT
FT                   ILETEALKKIPNDGSVILDGPLIPPLIFLRSKVRDDVLNLRLEAIRGRNVIGIVKRLDK
FT                   SRLLISSLYKLSSKFMEKFRIDPRRYFSDESFILDLIKANLSPPYSPISLGPILRNIVN
FT                   TPVYVNYLIYPLHPYVYKFAILRVESLSNDSRVIDQLSSLKFTKDGIPFVLAIADRTAK
FT                   EITNAILKIVMTSLESMGLQASFYSKLEQVRI"
FT   gene            83127..84956
FT                   /locus_tag="YN1551_0096"
FT   CDS_pept        83127..84956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0096"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47294"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJP2"
FT                   /protein_id="ACP47294.1"
FT                   /translation="MSSDVPLYNDIKDKISKARALAITLGDFIGKVSRYVPSRVDEENN
FT                   VVNVTIDPNTYYKYPFLGKIGIFLGAIDIKTLYFILLRVIGYERNDASSLFIGDSNVLN
FT                   NIGLSDDEPGSLITNVTLKCEMLTKVDFLSSSEPDAADIILEPQSPVIIPKPEVIERSL
FT                   GTTRGLLRLGFLDVAYSKVRVSASLDDLNFHMLILGTTGAGKTSFIKDLIAGLNVANEE
FT                   GSKIFILDATGDYYHIFLPPDRSDKVVMRGVEEFNQLYSAIVKGINLDIIYPVSKSWVK
FT                   KYLGGAKSAGSIAKVYFDMFVKPILNHLNNKGISIYASIINNKIIISNAEWSSQVTIYP
FT                   FYFRFKDVKTILHRLNPYFTEQASHFIKIMIRKKGKDIGKLEDLIDLFNENSLEGVEIH
FT                   RSTRENIVRGLYLLKETQLFDVSVERFPLSKILKESSSSTLVFDLYNSELDDFSQKILT
FT                   YYFLDRLFEFRERQMRSGNVKGRNVIIIDEAHRFFPSSKGGEEDTNYIRRVAGKIATMM
FT                   RLGRRRKIGFVFATHNPNDLSDIIIQLANTKIIFRIKSEVAETLGLSKTEAKILNWERN
FT                   GVAYLLTPWLREGKIKIKTPVPPPLGHYDLSKT"
FT   gene            84981..85370
FT                   /locus_tag="YN1551_0097"
FT   CDS_pept        84981..85370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47295"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJP3"
FT                   /protein_id="ACP47295.1"
FT                   /translation="MESNLENVINTLKRKKDKEVVIEFLKTVRKYLPPSDDFSITLWKS
FT                   GIYEYILDRNGVAIMRIAEDEYLPYMSAYEKRMDYSQLPDNLVNNLDWKGVLRQLRDIA
FT                   LEYAKRDKNFDKIAEMVNHVILENL"
FT   gene            85348..86304
FT                   /locus_tag="YN1551_0098"
FT   CDS_pept        85348..86304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0098"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47296"
FT                   /db_xref="GOA:C3NJP4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJP4"
FT                   /protein_id="ACP47296.1"
FT                   /translation="MSYLKISDTTIETFRFIHYEQSNFLNRLHGGDMLFFLVEAGMLSA
FT                   TKVAMGTTVLASLDDVIFKKPVKLGDIVKVRAETVYVGNTSLEVEVSAFDRDEEVVSAY
FT                   ATYVKVDDLLRPAPVNVKIIAESEDDKRKMDEAKRRRENRLSKILNRQKMRFYVDDITD
FT                   GLRYRISNVVHVSPELTYDGRIMSAGKLLKLMDDLGGIICLNYMNYNSKNIYDNVFNAV
FT                   VTVAVKGLAFYSPIRLNDIVTIRAGLIYVGNTSADILINVIREDVNGTKEHVATAYFTY
FT                   VRVDKEGKPIKMPEYVPVTEREKRLHEEALTRRGLRK"
FT   gene            complement(86265..87353)
FT                   /locus_tag="YN1551_0099"
FT   CDS_pept        complement(86265..87353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47297"
FT                   /db_xref="GOA:C3NJP5"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJP5"
FT                   /protein_id="ACP47297.1"
FT                   /translation="MGQYFIITSFTMIGLLFPVEFYSETKSLILLGVITGIYNALNALG
FT                   SYIWGYLIDKTTLRKEYAVILSLFGVVIGLIYHYDKLIAYELSGFVSALDGPIYSAILL
FT                   ETTPQEKLVLGNTRISQISLAGNVTGSLLSAFYHNDYLILIFFSVSLIFNVIHIPKYDG
FT                   GINYDVADRNKLLRILLIPIISYFWFNMAAEIFYILFVPLNYLMLNPSYVIFLSYTFLY
FT                   LIEEVIYSKGISVVKGREEYFMLLVTFARSLIVLSLVYIILMGLKIYEGTMLLFLVFGP
FT                   LFPVYNISFFSLLIKGLKRNKATIIGIFNVSEDIANVVGGFLSGSTNNIVSGYQISFYS
FT                   FALSLFLIYIYLRKPLRVSASS"
FT   gene            87407..88186
FT                   /locus_tag="YN1551_0100"
FT   CDS_pept        87407..88186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0100"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47298"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJP6"
FT                   /protein_id="ACP47298.1"
FT                   /translation="MVVSYHMRFKDKVILITGGTRGIGRAITEAFLREEGLPIVLYNSA
FT                   ENEAKKLREKGVFTIKCDVGNRDEVKKSKEVVEKEFGRVDVIVNNAGIMVLMPFEEFDD
FT                   EKYNKMIKINLNGAIYTTYEFLPLLKLSKNGAIVNIASNAGIGTAAEGTTFYAITKAGI
FT                   IILTRRLAFELGKYGIRVNAVAPGWVETDMTLSGKNQEDAEKLRELFRNKTVLKTTGKP
FT                   EDIANIVLFLSSDEARYITGQVIVADGGRIDNLTHSL"
FT   gene            88197..88940
FT                   /locus_tag="YN1551_0101"
FT   CDS_pept        88197..88940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0101"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47299"
FT                   /db_xref="GOA:C3NJP7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJP7"
FT                   /protein_id="ACP47299.1"
FT                   /translation="MKIVSWNVNGIRAALKKNLIDFIENNMFEVIMFQETKGDIVPLDF
FT                   IMMGYEVISFPAKRKGYSGVMTLTKIKPINVIKGLQIKEFDDEGRTVTLELKDFYVINA
FT                   YFPRAGDNLERLDFKLKFNNEIENFVLKLRKAKPVILCGDFNIAHQNIDGAFSNPTIPG
FT                   LTPQERSWFSHFLSLGFIDTFRYLHPNVRKYSWWSYMGKARDKNLGLRLDYCIVSEELK
FT                   DRIKMADILIDIQGSDHAPIILELT"
FT   gene            complement(88932..90597)
FT                   /pseudo
FT                   /locus_tag="YN1551_0102"
FT   gene            90834..92372
FT                   /locus_tag="YN1551_0103"
FT   CDS_pept        90834..92372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0103"
FT                   /product="amino acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47300"
FT                   /db_xref="GOA:C3NJP8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJP8"
FT                   /protein_id="ACP47300.1"
FT                   /translation="MERKQVFVRETSGLIKQVSLTDAVMLNLANMSIGIALFQSISPYI
FT                   TQGGVLWIASLIGMFLALPQALVYTIFNRKVGRTGGDYVWISRNLGGIIGTIFAVAYLL
FT                   ESTAFYAIISFFSASSINSALLTIGYLNHQNTLIYVAENVIVNPYATPTLQQRLIFYGI
FT                   SALAFVIIVLINILHSKWGYKLVTSLGTFSILTVMLAMIIIAINAKHFDSSVIPLLKDF
FT                   NVTVSSNLPKTILPYSISLLATLSLLPLFSLYTYPWMNAGPAVSSEFRGDKVSKFNVFF
FT                   SLLITGILVTLGFLEMDVVGGYYFNLNAYPSAIYNFWTVAMALSLNPIIEWILGLGLIL
FT                   WNYFVLSYGVLVFSRYVFALSFDRVFPEKLSQLNAHGSPVYAHLLDITLTLLFLLIPVF
FT                   SIDAAISLYGASIVGMLYFLAVGISAIIFGQKTKSRLMKIAGILTTIYFVYLTYEAATN
FT                   PLFGFSTTSGVNIITLSFVLGSFVSGIIIWSVTKYMNSKKGIDLSLTFKEIPPE"
FT   gene            complement(92343..92732)
FT                   /locus_tag="YN1551_0104"
FT   CDS_pept        complement(92343..92732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0104"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47301"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJP9"
FT                   /protein_id="ACP47301.1"
FT                   /translation="MNLEPLFQRANELLRASKFNFNSGFYEIAAIAAEESLYLMLNATL
FT                   IKLGADIPWYLDFDVLFRVVSRYSHDDRLSEIRIKERDIIRLLDDIKIRLGYSIPLELN
FT                   EKDIEKLIAFSEKMFDLLWRNFLKS"
FT   gene            complement(92780..93184)
FT                   /locus_tag="YN1551_0105"
FT   CDS_pept        complement(92780..93184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0105"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47302"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJQ0"
FT                   /protein_id="ACP47302.1"
FT                   /translation="MENIEYIFEDVVRIYDTDAQGIAHYAAYYRFFTNTIEKFIKEKVG
FT                   IPYPIVNDDLWFVIAESHAIYRKPVKLGDRLTILLNPKILSNKTIKFDFRILRDGELTT
FT                   EGYLIQIAINPKIWKSTEMPKEIMDKLSIK"
FT   gene            complement(93234..93917)
FT                   /locus_tag="YN1551_0106"
FT   CDS_pept        complement(93234..93917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0106"
FT                   /product="precorrin-6y
FT                   C5,15-methyltransferase(decarboxylating), CbiE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47303"
FT                   /db_xref="GOA:C3NJQ1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJQ1"
FT                   /protein_id="ACP47303.1"
FT                   /translation="MRVSEIPVYIVGVGPGDPEYLTLKGYKAIKDSSIVAGWKSVLERF
FT                   WPILEGKRTVVLTYKIESETLEEIIEIGKTENVAILDHGDPSVSDWQFVEKIRNIATSK
FT                   GVKVNIISGVSSLNIALSRLGLDINFIGFVTLHVRGDISKSLNDLLNILKMGRVAVVIP
FT                   EPYKDGPQKVAKFLYDNNLNCRIVVFEKLSYDDERRRDYDNLISLLNENNEFGDLTIMA
FT                   IFPKS"
FT   gene            complement(93904..94893)
FT                   /locus_tag="YN1551_0107"
FT   CDS_pept        complement(93904..94893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0107"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47304"
FT                   /db_xref="GOA:C3NJQ2"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJQ2"
FT                   /protein_id="ACP47304.1"
FT                   /translation="MIENLWRGIAIISASEDGFKAGEIVKEKLKRFEIPVVHFKYKDAD
FT                   IETVWRCYDAIIFVMALEGATRIICKYAKSKTKDPAIICIDDKINYVIPLLGGHWGAND
FT                   IARDLSVILNSTPIITTAAELKGKLSVEKIANILVAKILNPENIVKINAVLLRDEYVCV
FT                   DGVDINVTFPENIRINSEECNYIVSLRNDKEYKDKIVVWLKPLKISIGVGSKKDVKIDE
FT                   IRDGIYKVLERLNLKRERIGIIASIREEVKKIADEINVKFRLVNEEEINNFTNPCLTPP
FT                   SKTLIEVGLKGVAEISALIAGGINSKLILRKIAISRNSTIAVATYEGE"
FT   gene            complement(94896..95684)
FT                   /locus_tag="YN1551_0108"
FT   CDS_pept        complement(94896..95684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0108"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47305"
FT                   /db_xref="GOA:C3NJQ3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJQ3"
FT                   /protein_id="ACP47305.1"
FT                   /translation="MVGKVVFIGSGPGDPELITVKAKKYIETTDVIVYAGSLVNPEILK
FT                   WSRKDAEVYNSSSLTLNEIVEIMVKKASEGKLVVRLKSGDSSIYGALFEEMWALEAAGI
FT                   PFEVVPGITAAIAAASVIPIELTVPKLSQTVIITRASLRVPMQGSIKDFAKMVKIGATM
FT                   VIYTGIHIIDRVVNELKEGGLTDDTPVIVVYRATWPEQRIIKGTLADIVSKVREAKIYR
FT                   DSVIIVGLASDPQQIKNMVRSSVYDPKHNHSYRPWKVEED"
FT   gene            complement(95690..96358)
FT                   /locus_tag="YN1551_0109"
FT   CDS_pept        complement(95690..96358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0109"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47306"
FT                   /db_xref="GOA:C3NJQ4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJQ4"
FT                   /protein_id="ACP47306.1"
FT                   /translation="MKLYVVGLGPGDEELITMRGAKILKEVRTIFIPYSTGTNRSLAEN
FT                   IVKKYAKSNSKLVLLGFPMAKDVNENELKKIGEKICNESEGDSAFVTLGDPTLYSTFFR
FT                   IKDKLPCNVNVEIIPGVSSVTACASKAMISLANSEDSISIIPASRLDSIEKASEIFETI
FT                   IVLKANENIKEIAQMLSNKYDLLYARRCFMNDEKLVNMEKEIVNDKDYFSMIIALRKKR
FT                   "
FT   gene            complement(96355..96954)
FT                   /locus_tag="YN1551_0110"
FT   CDS_pept        complement(96355..96954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0110"
FT                   /product="precorrin-6Y
FT                   C5,15-methyltransferase(decarboxylating), CbiT subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47307"
FT                   /db_xref="GOA:C3NJQ5"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR023475"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NJQ5"
FT                   /protein_id="ACP47307.1"
FT                   /translation="MEWKYVIPGIPDNFFERDEEIPMTKEEIRALALSKLRIRKGDMIL
FT                   DIGCGTGSVTVEASLLVGSTGKVYGVDKEEKAINLTRRNAEKFGVLNNIVLIKGEAPEI
FT                   LFTINEKFDRIFIGGGSEKIKEIISASWEIIKKGGRVVIDAILLETVNNAISAMENIGF
FT                   INLEITEVIIAKGMKTKVGTAMMTRNPIFIISGEKQ"
FT   gene            complement(96955..98004)
FT                   /locus_tag="YN1551_0111"
FT   CDS_pept        complement(96955..98004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0111"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47308"
FT                   /db_xref="GOA:C3NJQ6"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NJQ6"
FT                   /protein_id="ACP47308.1"
FT                   /translation="MIINSLKRFGITTGAAASAAAKAAVMGLLNREKRNTVVIPTPIGL
FT                   RLEIPVEKVEIDSGIACAEVKKFSGDNPDILDGLVIRCCAKLNESNEIVIVGEKGVGKV
FT                   TRSGLKATMGETAISPTVRDMVINAIREVTDKGIQITIEVPNGDIIAENTLNKMVGIVG
FT                   GISILGTTGIETPVSDDDYLEHIKCELNVIRQSYDFVVIAPGNSAAKYASKLFDSNSII
FT                   KVGDRIGDSIKLASSVFRKVILAGLPAKLLKVYAGIFNTHYSQGDARLESLTHASVLAG
FT                   LPYDVLTKITNALSVEEAFTYMTKEQRRKVMKIVAEKILSRIKSFNGDINFCVIIFDYD
FT                   GESLSRVGC"
FT   sig_peptide     complement(97933..98004)
FT                   /locus_tag="YN1551_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.976 at
FT                   residue 24"
FT   gene            complement(98001..98747)
FT                   /locus_tag="YN1551_0112"
FT   CDS_pept        complement(98001..98747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0112"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47309"
FT                   /db_xref="GOA:C3NJQ7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJQ7"
FT                   /protein_id="ACP47309.1"
FT                   /translation="MGKLYIVGIGPGSKEQRTIKAQEVLEKSNVIIGYNTYLRLISDVL
FT                   DGKKEVIGARMKEEIFRANTAIEKALESDNIVALVSSGDPQVYGMAGLVFDLISRRKLD
FT                   LDVEVIPGVTAALAAAARLGSPLSLDFVVISLSDLLIPREEILHKVTKAAEADFVIVFY
FT                   NLINENLLIEVMDIVSKHRKPNTPVGLVKSAYRNNENIVITTLSSWKEHMNEIGMTTTM
FT                   IIGNSLTYSYKNYMITPRGYERKYEL"
FT   gene            complement(98750..99748)
FT                   /locus_tag="YN1551_0113"
FT   CDS_pept        complement(98750..99748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0113"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47310"
FT                   /db_xref="GOA:C3NJQ8"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJQ8"
FT                   /protein_id="ACP47310.1"
FT                   /translation="MDRQSNTAIMLIGHGSRRETYNSDIEGMINYLKEKISIPIYLTYN
FT                   EFAKPDWRSLLNEIIKEGYRRVIIGLVFLGRGNHVFRDIMGELGIQRLNSWEVSKISGK
FT                   EVEFYVTEPLSSSPLIGLALYYRLARALDALPTLEYTEDPYEIEERSMNYILPNLDVKD
FT                   AREKRVIGKAVFASGNPEVAKYLKVTNLDMGIEAIRSESEIVADVKMVSVGIRWKKVTC
FT                   MIDDERTKELSKELGITRAAAAMRLSIGQGGKVVVIGNAPTALIETIKLVKQGVDIPFI
FT                   VATPPGFTNAKESKEALIESKIPSVVLTGTYGGSGIAVAIINEIIKMAMEG"
FT   gene            100003..100175
FT                   /pseudo
FT                   /locus_tag="YN1551_0114"
FT   gene            100290..101450
FT                   /locus_tag="YN1551_0115"
FT   CDS_pept        100290..101450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0115"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47311"
FT                   /db_xref="GOA:C3NFN0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3NFN0"
FT                   /protein_id="ACP47311.1"
FT                   /translation="MELKVTNKAFAIDISQSKLTAAKGELVVEQEKSAVYVKEVKEFNH
FT                   DNEGIEELIKFLGEYKEGIIEATGIYYFYLHEKLTEKGYKVTVINPLHLTEILGKKTDK
FT                   LDAQRLLVAHMTGVIKGSYIPTGEIMELRELTRYRESLVEKTTQVKNEIRKILEFAGYK
FT                   IQPFDKKGRKLLEKLVKGEGLSKEEKEELKEKLGRNLNDAEKLALKQLVELLKNLEKMI
FT                   KEVEDMIISKIPKPVIELSKIPGIGLISAATIYAEFGDVSRFSSSKAARAYASFAPKTK
FT                   QSGDSESHSGMIRGNKYLRRALYLVAKVARGLEPFKGYYERLIARGKSVTQATCALAGK
FT                   LASICYHVIKDGVYKGVVKKSFRIPRGKEVNVKDFDVGDALDSLSP"
FT   gene            complement(101439..102263)
FT                   /locus_tag="YN1551_0116"
FT   CDS_pept        complement(101439..102263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0116"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47312"
FT                   /db_xref="GOA:C3NJR0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJR0"
FT                   /protein_id="ACP47312.1"
FT                   /translation="MGKSKYKRDWHKYDENVITRYTLMFPFYVFEHWWELLAEENRNAK
FT                   KTYKAPKEFNDFLAFLHLFLPYRAIEGVLRALERLKIIPTSLDYSTIWERVRNMNIKFP
FT                   EANDQLEVIADATGISTNKGGQYIIAKWGKTKDSKFLKIEIVMDKDQFNVINAEVTSNE
FT                   VETAVKTVKDLQDKGKKFYGDKAYDANEVYKTGVEVVAPPRKNASTRRGHPARRKAVRE
FT                   FKRLGYNRWREEKGYGVRWRIESLLSAVKRTFGESVRATRHYMLTPLTNLWG"
FT   gene            complement(102687..102890)
FT                   /locus_tag="YN1551_0117"
FT   CDS_pept        complement(102687..102890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47313"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJR1"
FT                   /protein_id="ACP47313.1"
FT                   /translation="MERKSKFINTKIEVICNKCKMPGRLAIRLRQNIGIECYIYHGKWP
FT                   LVSKHSVSCNDYKDVVDKFIKR"
FT   gene            103353..106268
FT                   /pseudo
FT                   /locus_tag="YN1551_0118"
FT   gene            103362..103904
FT                   /locus_tag="YN1551_3291"
FT   CDS_pept        103362..103904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_3291"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47314"
FT                   /db_xref="GOA:C3NJR2"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJR2"
FT                   /protein_id="ACP47314.1"
FT                   /translation="MKKYDLLIIGCGASGFAAAIKASELTEGKIKIGMVCKGLLGGTCV
FT                   NVGCVPSKYLIEITNKYYLSRKKFIGLELSAKINFTDIMGGLKKVVKELREEKYEKVLN
FT                   YYSNVDLIKGDVTFIEPNKIRVNTEKGEQELSGSKIIIGVGSTCFASNMARRWLEEPKE
FT                   LLDWGQLEGLHHLLPYT"
FT   gene            complement(103822..104973)
FT                   /locus_tag="YN1551_0119"
FT   CDS_pept        complement(103822..104973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0119"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47315"
FT                   /db_xref="GOA:C3NJR3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJR3"
FT                   /protein_id="ACP47315.1"
FT                   /translation="MERKIKPKVFAIDVGESRLVATKMEINNNTVKEADTREFKYNEEG
FT                   LKELIKFLEGYEEGIMEATGVYFYHVYNVLRDKGLKVNVINPVQTVEVLGKKTDKNDSI
FT                   RLAIAYAAGTVKGSYIPTGEMQELREMTRHREGLVERKTQVKNEIRKVLETAGYKLPPF
FT                   EKKTKEIVRKLATDEKLTDEEIKEYSKLLGRKLTRIEAFILKQLLDLLNIIEEQIKEVE
FT                   NEIMKFLPEEAVELTKIPGIGPISAATIYAELGDVSRFESSKQAASYAGVSPRTKQSGK
FT                   TEFHNGLIKGNKHLSRVLFLVARSAKNTVQFNGFYQALLKRTGNSKKATLALANKICRI
FT                   VYHVLKDGEYKGETKKTRYRGGGGEGPQVDPNQVVPSALQAIA"
FT   gene            106274..106411
FT                   /locus_tag="YN1551_0120"
FT   CDS_pept        106274..106411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47316"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJR4"
FT                   /protein_id="ACP47316.1"
FT                   /translation="MTIKRSKYYTIRRTFICNSGYGIFECEDETKCALIACTYTRDETT
FT                   "
FT   gene            106408..106833
FT                   /locus_tag="YN1551_0121"
FT   CDS_pept        106408..106833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47317"
FT                   /db_xref="GOA:C3NJR5"
FT                   /db_xref="InterPro:IPR004927"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJR5"
FT                   /protein_id="ACP47317.1"
FT                   /translation="MSEEILNKITSHRPTNFKIIEQDSKEIYVYCALDVLLYAALTCND
FT                   IIVETTLSGENTRFKLDANSELILSFINPHDAEKLPPSYNTPSTICPYSRFFTNLEEFE
FT                   SWRNTLPEEIRHLVIPISVKEALFIIKRYVISSLDNG"
FT   gene            106838..107008
FT                   /locus_tag="YN1551_0122"
FT   CDS_pept        106838..107008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47318"
FT                   /db_xref="GOA:C3NJR6"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJR6"
FT                   /protein_id="ACP47318.1"
FT                   /translation="MNSSLFISNTIVLIVGLILISLGHSNGLRAVAGALVILIFSIIFS
FT                   KIFKNFSVNFI"
FT   sig_peptide     106838..106930
FT                   /locus_tag="YN1551_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.717 at
FT                   residue 31"
FT   gene            107029..107790
FT                   /locus_tag="YN1551_0123"
FT   CDS_pept        107029..107790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47319"
FT                   /db_xref="GOA:C3NJR7"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJR7"
FT                   /protein_id="ACP47319.1"
FT                   /translation="MNFLLDYWYVFPISALTSLFRNKTRYKYASLLCILLILTVPPLFP
FT                   PSPLGLLAITNVQINDYIALRKFIKQKINRLSSLNFTELVEILLPVSIGSLLLLFYGCK
FT                   EGFVLYSFASTSFTLLYMLRLRIKNLGNTGPKEYNPLGIMIAKYFSLIVLSTSSYGFPY
FT                   CHLERYKLEKLALATLSAALINVIITLIKIGPSFLQINLLILIIGGTMTGNYISNVWGK
FT                   EELQALSTLYHYISLIIGFITIFLEIFLKII"
FT   gene            108573..108821
FT                   /pseudo
FT                   /locus_tag="YN1551_0124"
FT   gene            complement(108807..109256)
FT                   /locus_tag="YN1551_0125"
FT   CDS_pept        complement(108807..109256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0125"
FT                   /product="amino acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47320"
FT                   /db_xref="GOA:C3NJR8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJR8"
FT                   /protein_id="ACP47320.1"
FT                   /translation="MPDKNQSVFIRQSSGLVREVSPWASFFATFGLVTGGIPILIVSWL
FT                   YLAPGANWTVSYLISLLPTLGMAFLFYVASISTPRSGGDYVFQARSSHPLVAFVNYWAL
FT                   WIAFALSLGLYSYLGAQWFAYLFSGLGLFYNDQALINLGSFLPQL"
FT   gene            complement(109400..109519)
FT                   /locus_tag="YN1551_0126"
FT   CDS_pept        complement(109400..109519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47321"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJR9"
FT                   /protein_id="ACP47321.1"
FT                   /translation="MKLTILVKEKKVVIISKIVTAYTSTITYKWQLEILSNRN"
FT   gene            109570..110892
FT                   /locus_tag="YN1551_0127"
FT   CDS_pept        109570..110892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0127"
FT                   /product="aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47322"
FT                   /db_xref="GOA:C3NJS0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJS0"
FT                   /protein_id="ACP47322.1"
FT                   /translation="MEENFDASVLEAPIINVIPPGPKSLKLLKDQEEYETSAVNYPKYF
FT                   KIAIDKAQGSTITDVDGNVYIDLVTGISVVNLGHNNPFIRRRVQEQLEKVWHTLEIPTE
FT                   IRVNFSKKLLSTLGFKAKLLFTTTGADAVEAAVKIARYVTGKKTIIAFEGSYHGITAGT
FT                   LGLTGANRFKEFNPFFDDRVVKFPYPYPYRCPFKDCLNEILRLLDYAMSNPGYLGGDVA
FT                   GILVEPIQGEGGYVVPPKGFLKGLKELAEKYSVPLIVDEVQTGVGRTGKMWAYQWENIE
FT                   PDIVVISKAIGEGIPVSMVGYREEFNKLPTGFHLGTYRGNPLGLAAGLASLEFIEKYNI
FT                   LPRVERLGKKILEELSEVENSHVGDIRGLGFMIGIELVRNGNEPWSEGTKIVIEEALKR
FT                   GLLVYKAGRWDNVIRLMPPLTIPEPLLNKAVEILKRILNSI"
FT   gene            110970..112529
FT                   /locus_tag="YN1551_0128"
FT   CDS_pept        110970..112529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0128"
FT                   /product="amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47323"
FT                   /db_xref="GOA:C3NJS1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJS1"
FT                   /protein_id="ACP47323.1"
FT                   /translation="MEKHKKGVFLRESSGLVREFGILDALWFNIALLGLLFSTYYVAST
FT                   GPLVGGNPLLGLILPILGFFLVGMIFSYVGSKVPRVAADYVYVSRNLHPALGFVGNAGY
FT                   FLATVPLFMGITGITLQTFGLIPLLTILGYYTHNLSLIAIGSQIDSNPYLIMTIGATEI
FT                   VIMSLIPIFGNKVYRVFQWLAIPLALIAAIGMIIVEAVVPHSLAISRLNDFALTYANVT
FT                   NLYANVTSSNVPVPAYYNIYNITSLNPVYVVGFSYIINTVYIAGEVRNPKRSMPISILG
FT                   TLIITGFIFTAALALEYNQFGYDFTTKMMYLSIAQGTLPIPTPYLDLLEGVASGNVVLG
FT                   VLFALASILQLLMYLSAASFVGSRLLFSYAMDRIMPDFVGDVSEKRHVPIKAIILSMIA
FT                   GLIGLTVFTLPVTSAGAFLLSSVAVAILMLFPMTILSIAVLKTEKGENKIRTVAILSII
FT                   YLIYTFYQYLTVPAIGADSVVGYGILTGSIVILFGIFYIAKFVRARQGIDFNLIFKEIP
FT                   PE"
FT   gene            112580..112762
FT                   /pseudo
FT                   /locus_tag="YN1551_0129"
FT   gene            112878..113066
FT                   /locus_tag="YN1551_0130"
FT   CDS_pept        112878..113066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47324"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJS2"
FT                   /protein_id="ACP47324.1"
FT                   /translation="MKVYKFCSYILKCRREPYSELDEQCEGEDGFDEAPHVLEGSGLTT
FT                   APVDGMGSWTGGMRTRG"
FT   gene            complement(113101..113223)
FT                   /pseudo
FT                   /locus_tag="YN1551_0131"
FT   gene            complement(113243..114160)
FT                   /locus_tag="YN1551_0132"
FT   CDS_pept        complement(113243..114160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0132"
FT                   /product="agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47325"
FT                   /db_xref="GOA:C3NJS3"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJS3"
FT                   /protein_id="ACP47325.1"
FT                   /translation="MRQIDALKSPRFTQISTFGRLPICGRDEEIKAAFLGIPFDDAVTY
FT                   RPGARFGPMGIRQGSRLLRPYNQFLDTYPFDKLNACDMGDINIIPGYIEDTMNIIQTNL
FT                   YEIISSKNLVPFITGGDHSITLPVLRALHKKYGKINIIHLDSHYDFWDSYWGKKHTHGT
FT                   WLRRAIEEGLIKEAIQGGIRASTFSKEDLKDKERLGVKSFTIRDLKYNLDSVIREINSL
FT                   SGPTHVSIDIDVVDPAFAPGTGTPEVGGLTSFEIIEIIRKLRFDKLVGFDVVEVAPPYD
FT                   VSEITTMLAANIIYEGMSVLSLNL"
FT   gene            complement(114343..115011)
FT                   /locus_tag="YN1551_0133"
FT   CDS_pept        complement(114343..115011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0133"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47326"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJS4"
FT                   /protein_id="ACP47326.1"
FT                   /translation="MENFISRLISCNKCPRLTQYRNSFPDNYWKKPVPPNGEINAEIVI
FT                   IGLAPAANGGNRTGRMFTGDESSNNLTNALYAVGFANQPFSISKDDGLKLFRVYITSAV
FT                   KCAPPQNKPNKDEIINCSTFLEEEVRMLENAKVYIAFGKVAWDSIIYVFKKIGYSVPNV
FT                   KFYHGALVKVTKPDMSIIWLIGSYHPSPRNMKTGRLTMNMLVEIFSTAKKLVSNKERIT
FT                   "
FT   gene            complement(115049..115312)
FT                   /locus_tag="YN1551_0134"
FT   CDS_pept        complement(115049..115312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47327"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJS5"
FT                   /protein_id="ACP47327.1"
FT                   /translation="MGVSISDIKYLVERPDIFGFKLETIRKDTEFNTLITDVKQNGIKI
FT                   ENYWIKCNKDTGECEVVDDNSNNLVIVNFLKKTIIRYIATKL"
FT   gene            complement(115350..115637)
FT                   /locus_tag="YN1551_0135"
FT   CDS_pept        complement(115350..115637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47328"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJS6"
FT                   /protein_id="ACP47328.1"
FT                   /translation="MDYSAILRTLIKDKRECQSFLSLCKNEKFIFITVCNGERMIYYGE
FT                   VNGNSIRFNEKGNDNVKYEIPISDIDSDIKVFKVSDDIYAYNVDESLFSD"
FT   gene            115794..116426
FT                   /locus_tag="YN1551_0136"
FT   CDS_pept        115794..116426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0136"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47329"
FT                   /db_xref="GOA:C3NJS7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJS7"
FT                   /protein_id="ACP47329.1"
FT                   /translation="MSVYSGMKLVVSCMDRRLNSYLKKKYPDAIVIRNAGANVNSLLIT
FT                   FEKYKDRVDDVILLPHTDCGAMKVVYSSLKEGKKITSLVEEKLVSQFSSKKFSSLSELE
FT                   RLNMEIQKENLKRIFGDKVRTELIDVNKIEIPPSNEPYMAYVSKPSQLAELSSNIYHIS
FT                   AEDKEIWDSLDIAVYAMKINKIITPDEKTVEKIKAAYPSVIVSTTSF"
FT   gene            complement(116413..116964)
FT                   /locus_tag="YN1551_0137"
FT   CDS_pept        complement(116413..116964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0137"
FT                   /product="protein of unknown function DUF433"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47330"
FT                   /db_xref="GOA:C3NJS8"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJS8"
FT                   /protein_id="ACP47330.1"
FT                   /translation="MDLPGYDYIVVYKDIHFGRPHIAGTLIRPESVLYELAKDKTFDEV
FT                   SKAFYNQINLKQIKECIKYAIDVMKILKYYKKVKPKVPRRLKRKLGPTSYAFIDKENEN
FT                   NKYDPTIKNSNVKVVDVLNKLYEGKEISQVTEELSIPKEAVIESILYSASLIDDFHLSL
FT                   SEFKDPASVVIESFNYIRKK"
FT   gene            complement(117003..118316)
FT                   /locus_tag="YN1551_0138"
FT   CDS_pept        complement(117003..118316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0138"
FT                   /product="peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47331"
FT                   /db_xref="GOA:C3NJS9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJS9"
FT                   /protein_id="ACP47331.1"
FT                   /translation="MDEELYTLIEFLKKPSISATGEGIEETANYLKETIEKLLGVKSNI
FT                   EKTKGHPVVYAEINVNAKKTLLVYNHYDVQPVDPISEWKRAPFSATIENDRIYARGASD
FT                   NKGTLMARLFAIKHLIDKHELNVNVKLLYEGEEEIGSVNLEDYIEKNDNKLKADSVIME
FT                   GAGLDPKGRPQIVLGVKGLLYVELVLDYGTKDLHSSNAPLVRNPCIDLSKVISTLVDME
FT                   GRVLIEGFYNDVRELTEEERELIKKYDIDVEELRKALGFKELRYSDREKIAEALLTYPT
FT                   CNIDGFECGYTGKGSKTIVPHRAFAKLDFRLVPNQDPYKIFELLKKHLQKVGFNGEIIT
FT                   HGFEYPVRTSVNSPVVKAMIESARRVYGTEPQVIPNSAGTQPMGLFVYKLGIRDAVSAI
FT                   GAGGYYSNAHAPNENIRIDDYYKAIKHTEEFLKLYSTL"
FT   gene            118446..119963
FT                   /locus_tag="YN1551_0139"
FT   CDS_pept        118446..119963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0139"
FT                   /product="Vinylacetyl-CoA Delta-isomerase"
FT                   /EC_number="5.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47332"
FT                   /db_xref="GOA:C3NJT0"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJT0"
FT                   /protein_id="ACP47332.1"
FT                   /translation="MVLRTGEEYVNAIRHRNKVEIYVMGKEVKDVTEHPFLKPSVLAFK
FT                   ATYDAAHEEDSKSLGRAWSSFINEEVNRFTHIHRSPEDLAVKVKLLRKISHKTGACFQR
FT                   CVGWDALNTIYVTSRLMAEKGKKEYYERFVEYLKYVQKNDIALAGAMTDVKGVRTLRPN
FT                   EQPHAYLRVTQVTKDGIYVSGAKANITGIAASEEIIVMPTRAMGEKDKDFAVAFSIPLD
FT                   TESIKVIIGRQVNDGRRLEEGEIDGLPYRTNHEGLVIFDNVFVPMERVFMLGDWQMSGI
FT                   LVEIFSSYHRQGYGGCKSGLGDVIIGAAYNLAKQIGVEKAPHIQNKLNEMVLLNENMYG
FT                   SGIAASLDAVKLCEDGCWWVNPMFANVTKQLVTRFPYEITKFSTDIAGGIIGTAPSEWD
FT                   LKNPKLKPYIEKYLQGMMDYSTEDRLRMVRLLENIGFSVAFLIESVHGAGSPEAQRIAI
FT                   NRVYDYEYAEKIAKYLSQTEKRIEFKENAEPWRSTDTEKLANNGGQK"
FT   gene            complement(119979..120731)
FT                   /locus_tag="YN1551_0140"
FT   CDS_pept        complement(119979..120731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0140"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47333"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJT1"
FT                   /protein_id="ACP47333.1"
FT                   /translation="MKVLDVANPIVITVFPESSLKEAIDILSNNPTGRIVVLKEEKPIG
FT                   MVSTRDVVASFSEYGTNIYDLKVKDLMSKDLITVWPNDDVNHVVRIMLMNNIGGIPVVD
FT                   NNAIVGIFTEREVLKLIASSMFSGLVDSVMSSNVVSIGEESTILEAAKLMAMNNVRRLP
FT                   VFSKNNKLIGIITAADIVKYLAKNKNIGKVLDAGTKNPITISRYYSILNAAKLMIEKRI
FT                   GTLPVMENQKLVGIVTERDLMYAYINIV"
FT   gene            complement(120765..121298)
FT                   /locus_tag="YN1551_0141"
FT   CDS_pept        complement(120765..121298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47334"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJT2"
FT                   /protein_id="ACP47334.1"
FT                   /translation="MYCLDDRKRIPANVVCSSYNFKIRAIVNGKPYMASYEELWNFPLD
FT                   GLNSIHLFENLDYALRNDPFLSATSSIAIFVSEKEDIEGFVELILSKTFFEIRSIILAE
FT                   NPISKYGDNETTLSSSSYYYSVSYRNDRLMIKAKDREGYYEINMKLHNFTFVSDYRELL
FT                   RNVEKVGKNTRVVI"
FT   gene            121406..123142
FT                   /locus_tag="YN1551_0142"
FT   CDS_pept        121406..123142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0142"
FT                   /product="glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47335"
FT                   /db_xref="GOA:C3NJT3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJT3"
FT                   /protein_id="ACP47335.1"
FT                   /translation="MKTLGFISNQITSALIDLSSIVWFPVPKFDSPSVFTRLLDEDGGE
FT                   FSILPEGQEIIAVKQEYVYPLVIMTVIRTKQGEINITDLIPLGETVIIRKVESEIPFKV
FT                   VFRPRFYYSLYKPIIGGSKFVNPRGRDCIAFLYDFSGKVKRSGNYVWNFSNGKGYLIAN
FT                   YASDVKHGVFSERGSTLNAMYERSFENTINYWKSTDVKDVKSFNDLYKASIYTMLGSIY
FT                   APSGGVVAAPTTSLPEVEGGKRNWDYRFAWIRDSSIIAEALLEAGFIVEARRIINFLLS
FT                   LINFSSKPFYYPLYTIEGTIPPPERKLRWLSGYKNSKPVRIGNGASSQIQLDIEGFFIS
FT                   ALYKYVKLTNDQVFLKDVFSKVKYIGDWIAENWSLKDSGIWEDRGSPQHYTHSKIMMWI
FT                   ALDKIGKLANLIGYADIWAKERDKLRNWIFTNCVKNNYFIRYCGNTDDVDSSLLSASLY
FT                   GFIEVNDNIFINTLTKIENDLKTDVFVKRYKTDFMGEAKHPFLLTTVWLARVYMRLEKI
FT                   DGAIEILDKINKISRELHLVGEHIDVEKGEFTGNFPQIFVHGQLVIAIKELNEMLTDKN
FT                   II"
FT   gene            123165..124358
FT                   /locus_tag="YN1551_0143"
FT   CDS_pept        123165..124358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0143"
FT                   /product="Protein of unknown function DUF650"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47336"
FT                   /db_xref="GOA:C3NJT4"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJT4"
FT                   /protein_id="ACP47336.1"
FT                   /translation="MIRPELCIRCRGAKYLCGLSYCPIIVNTKTVRIDFKEVYGSSPPT
FT                   VFVGRFSYPKITIYPSTPPILGDTTKFEDSKYWLNTDLSEFLSMRLSLVRGGVKYHRDD
FT                   ARLPDRFLLDIQSITISSRPVELDLRLKRIPSGGILDESLPPLGPSAPLEKLEIATLPP
FT                   PLAVVEKVYDDNDMRAKDGIMKLYNAGIDVEKISRILSIGGIGKERKLVPTRWSITAVD
FT                   KAISDTLIENIKSYDTIDKVEVYFRKHNKNIFIAILLPRDWSFEWGEAWYPGSTWNKFG
FT                   NYVDIEVDNERYHGRSDYPEIGGCYYASRLGVTEFLASRKRQATAILWREIYGGFNLPL
FT                   GVWFVRENVREMFKGKPVVFDDITTALNFVKRLLRSDLKQWLSKSVLSFNTIDKWLK"
FT   gene            124355..125131
FT                   /locus_tag="YN1551_0144"
FT   CDS_pept        124355..125131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0144"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47337"
FT                   /db_xref="GOA:C3NJT5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJT5"
FT                   /protein_id="ACP47337.1"
FT                   /translation="MIVKSIRVKSALSKSGLKELNYSLNPYLGCVFSCPYCYAPNFTPD
FT                   REASENWGKVVAVKENLLEVLEREVKIYKRGVVGISTITDAYQPIEALRKLTRESLKIL
FT                   LKNGFRVSIQTKSPLILRDIDLLLEYKDRVDVGFTVTSLNNKLELNAPPAKGRLRALEK
FT                   LSNEGLETWIFLGPIIQGVNDAEIENIIREISNIKVRVIFDSFHYYRGLKFKEGSTQWW
FT                   VNLRNRILENCKRYGMECHEESEDWIYEKRRYYKTF"
FT   gene            complement(125134..125472)
FT                   /locus_tag="YN1551_0145"
FT   CDS_pept        complement(125134..125472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47338"
FT                   /db_xref="InterPro:IPR018685"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJT6"
FT                   /protein_id="ACP47338.1"
FT                   /translation="MSEKLDKLMQLKGAIAAGEYTPDGKLVEYKGPMPKEMAEMIAKMV
FT                   AANTLMGTVEAESFTKISGMRWTPFLGWAVAAGEYVVCVMGNYGVFVRLTEADFNQIFK
FT                   TLREVAGI"
FT   gene            complement(125679..126932)
FT                   /locus_tag="YN1551_0146"
FT   CDS_pept        complement(125679..126932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0146"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47339"
FT                   /db_xref="GOA:C3NJT7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJT7"
FT                   /protein_id="ACP47339.1"
FT                   /translation="MIKYKDTRWMYLVIPYNASIGPLSTLVTLQILSLGGNAIDVAYAI
FT                   SLSNAVLIPASIIWGFLADKMDRKKQILLSLAGVSIPLIVMPFMKSISLITLNYALITF
FT                   MSTASTTPFNLLIMESAEKKHWGSLFSRFSLLSSIGVLLGLVVSTFLVILLRIDQIEEI
FT                   LGFSVLATLIASVKILPKPIITFERAAIIHNKESFLTRMRHLPMMFLHLPNIHHFKMFS
FT                   VSRLFRKPLNYIPLLYLGIVLFYISSGIFNTVYPAGLYVKGLNKSEVLAVISVGMIFQI
FT                   LGFRISSTLLENKDEKGLAYISLILRGVLYVLLGIFAQLFLGIPILISGLIFYPLAAGI
FT                   AYAVFYSSSTTLIFKIVGERRQGTGLGVYSTVVGISLFVGSLLSGYITHYISYGIDFIV
FT                   AGIILLIASWIFRYLEEG"
FT   gene            127086..127874
FT                   /locus_tag="YN1551_0147"
FT   CDS_pept        127086..127874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0147"
FT                   /product="Aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47340"
FT                   /db_xref="GOA:C3NJT8"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJT8"
FT                   /protein_id="ACP47340.1"
FT                   /translation="MKIKKGDTEAEILTKGAYLNAFRIGSKDMILKGDLERPTRGGMAI
FT                   LIPYSNRVKNAEYIFEGVKYTLPQNREGNAIHGLVMDKEFSVVTKSDDSVSLEHVLEHE
FT                   GYPSRLDCLITYKVFKYGLRTKIVVRNVGNKRAPLTVGAHPYFITADDWRIIVEKEESV
FT                   KKCVSFNKIPTGELIKTKLEHTDYDDCFLISGSIQLHSSYSKVRITRRNMPFVQIYTGI
FT                   RGTVAIEPMSGAPDAYHNGLGLKILEPNESSYFAFAFRFH"
FT   gene            127946..128755
FT                   /locus_tag="YN1551_0148"
FT   CDS_pept        127946..128755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47341"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJT9"
FT                   /protein_id="ACP47341.1"
FT                   /translation="MPYAEEMEVKANRSQLLSFFIDPVRFTGILGHLMIVNIFDKSENK
FT                   FVTMGSLKNPENRFKVLYVIGDPESRVTMFSGTMEGPMLTFNTITYKGEGDNGKLTWKT
FT                   DLILTELGRLTRIKVVVDAKQSFGFLDKVRMGDFDFATHLVKEHIAPFLRFYFKPSINE
FT                   ETPTLNEVFRFRGSVEEVILKLREVIINIKQGGIIILGEDYNIMTSIVNGEVSHAQINN
FT                   MDVNGNEVFAYLLKASGNVELIAYEISLDDLIFKNLKKRLEEVKARS"
FT   gene            complement(128750..129790)
FT                   /locus_tag="YN1551_0149"
FT   CDS_pept        complement(128750..129790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0149"
FT                   /product="Linocin_M18 bacteriocin protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47342"
FT                   /db_xref="GOA:C3NJU0"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJU0"
FT                   /protein_id="ACP47342.1"
FT                   /translation="MFSNDPSTLTRKEKFDKEEAVRAIRNAIAAEIDAINFYLQQNKYI
FT                   DDEKLRKVHEDITREEMTHFGEFLRLLYQLSPEDFSYFKKGWEEASKLIGESKDFPLIQ
FT                   PTPSESRKDPIVSWIIEGIMSNRVVRNIGNMIKYESTTVPFSEVKEDSGDTVQSKSVTL
FT                   YEVPLISSQVKFYSGQKNDSRRTAIVAGKSFAKTENQLLLKNHLLSPLKMGSQITASDW
FT                   NISGNILLDVLKAYENLAKEGFGKDIYVLISSSNYSKTFRVVDRTGTYEIEMIKEIGNV
FT                   IPTDIVNNDEIYIISKQGFDILVFSEANVEYLSKERDYEVYLITEQIAPRLISSSASCR
FT                   ITQKTS"
FT   gene            complement(129960..130175)
FT                   /locus_tag="YN1551_3245"
FT   CDS_pept        complement(129960..130175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_3245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_3245"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47343"
FT                   /db_xref="GOA:C3NJU1"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJU1"
FT                   /protein_id="ACP47343.1"
FT                   /translation="MFSMSLCCFSPYLFISFSLVILGFIRSLVLRGLPRRSFLGQVVEA
FT                   KLKFWAYAWMVHLANSLVGRAPGIRV"
FT   gene            130362..131522
FT                   /locus_tag="YN1551_0150"
FT   CDS_pept        130362..131522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0150"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47344"
FT                   /db_xref="GOA:C3NFN0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3NFN0"
FT                   /protein_id="ACP47344.1"
FT                   /translation="MELKVTNKAFAIDISQSKLTAAKGELVVEQEKSAVYVKEVKEFNH
FT                   DNEGIEELIKFLGEYKEGIIEATGIYYFYLHEKLTEKGYKVTVINPLHLTEILGKKTDK
FT                   LDAQRLLVAHMTGVIKGSYIPTGEIMELRELTRYRESLVEKTTQVKNEIRKILEFAGYK
FT                   IQPFDKKGRKLLEKLVKGEGLSKEEKEELKEKLGRNLNDAEKLALKQLVELLKNLEKMI
FT                   KEVEDMIISKIPKPVIELSKIPGIGLISAATIYAEFGDVSRFSSSKAARAYASFAPKTK
FT                   QSGDSESHSGMIRGNKYLRRALYLVAKVARGLEPFKGYYERLIARGKSVTQATCALAGK
FT                   LASICYHVIKDGVYKGVVKKSFRIPRGKEVNVKDFDVGDALDSLSP"
FT   gene            complement(131511..132344)
FT                   /locus_tag="YN1551_0151"
FT   CDS_pept        complement(131511..132344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0151"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47345"
FT                   /db_xref="GOA:C3NJU3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJU3"
FT                   /protein_id="ACP47345.1"
FT                   /translation="MGKSKYKRDWSKYDENVITRYELMFPFYVFQHWWELLAEENRNAK
FT                   KTYKAPKEFNDFLAFLHLFLPYRAIEGVLRALERLKIIPTSLDYSTIWERVRNMNIKFP
FT                   EANDQLEVIADATGISTNKGGQYIIAKWGKTKDSKFLKIEIVMDKDQFNVINAEVTSNE
FT                   VQTAVKTVKDLQDKGKKVKKFYGDKAYDANEVYKTGVEVVAPPRENASTRRGHPARRKA
FT                   VREFKRLGYNRWREEKGYGVRWRIESLLSAVKRTFGESVRATRHYMLTPLTNLWG"
FT   gene            complement(132432..133781)
FT                   /locus_tag="YN1551_0152"
FT   CDS_pept        complement(132432..133781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0152"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47346"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJU4"
FT                   /protein_id="ACP47346.1"
FT                   /translation="MVCEIPRVTVTTWSSKSVILVGPTYRKYLEKALDVVRNNEVASVV
FT                   GQPGMGKTTLLKKIEEITKSNNLTIYLDLANKQSIDEEFWTKINQFELREKVLPELQKV
FT                   KGKLGYSFWKKITGVKFEDWLLKICNKYNNLFLRVYCFNYERNFDGMINALRDMKNLGK
FT                   PVLLVDEIRDYHLSLIHRLINAGLEIPIVMAMPTEAYSKISDLAIRRRIEESRIHLDDA
FT                   LTTEDIKEIVEAYCKDLGENILPIIITLWSSKEITNVSSILQFIRNEMDKVEKVCEKND
FT                   VECIRNELRKYTSLRNPEDDAKEFEKKVRDLLSNISKEFGISYVHPRGKRIEIDGKSLV
FT                   VGLFFIADNQVFLGDVVFSNDGRLHNEEELKLLSKVEEVEHEKKIYKVRGRFIITNINI
FT                   NINDIYALNIPTLEVVKILNGDIFLLEERIKILFDQYQTFTRNETESLAL"
FT   gene            complement(133784..134284)
FT                   /locus_tag="YN1551_0153"
FT   CDS_pept        complement(133784..134284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47347"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJU5"
FT                   /protein_id="ACP47347.1"
FT                   /translation="MISKDDVFTLILNEYKNSQKPVSISKIKRKFKDESIAKVLEELEK
FT                   EKKIRRVENKGKVSFEPIDSLNIAEELKILRDEIHRVLDLLQKLIESKSFSYKDFDEAY
FT                   DRIKDSLGYAPLERIRIELGLSKEEFYSKFRKYIEENYDLIAGGDEGFTRKGVTYGIIK
FT                   RRR"
FT   gene            complement(134284..134409)
FT                   /pseudo
FT                   /locus_tag="YN1551_3246"
FT   gene            complement(134603..135136)
FT                   /locus_tag="YN1551_0154"
FT   CDS_pept        complement(134603..135136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47348"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJU6"
FT                   /protein_id="ACP47348.1"
FT                   /translation="MNRLQQLLKEALDEIEIYGSWTSLYYILKSVAESNVEKLCREQEV
FT                   IYHMTVDSLTLFTIYKYGEGVDKTRLFVLSFLLYDYLSRHYNVQNPIFSIKWNKRHFIY
FT                   SPRIDSRLHSLSKRGLILKKDRLYYLSQLGISEAESINIGKKDSTKVDSIVANLKSLRK
FT                   VKDIKIFVRKYLLG"
FT   gene            complement(135136..136890)
FT                   /locus_tag="YN1551_0155"
FT   CDS_pept        complement(135136..136890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0155"
FT                   /product="glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47349"
FT                   /db_xref="GOA:C3NJU7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJU7"
FT                   /protein_id="ACP47349.1"
FT                   /translation="MIRYYEFLSNGITSALIKNGSVEWLPLPKFDSSSIFTRILDEERG
FT                   GYFSIRPADEKYDIIHEDYVENTLILRTAFKSEKGKAEILDFLPLSLSGIIRIYESEID
FT                   LKVDIKPFFEYGLVTPAIIKARRGLIFRNPKSKEGIEILIGGEYIPLDNTEFTLKKGKG
FT                   YIYLLYSKDLRYGLFSNKGFVYSEPYEALNKAIKYWKGRLENAKKVNIYRDAYYRSLLV
FT                   LLGLIYEPSGGIIAAPTTSLPEIIGGSRNWDYRYVWIRDASYSAEALIKAGLLVKARDI
FT                   ISFLTAMVDPSSKSFDHPLYTIDGTAPPAEEILDWLEGHKKSFPVRVGNAAYMQIQMDV
FT                   EGAYMNALYEYYNTSKDSKYVNEIWWAIEAIAEWTKKSWKWKSTDLWEQRGVEEHFTHT
FT                   KVMNWVALDRASKLAKELGYKNEAEEWISIAEEIRKDVLDNGYSEKLGYFTRYYGSDSV
FT                   DSALLTLPLYDFIDAKDPRFLKTHEKIEKDLMISDGFLLRYKDDFMGSAKHPFTLVSTW
FT                   LTRVYIRLGEIGKAKKVIEKLISCSTSSLLLAEHLDQNTCEPRGNFPQAFPHAGLVMAI
FT                   VELEERLV"
FT   gene            137213..138610
FT                   /locus_tag="YN1551_0156"
FT   CDS_pept        137213..138610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0156"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47350"
FT                   /db_xref="GOA:C3NJU8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJU8"
FT                   /protein_id="ACP47350.1"
FT                   /translation="MNTIDINLYIDLPLFQDKHKWINMERNSMFSVAINTQTPPIRFTL
FT                   TYRDLLEKYGYLEPPIDLGLLSNEDYHTSVGGVAKMMLSLINANAFSKSRWVSLGPGYP
FT                   PSVKMTSTEVHFVDLEAKSLANYTRFKEGLYNEAHGLGKYELVGEEYIAYANYNWLSAQ
FT                   KLLEFYKDTDIYFINDFQQLLVGGIIGPSAPAVLWYHIPFVPENLSKKLREFLIKAFES
FT                   FDLVILSTKRDLEGLIRTGAKVKVKQIYPFIDPSDYKTVGKKEIQYVEDKYGFKGDDKV
FT                   VLVVARMDPMKSQDLAISAIKNVDAKLVLAGDGSFTSRTLGHDKGSMWVSRLKELARSL
FT                   GVQNKVVFTGYVPDDELFALYQRANVVLLPSRIEGFGLAVCEGWVYGKPAVVSSGTGVS
FT                   ELIIEGGNGFVFKSGNVEELAEKLKLALKDEKVGSLGRETVKRCSVNNAVNELREAFDL
FT                   ASEEYKK"
FT   gene            complement(138613..139512)
FT                   /locus_tag="YN1551_0157"
FT   CDS_pept        complement(138613..139512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0157"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47351"
FT                   /db_xref="GOA:C3NJU9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJU9"
FT                   /protein_id="ACP47351.1"
FT                   /translation="MSLGLREILNKHNGILSGTSACPGCPENMAMRMLGMGLGKDMVLV
FT                   VVAGCSSVIQGNAPYNAYNFPTVNVAFAAGPATAAGLARAYKQRGKNVTVVVWAGDGGS
FT                   ADIGFASLSGAAERNDNILYLTVDNEAYMNSGGQRSGSTPFGAITTTTPEGKKENKKNL
FT                   PLLMIAHNVPYVATASVGYPHDYIEKLNKAKQVEGFKYIHVLTPDPYGWLFDPSKTAEV
FT                   AKLAVQTCYWPLFEYYNGKLSISSESLHCLDRRTRRPIRDFLSVQGRFKRLTEDQIKIL
FT                   EQYIDNVWEKLKSMLDNQ"
FT   gene            complement(139481..140683)
FT                   /locus_tag="YN1551_0158"
FT   CDS_pept        complement(139481..140683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0158"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47352"
FT                   /db_xref="GOA:C3NJV0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJV0"
FT                   /protein_id="ACP47352.1"
FT                   /translation="MIRKIISGNEAVALGVKLARVGVTGIYPITPQTTIIEKLAEMRAK
FT                   GEIETEIVRVESEHSAMAATFGAALGGVRAFTATASQGLLYMHEMIWWVAGSRVPVVMV
FT                   VGTRAVGAPWNIWNEHTDFTSERDSGWIMAFASNPQEALDLTLQAFRISEDERVFLPMM
FT                   VGMDGFILSHTKTNVLIPDQDQVDEFLPPRRQPYVIDTEDPIGMGNIFPPEGYMRLRES
FT                   IDLALRNSENIIKEIGREYNKKINPLGDYSTLNVSYKLEDADYAIVLMGAWAGDAMEAV
FT                   DTLREKGIKIGMLRIRYLRPWSEKEIRNALKDKRAVLVLDRSTSFGRGGGPLYVEVKST
FT                   ISDIVPQVKGVVSGLGGVTVNKSELLYIFNKFVEGLKDDVIWYYPKEVGKIEFRTPRDI
FT                   E"
FT   gene            complement(140680..140943)
FT                   /locus_tag="YN1551_0159"
FT   CDS_pept        complement(140680..140943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0159"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47353"
FT                   /db_xref="GOA:C3NJV1"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJV1"
FT                   /protein_id="ACP47353.1"
FT                   /translation="MSLLEYQYFPVTRPNKGAGGRTGAWRIVKPVVDYNKCIGCKVCFM
FT                   FCPESTIVPSNGKVRVDYEYCKGCGVCANVCPVKAISMVNEQ"
FT   gene            complement(140930..141484)
FT                   /locus_tag="YN1551_0160"
FT   CDS_pept        complement(140930..141484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0160"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47354"
FT                   /db_xref="GOA:C3NJV2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJV2"
FT                   /protein_id="ACP47354.1"
FT                   /translation="MLEIRFHGRGGQGVVTASQLLAEAAGYENLYTSSFPIYGAERRGA
FT                   EIEAYCRISENPIRVTSPVEEPDYLVVIDNSLLQISRNLFRGLKDTSTIILNSPSKPDL
FT                   NWRTFHVNATKIATDLGLVKSGWPMVNVIILGALIRVMGIPKLSSLEQAIEEEFGGKIA
FT                   ELNIKGTRLAYEQVGVEYVTA"
FT   gene            complement(141548..142744)
FT                   /locus_tag="YN1551_0161"
FT   CDS_pept        complement(141548..142744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0161"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47355"
FT                   /db_xref="GOA:C3NJV3"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJV3"
FT                   /protein_id="ACP47355.1"
FT                   /translation="MERKLGFIFDHNKCIICNACVDACNKAYGNLNWRSLIVMPYGESK
FT                   TALSIACNHCDNPTCMQVCPANAIEKNEMGIVRIRDDKCIGCGFCTWACPYEALKFNNE
FT                   GIMTKCNFCYARLAEGKGIPYCVEACPTGALAFGWIEKGEAEVDYLPPSEITKPRIVIK
FT                   QPEIKESLKANVLHTKKEENYLGLLAFTIGSEFALGYSLFKLPFWSIVSVILLVASLLL
FT                   SVNHARRTDRFYRVIYNLKTSWLSREVLFSSLSILFYILSIVKPVFYYPALVFLTAGVI
FT                   SSIIIYMLKSRPSWYKADTPVSFVGSIFTMSLPIAYFLTHDPITIIPLVIILAIEIISN
FT                   HMRSKVRTSLNIVSILISLISIIIPEIIIIVEIMNIVSETEHRKEFYEKVIYYGLPKV"
FT   gene            142811..143059
FT                   /locus_tag="YN1551_0162"
FT   CDS_pept        142811..143059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47356"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJV4"
FT                   /protein_id="ACP47356.1"
FT                   /translation="METPFYKYALMRNFIREMIEHDSISDFVKEKLTSDLEMKNRFCNE
FT                   DEDTLKQLISEVIEYVTLGKGKGKEEEILNAITSSCR"
FT   gene            complement(143043..145331)
FT                   /locus_tag="YN1551_0163"
FT   CDS_pept        complement(143043..145331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0163"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47357"
FT                   /db_xref="GOA:C3NJV5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJV5"
FT                   /protein_id="ACP47357.1"
FT                   /translation="MTLYIGSPVKRVEDLRFLTGKGRYIDDIYFPNMLYMAVLRSNYAW
FT                   TKFKIDPKRVEERGFSVITFEDTKEFSPLPNFFVPDPKRVPKEYILAKDEAKYFGEPIG
FT                   LVLGRDRYEAYDALELIDVDYEPREPITDPFKAIGPNSPTLHKELGSNIVYSDIFEYGE
FT                   EPKDYNYIEKKFRYNRILPAPLETNGVIAEFDKISGNLTIYANTQVPQVFKTALSIIFN
FT                   IPRSKVRIIVPDSGGGFGGKIFLKPIAMTALASIITGRPVKYIETRYEHIISAIHGPDR
FT                   HYTAKILYKGDELLGAIIDLVEDFGAYLHTYQPLPILRQIYQLVGPYKMKYLKFRVSGV
FT                   VTNKPPTGAYRGLGIPPAVLVLENLVKSVSKVSKIDEMELRMKNFIDKLPYEHITGAVY
FT                   DSGNYREALKKLVSQLEVKDKDKYTGIGIALALEPGSSLAFQTLVVNKPRTPYYEGVYM
FT                   RIDSGGDVTVFLSTNTMGTGHETSISQVVADVLGIPIDDVKVVLGDTAGPPGTGFYGSR
FT                   FSVVGISAVYTAALKLKEKMRQYLAKMFNVEKDEVKIDNGIVKISNKSFSIKEAVNIIY
FT                   NRSYLIGDEIGLDVSVTINSYNVNVADDKRRVNFSTTYGVNAHGVVIKVDKDTGFIKIL
FT                   KYVVLSDCGTMINPMIVDGQLMGGTTMGIGASLLEKVEYDENGIPRQTSFADYWIPSAE
FT                   EVPKFEIQHMISPSPFTPLGTKGVAEGGATVPPAAIINALEDILKKPINRIEIPITPEY
FT                   VLQLINDMS"
FT   gene            complement(145328..146524)
FT                   /locus_tag="YN1551_0164"
FT   CDS_pept        complement(145328..146524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0164"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47358"
FT                   /db_xref="GOA:C3NJV6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJV6"
FT                   /protein_id="ACP47358.1"
FT                   /translation="MVFPFKSLEDFKVEITQDHELLRSAVRDFAENILAKYVEIGEKEL
FT                   DIPLEVKQKAKEIGLYGLFARQDLGGQGADYLSLLTATEEMARIWPSFSTFLLINWMFI
FT                   YALSRFGNEELRKKYVTPVANGDKVAAFAVTEPVAGSDVAGIKTTAKKLDSEYVINGRK
FT                   IFITNGDIADYYLIAARTSPPDPKARWKGISMLVVEKDAVKPVSRIETTGLKSSHTAEI
FT                   LLEDVKTPAENLLGEEGNGFKYAVSSFDFARTIVASQALGIGQAALEKMINYSLQRTAF
FT                   EKKLAEFQLVQTKVSESLADLEVARLITYWAGTLFKNGKENEYTVAASLAKFISTESAE
FT                   RIILRAMSVYGGYGVTTSTGLERMLRDLQIMKTYEGTNDIQRISAARFLYNKFIGYKV"
FT   gene            complement(146549..147412)
FT                   /locus_tag="YN1551_0165"
FT   CDS_pept        complement(146549..147412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0165"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47359"
FT                   /db_xref="GOA:C3NJV7"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJV7"
FT                   /protein_id="ACP47359.1"
FT                   /translation="MKAVVFSESPVFLKMAAAVAQSFGGEVIGISDNENVKFVNKLYII
FT                   DKMDEDGIVDLISSLSPDVILTGNVRRDRAIAGRVAGRLKLPIVTDVVSLKVEDKKITL
FT                   NRVAYSGMGLVTLESELPIVITIANTQLQPKELQPSVEKVQLKEGRVKIAGKKSTSSGV
FT                   NLATADIVVGVGRGIGSKENVKYAEELAKALGGAVGGSRPVAAELNWVSEDRQIGLSGL
FT                   RIRPKLYIALGISGQPQHIAGIRDSKIIVAVNTDKNAPILENADYFVVGNAIDFCKVML
FT                   SKLGKK"
FT   gene            complement(147414..148142)
FT                   /locus_tag="YN1551_0166"
FT   CDS_pept        complement(147414..148142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0166"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47360"
FT                   /db_xref="GOA:C3NJV8"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJV8"
FT                   /protein_id="ACP47360.1"
FT                   /translation="MNIIVGFKIVPDDQMVKVVGDKLNTDAPLKVSSYDKNAIEEAIRL
FT                   KEKFGGKVTGITVGSNDRKSIREALAMGVDEVIAILVKDPDVYVTAMAIAENVKTLNPD
FT                   IILFSEMTTDSGTSALPAYVSELLGLPYISNVKSLKIEGNKVTADRGMVSYIETVESSL
FT                   PLVVSVGGEINTPRIPSVKQIMESSKKPVKEVKFDAQSKVRIREIKPMIVNRKRIVIEE
FT                   SDINKAVDKLIEYLKSDGVI"
FT   gene            148239..150122
FT                   /locus_tag="YN1551_0167"
FT   CDS_pept        148239..150122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0167"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47361"
FT                   /db_xref="GOA:C3NJV9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJV9"
FT                   /protein_id="ACP47361.1"
FT                   /translation="MILLPIIITVTMLLAMFYVIYEVERWRSTRRVLLALYVEGMMLTM
FT                   NIGGYLYLISNNPFYFLIANSAYMIFGLYPLLNVKEVKMRQFVYSLFALLMVISEIAMG
FT                   ALIYTLETSIPANIDTSIGNIYFVSVMMVEMAFTLILSFKNIDKTLRNYLIGLLLLMPW
FT                   FPQVFPLISLPIWLSAIIMIGNTILIYDSLYKQRLRASQETFTTIELTSIFTLMMIGEF
FT                   LFFLYDTLIVFDISMIIGMAWFVYRALAGPNPRKGNYTRNPLLAFTIIFLTFIMEFFMG
FT                   GVLDFVEGIFSPRISGFINSLTLPWQPLTNPINVLWDFIDLVGSVLGSMWFLIMMGIEM
FT                   GFLAFKKMLEMRVKEVRVRMSLMILAYALYTIYIPMFSPLSDRLPYIPYMWSMGIGTLG
FT                   GFSNSVLLGLIGTYVVYAILSFLFGSRNLCSVSCTAPLMYQGTFYDSLKVYNRTSKVGR
FT                   KLMTSRSPNWVKGITLGVSILVLIAAVISYLNSLGIISFTLFGTDITFLMYFMWFDIIW
FT                   YLLFISIPFLGTFACVTTGYCYWGVFNQAISSIGLFRLKVKDPMLCVNCKTVDCAFACP
FT                   VGITDMRGWFIKKGEFKSFKCVGIGECVNACPYDNIYFYDVRQWIKERFKH"
FT   gene            150206..151183
FT                   /locus_tag="YN1551_0168"
FT   CDS_pept        150206..151183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0168"
FT                   /product="FAD-dependent pyridine nucleotide-disulphideoxido
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47362"
FT                   /db_xref="GOA:C3NJW0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJW0"
FT                   /protein_id="ACP47362.1"
FT                   /translation="MPLKTFDTIIVGAGIAGLSAALYSSRQKLSTLVLSKDLGGQLTLT
FT                   DLIENYPGIESTGGLSLAQKIEKQAKKFGAEFIYGEEVKEIAQESDVFIIKGIKGEYAG
FT                   RAIILAFGKTPREINVPGEQEFKGKGVSYCAICDAAFFKGKPAAVVGEGEPGIEAIELL
FT                   SNYANPAYYITSSSYLAGEEEIVKNVLNKPNVKIFTSSKVLEIRGNSKVEEIMIKKGDE
FT                   IISLRVDGVIIEMGYVLKTEFLKGFVELNEKGEIVVDELGRTSREGVFAAGDVTQTPYK
FT                   QAVVAAAEGVKAALSAYNYIRSKKGLPPVNVDWKAEKKKVSFRL"
FT   gene            151214..152569
FT                   /locus_tag="YN1551_0169"
FT   CDS_pept        151214..152569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47363"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJW1"
FT                   /protein_id="ACP47363.1"
FT                   /translation="MQTYFVPLAVDQNYNEINFHKQIAISLLNLDLERKEKIVRASIIG
FT                   WPLLIKKTDQGFLVLDQTLKTSSRILKYLYPPFNDMASQFSSINDYTTFVSNLKKINLE
FT                   RVSSSEITLVGLLNFEIDRLLRVAKNTSNVNHQLFLLDSKISDHDVKVINDTLINLKAE
FT                   ALSTITSLENLLKEVDDARLRIKKDYVSKLDEINKKYNELIENKKKEINNEIQKVYSEI
FT                   YNETNNEINSRVSRLADTTTRHVITSLKYEGGIVGKDEFENSKNEFESLLNELRQVRDS
FT                   IAGKYLEEVKNLRKELDSLYSNKNSEIENINKSIRDLDSLTNDFKNKANKIKEDIENFI
FT                   KYIESFYNTKLDLTEDTTLIVPFLIAKTNTGNTLVVEPQLYKGKAKGILGKVFKKSDLS
FT                   ETLLNLQIFTEYLKTIDIIDNVKMHSIQVNSAFKEIKDEGWKSIDSLEELYD"
FT   gene            complement(152599..153195)
FT                   /locus_tag="YN1551_0170"
FT   CDS_pept        complement(152599..153195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47364"
FT                   /db_xref="GOA:C3NJW2"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJW2"
FT                   /protein_id="ACP47364.1"
FT                   /translation="MIFRYSNGTISSEDLTLCTVKVEGNQIRVEGSYNLLLKRKGFNTY
FT                   DIYQYNSKIGEIKNFNLQYSMFNFIVSRPQLVAFMRGYENSVKIFTTSNTEVGEIRRIQ
FT                   DGLEAYLNDTYDPYIIIVYLVLLSNFSNAMPYPRYRTSRVSKYRGLIYFIPLLLILVYL
FT                   IPLPYYIDIAIYIALLIVFYYFLVIRRVNAVPGHV"
FT   gene            153470..154399
FT                   /locus_tag="YN1551_0171"
FT   CDS_pept        153470..154399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0171"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47365"
FT                   /db_xref="GOA:C3NJW3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJW3"
FT                   /protein_id="ACP47365.1"
FT                   /translation="MALNERRVIAIILTVILAGIAIGGGIFVLSSVFKIIPSDYLLYIY
FT                   AGIWFIVAVIVSYFIGSLIRNRLGNVIGYDNASSVSFVVRLIGYIIAFIGFFVLVRVSL
FT                   GAALAAGGFAGLVLGLASQDVLSNIFGGIMLVISRPYKVGDRVTISTWQYGLIAPTYPP
FT                   KFFSNDFLIPGYTGTVTDISLLYTTIFTDEQVPVKIPNSITIQAAIFLHNREERRKVRT
FT                   KYEVFKDIDPDVLINVLKEKIKKLDFVIEEPSIKVLETTLNTYILAIDTICKTTYEEPP
FT                   RSEILKVVMRTVRELQAKTASSSGNNNR"
FT   gene            154427..155662
FT                   /locus_tag="YN1551_0172"
FT   CDS_pept        154427..155662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0172"
FT                   /product="Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47366"
FT                   /db_xref="GOA:C3NJW4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJW4"
FT                   /protein_id="ACP47366.1"
FT                   /translation="MITIRNARLLDGRIVDIGIEDERISCLGECRGNDELIDAEKKLVI
FT                   PPYFNMHFHLDSAFTKAVNRSGTLWEGIRIWQDMRNRISEDEVIRNALTAVKLFVAYGT
FT                   LWTRTHVDITERSFKLLRAINKVKEESKDMADIQITAFPQDGIFTEKGNDELLRKALEN
FT                   GVDNVGLIPHNEITREDGFRSIKFAFELAKDYNKDVDGHIDETDDPNSRYLEVLLKETI
FT                   ENKWEGRVTAGHATAMHSWDSAYRFRILPYVAKAGITVIPNPLINVVLQGRFDGYPKRR
FT                   GMAPIKEMLNANVNVALGHDCIMDPWYPLGIGNMLQVLFMAIHLDQMTGFEELISSINL
FT                   ITFNGAKAWRVKNYGIEIGNEANLLVTDADDVIDLIRFMSPPRFVIRRGNVIAKEGKYV
FT                   LFKGKWEKVKVK"
FT   gene            155696..156322
FT                   /locus_tag="YN1551_0173"
FT   CDS_pept        155696..156322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47367"
FT                   /db_xref="GOA:C3NJW5"
FT                   /db_xref="InterPro:IPR031594"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJW5"
FT                   /protein_id="ACP47367.1"
FT                   /translation="MDVSVFLAALGISLLELTEAGAIAAIYHNIYKNNLPFIYAVLGVA
FT                   VVLIPTFTVGRLIYLVPLNYVLLASAVILFYFGYRLIRSARMSFKGIRKKGGEEKEEGL
FT                   SVVFTVSAIEGFEAALVILALIPQSYSSALIGAILASFLVVILTAILKSQVARIRLPHL
FT                   KFVLSALLFSLGTLWISEVVFDIPDLILPLFFLAYLGINYAIIKI"
FT   gene            complement(156325..157239)
FT                   /locus_tag="YN1551_0174"
FT   CDS_pept        complement(156325..157239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0174"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47368"
FT                   /db_xref="GOA:C3NJW6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJW6"
FT                   /protein_id="ACP47368.1"
FT                   /translation="MVKILLFSPNPNEFKRVGVYENNKVIDLVKAYELLYDAKPPNWFY
FT                   DTKDLIEGGDGSMLMIKTILDNLRGNEDKVSYDPEKIFYYPPITNPEKIFLLAVNYKAH
FT                   GKETNNEPPKEPYIFTKFSNALIGHNQPILYPKASNKVDYEVELAVIIGKKGKYIRKER
FT                   VSDYVFGYTVFNDISYRDKQFPSEMPYGMRWVHGKGMDTGAPMGPWIVTKDEIPNPYEL
FT                   RLTLRVNGEVRQDAYAEDMIFKIDEIIEYLSNGITLKPGDVISTGTPPGVGLASGKFLK
FT                   AGDVIEAEISKIGVLRNYLVKEE"
FT   gene            complement(157270..158865)
FT                   /locus_tag="YN1551_0175"
FT   CDS_pept        complement(157270..158865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0175"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47369"
FT                   /db_xref="GOA:C3NJW7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJW7"
FT                   /protein_id="ACP47369.1"
FT                   /translation="MGKTTSELLIDAISSQVTDVFGIPGTHGLSLYEELRKRVSSGEIR
FT                   YYMPRLEYGGAIMADYYARLKGNVGIFMSVNGPGFTNSLTGLVEAYSEGSPLVLISLNK
FT                   EFKYRHRKQLHDSGYYDLQLEMARQATKASFRIYSPEDVPIVMERAFRIALEDKMGPVY
FT                   IEVPVDLLEEKSNIEDYKASKRINRTLVYPTKEEIREALNFLSECSKPILLLGYGASRS
FT                   NIISYIERLGIPVFTTIRGKGNIPENHPLYAGTIFNLSEIPGDCLIAIGTSFNDLETSR
FT                   WSIKLPRKILHVDPDVNVFNTSFNAEVTIKASAEAFLEEIVEKVNLPKWSYKVDEKTNI
FT                   ESSSSGITHDYLAKVLDEMLSEDRVIIADAGTNQVMAMDIKVYRPNSYFNSLIFNAMGS
FT                   AIPAGIGAKIASPERQIVSIIGDLGFQGCLNELITAVQYKVNFLTVLVEDGVQHFLRLN
FT                   QKMRYGNTFATDVFQIDYTRVMEGIGVNVIEVKNKEDLKKSVEEAVVLSLKSPTILRVH
FT                   VNSNSIPSRLLMKR"
FT   gene            complement(158891..159940)
FT                   /locus_tag="YN1551_0176"
FT   CDS_pept        complement(158891..159940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0176"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47370"
FT                   /db_xref="GOA:C3NJW8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJW8"
FT                   /protein_id="ACP47370.1"
FT                   /translation="MDLLIINHRDLRHNKAGGAEQVIYEISRRLVKKGVNITWLSEEVK
FT                   GLPKEEEIENIRIIRRGNSLTLHLYAPVEARKHKIVIDSVAHAVPFYSYLVNKNAIALV
FT                   HHVHQDVVKYELNPIIARAVAFSERSVSNYKSIIAVSNTTKRDLVEKLKAREDRIEVIH
FT                   NGIDHNVYKPGNKASEPLILWIGRLKKYKNPLDAIEIAKRVKAKLIMAGGGDLEKEVIE
FT                   KIKSVNGEYLGRVSEEDKIRLYQSAWIVIVTSFIEGWSMVTVEANACGTPVVAYDKGSL
FT                   PEIIRNGVNGYIVEYKNIERMSKIINNLIGNEDRIKELWKNSYQESLNYDWDKSSEKYY
FT                   NYLVRKTSD"
FT   gene            complement(159958..160227)
FT                   /locus_tag="YN1551_0177"
FT   CDS_pept        complement(159958..160227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0177"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47371"
FT                   /db_xref="GOA:C3NJW9"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJW9"
FT                   /protein_id="ACP47371.1"
FT                   /translation="MMDILKRLSLNKYNVDRTTHIEVNTDICLTCKDKPCTKVCPAGTY
FT                   EPSPDGRIIVHYERCLECGAALVACPYGAIKFRFPEGGISYKYG"
FT   gene            complement(160224..161447)
FT                   /locus_tag="YN1551_0178"
FT   CDS_pept        complement(160224..161447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0178"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47372"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJX0"
FT                   /protein_id="ACP47372.1"
FT                   /translation="MSFDADIVIVGGGLAGLSAAITANREGLSTIVLERGEYSGSKNVS
FT                   GGRMYVHALSQLFPDALERAPLERPVTKETYEIYCEEGKKITFSFQHKTKNSYTILRAK
FT                   FDQWLAKEAENEGVLISYTTLIINARREKDYVVIETNRGELKAPLVIDAGGITAPVSRF
FT                   LGVKKLEPKTLMLGVKEVLDIKPEIPENEGEARTIMGLIGNLKGGGFVYTNKDTLSIGV
FT                   TIKVESLYNSSIPSHEIVERFRESLGLSGNILEYSAHLIPYYGYDKIGKIHDKNLILVG
FT                   DAAGFLINDGFNIRGMDLAIGSGIIAGKAAKKIKELNDYSRTDIYYEMLKESFVLKDMK
FT                   TALRSFSVLSEEEVFTKYPKVICNVLGKLFTVTGDGKERPINVLLQESKSENVNTTKML
FT                   SDLMRLFI"
FT   gene            complement(161467..161823)
FT                   /locus_tag="YN1551_0179"
FT   CDS_pept        complement(161467..161823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47373"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJX1"
FT                   /protein_id="ACP47373.1"
FT                   /translation="MFGKLVAVIDKLNEGNVIEAGNELLSVAKDYENQDKIIDLLAEIE
FT                   KEIKEFRSSNDFLHRDDSPFMEVVKKSIEDMRVCRENKLKALILHTLYIISNGNEILLN
FT                   MIKKANIGKPNTYI"
FT   gene            complement(161852..162271)
FT                   /locus_tag="YN1551_0180"
FT   CDS_pept        complement(161852..162271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0180"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47374"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJX2"
FT                   /protein_id="ACP47374.1"
FT                   /translation="MKRILVGYDGSENAERALDFAIELASKFSARLFVVEVIDLTLFYN
FT                   SGVLPPLEATKSLEEKAKKDVKKAIEKAKSKGVDTEGITLEGDPAHSILEFAKDNQVDV
FT                   IVIGSRGLSKVQRIFLGSVSNKIVQESRIPVIVVK"
FT   gene            complement(162306..163184)
FT                   /locus_tag="YN1551_0181"
FT   CDS_pept        complement(162306..163184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0181"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47375"
FT                   /db_xref="GOA:C3NJX3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJX3"
FT                   /protein_id="ACP47375.1"
FT                   /translation="MEDVKKFKYFTVSSLAFGTWRIGGGYWYASHDRDNEWVSAIRKAI
FT                   ELGIRLIDTAEMYGNGHAEELVGEAIKRFNRDELFIVSKVWPSHAEYDNVIKSAKNSSK
FT                   RLGTYIDLYLLHSPSRVPICKTISAFEKLVDDGVIRYFGLSNFDVDQIERARECVSKYE
FT                   IVAIQNHYSLLNRDDERKALAYAEKNGLMYMAYTPLENGILARNEFLASIGKRYNKTAT
FT                   QVALNWYITGRNSLIPIVKASKIPHVEENAGAMGWRLSEEDWREIDEHFREKSYFLDKF
FT                   VSSLKSIRPWS"
FT   gene            163286..164323
FT                   /locus_tag="YN1551_0182"
FT   CDS_pept        163286..164323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0182"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47376"
FT                   /db_xref="GOA:C3NJX4"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJX4"
FT                   /protein_id="ACP47376.1"
FT                   /translation="MIIKPEPSLKDLSYLIESSGLKPSDLLNMYRRMLTIRYFEETIRK
FT                   IYHEGKNPFNMASGIIRGEMHLSIGQEAVAVGTLYKVRDEDVVVSTHRPHHHAIAKGVD
FT                   ANKLVAEILGKVTGLCRGKGGHMHLFDKTKNFACSGIVGASFPQAAGAAFAFKYSGKDN
FT                   VAIAFAGEGAANHGTFAETLNIASAWELPLILVIEDNKYADSTPKSFVMSTTFHYQRGL
FT                   TYNVPSYLVDGMDVIDVYSTARKAIERARKGFGPTLIEALTYRYVGHFEGDSEEYRTKE
FT                   EVEMWSSLDPIRRLENRILRLNYADNEILAKLREEARKQVQDAIDFALRSPYPDPNEAL
FT                   TGVFA"
FT   gene            164320..168905
FT                   /pseudo
FT                   /locus_tag="YN1551_0183"
FT   gene            164550..164705
FT                   /pseudo
FT                   /locus_tag="YN1551_0184"
FT   gene            164864..165013
FT                   /locus_tag="YN1551_0185"
FT   CDS_pept        164864..165013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47377"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJX5"
FT                   /protein_id="ACP47377.1"
FT                   /translation="MKPWIEYYNGPVPYEHLSARHKTGATGYSCVRKYVSRRLKVFIKT
FT                   HLEP"
FT   gene            complement(164978..166216)
FT                   /locus_tag="YN1551_0186"
FT   CDS_pept        complement(164978..166216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0186"
FT                   /product="transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47378"
FT                   /db_xref="GOA:C3NJX6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJX6"
FT                   /protein_id="ACP47378.1"
FT                   /translation="MTKSKNNPGRGNTIRESNTMKVMEEIREKIRKAIKEGVSLREIEE
FT                   IILQEAMMEEREAYLEVEDDHKNGTYFRYLGTGDGVLRLRVPRTRKGGFRPKILPEKYE
FT                   RTSPDYEDFLQQLVLSGMTPSQVKAVLAAKGIPYSEIVMNRVAERISNKLKEYKSRELP
FT                   HDLLALYIDVKIVKVRISESIMERAIYIAIGVDLEGNKFVLDYEVRDREDLDGWKSFLS
FT                   GLVSRGVSRVDVIVSDDFSGLDRVVSTLFPSSQHQLCITHMVRNLMRVLPDKEELMIRV
FT                   RDLKSSRKVEEGRKAILSLSQLVQPFSPARAKRLLDAADKYCSFLNFPREIRHYLYTNN
FT                   TSESFNSILARFEEELGGYFPSLRSLEVYLYVSIHESNSRWKFRPMSVIRHYSYHLKQL
FT                   HASRFQVSLDEDF"
FT   gene            166289..166759
FT                   /pseudo
FT                   /locus_tag="YN1551_0187"
FT   gene            166988..167962
FT                   /locus_tag="YN1551_0188"
FT   CDS_pept        166988..167962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0188"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47379"
FT                   /db_xref="GOA:C3NJX7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJX7"
FT                   /protein_id="ACP47379.1"
FT                   /translation="MLNFQGEKVEKVAKTLIPACLWNDSVENKSRAYDVSPQTVRNYVV
FT                   KQGMEVIEKLLERARKISLEILKGVKEIDLSIDWTTKTWYGKPVKGSSEKGNSWNYATT
FT                   KYKGKVLLLAFIPQVNGMTKDEIVKVLVEQVMAMGFKIRLMTLDAGFYTVDVLNFISQF
FT                   KYIVAVPVGDVKVYEEFDGEYMTNSKRHRRDGQVKFRLLVYSKEKVRRKSLVYFARATN
FT                   LDLSKREVLDLYNKVRGPIETSYRNIKAFLPFTGSTKFVFRTLIFVLALVLYSLYTIFK
FT                   GEVGREEFRLLLILLFPDLFNPENFTFNIIETLIYTIDLFLRR"
FT   gene            168978..169253
FT                   /locus_tag="YN1551_0189"
FT   CDS_pept        168978..169253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0189"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47380"
FT                   /db_xref="GOA:C3NJX8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJX8"
FT                   /protein_id="ACP47380.1"
FT                   /translation="MLSYEYILRVDEKGRIMIPKEVRDKLKIFNSVRLIVNESGEIIIK
FT                   KMERNIEKYAGYFRVDWSKLAGMDIDKILDEALRERSEKWLRDILT"
FT   gene            169229..169363
FT                   /locus_tag="YN1551_0190"
FT   CDS_pept        169229..169363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47381"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJX9"
FT                   /protein_id="ACP47381.1"
FT                   /translation="MVKRYFDVNVFLYFLTNHPNYFQRAKEWFQNTNEIYTGEITIIN"
FT   gene            169372..169563
FT                   /locus_tag="YN1551_0191"
FT   CDS_pept        169372..169563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47382"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJY0"
FT                   /protein_id="ACP47382.1"
FT                   /translation="MKKLTGKSDEEILNVLSSFFRDAEINLDHLETSDLEKVREIVEKF
FT                   KLDFEDAIHFFYRKRLVS"
FT   gene            169652..170236
FT                   /locus_tag="YN1551_0192"
FT   CDS_pept        169652..170236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0192"
FT                   /product="SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47383"
FT                   /db_xref="GOA:C3NJY1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJY1"
FT                   /protein_id="ACP47383.1"
FT                   /translation="MIYVFKGLSGYIILFLLMIGEGLGLPLPSEVIMPLVGYYSYLGSI
FT                   SLYIAIIVGTLGSLVGSIIAYVIGYNLGLPFLKRYGKYILIDEGKIEALHNWFLRYGDI
FT                   AVFGFRFVPGLRALISYPAGIGQMKIPKFLGFTFLGHTIWDIVLSLVGYELANQINFVV
FT                   TLAEKFGNYILIVVVIIIVIYILVRVLRNRQ"
FT   gene            170331..170948
FT                   /locus_tag="YN1551_0193"
FT   CDS_pept        170331..170948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47384"
FT                   /db_xref="GOA:C3NJY2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJY2"
FT                   /protein_id="ACP47384.1"
FT                   /translation="MAKSTTTKVGSAIGRTIVYIILYVTVSAIVKFLIEVLLPSVHLNA
FT                   VSYESYIQILLALAFGYLIVSGISLIFYYSLLPKYGHPTATAVRNVMRIIGIGALVAAI
FT                   AGAVAGGAAGVALGGFIGIVIGFASQQVLGQAVAGMFLLIARPFKINDNVNLVGEDGIV
FT                   EDVSTLFTTVIKSDGTKVLIPNNAIIGNKIYLKPVQQQQKSS"
FT   gene            171362..172678
FT                   /locus_tag="YN1551_0194"
FT   CDS_pept        171362..172678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47385"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJY3"
FT                   /protein_id="ACP47385.1"
FT                   /translation="MNDEELLKIMSEWNFWGKEKPKVGIERECYVERIIKLLNSVKVIA
FT                   ISGVRRAGKSFIVREVLNRLINNGVNPEDTLIIRLDDERLLNLNYELLLKIYNLYLTYV
FT                   KKDKSKPTYLVLDEAQEVEGWERFVRGLEERCEAKIVVTGSSAKLLSSEFTTLLSGRHV
FT                   EVRVTPLSFLEVLEFKGIKIKGVLELAENIDRIGKELVEVMNYGGFPDVVLNPEVRAEL
FT                   VHSYFDTIIVKDVVNRYKLRREDKIRTLAKFYVSSSASKITYNSVSKFLKIPVKTVERY
FT                   SEYLEKSFLVFFLKNYSISPKAVENSPRKVYVIDNGFLKYFSTASLGRIFETLIVQHLY
FT                   RYAVRRFYELYYWSSEDSEIDVILKSGKKILPIQITYELNDENEERELKSLKKFKKYAN
FT                   YDNSLVITFEQEIEIEGIKVLPAYKFLLNLEDLLDSLIS"
FT   gene            complement(172986..174053)
FT                   /locus_tag="YN1551_0195"
FT   CDS_pept        complement(172986..174053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0195"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47386"
FT                   /db_xref="GOA:C3NJY4"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJY4"
FT                   /protein_id="ACP47386.1"
FT                   /translation="MVGSISEAKSSVSGVTDPYCRTEHCGKIHPYRCDKEVGVLGIDVS
FT                   KDNLITSRGGKYENNLKGYEKILDMKPCTIVLEPTGVYSIKPSQYFKEKGIRVLQVSPN
FT                   VLSREKDFREKKTDFYDAEKLENMVDKAKEYEYNVLRELVTLYLFLKDMEVKQKNRLKR
FT                   ALFLVSDNDKINKERLERLASGDFAQEVLYQLEYTPIVLEEVKILAKALFETQEKLKEV
FT                   KEMIESQVPEDHVLLTIPGVGKLAAGIIIGVVGDIRRFPKPESFVAYCGLDPVVERSGK
FT                   AVVSKGISRRGNKYLRSLFYFLAQMNCSKNPTLLRFYESHKDKLHGRKLYTALARKLAK
FT                   VVWSVWYNNKPYEPK"
FT   gene            complement(174080..174805)
FT                   /locus_tag="YN1551_0196"
FT   CDS_pept        complement(174080..174805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47387"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJY5"
FT                   /protein_id="ACP47387.1"
FT                   /translation="MKWGPSLLLLTLLLLPIFFLPTNGLIARFGWGGGASYSTYSENIV
FT                   VQPSSTQLVTVSQTGSSLLNLPWLNPTYVSIYNTYYLQVLPNQEYISNNVSLSLSSSQI
FT                   ALNVTWLLASSSNTGSYGSIAIGYGVNFPSGFTGSYASALPYASDGIVVYLEKGSFPTY
FT                   RIFVYFDGVKQLNVSVGSISVGQQIGLGFWYLPASNQLYVYYYNGTLKTFSIIPDQVIN
FT                   NQFSSLSLNTYIGFISSRE"
FT   sig_peptide     complement(174731..174805)
FT                   /locus_tag="YN1551_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.823 at
FT                   residue 25"
FT   gene            complement(174845..175075)
FT                   /locus_tag="YN1551_0197"
FT   CDS_pept        complement(174845..175075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47388"
FT                   /db_xref="GOA:C3NJY6"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJY6"
FT                   /protein_id="ACP47388.1"
FT                   /translation="MKIYFPSLCISPPPSPSVQISQQPAIVVNQPPPPWYVQYIPEFII
FT                   VAGIVATVLTFYFSPELRNGLISKIRRYTRK"
FT   gene            complement(175122..176033)
FT                   /locus_tag="YN1551_0198"
FT   CDS_pept        complement(175122..176033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47389"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJY7"
FT                   /protein_id="ACP47389.1"
FT                   /translation="MRKALLALLTLSIELLILATPTGAITASQIGASQIVNTYNSDNWA
FT                   GVAYSVEWKSWFTNYWGPILWASESIYVGNLTLGYISYPNYIYTEDISIWIGLSPAQIG
FT                   YGTDSSSGSEQTNFIQAGFDIDVGSYVSVNYFVTTIVNGQLVYNNENYVPAGKATYLDV
FT                   FLENLGNGTALAQLYVYYANGTYWTTTIYTSIPWTNTGSAMSIVEAPSFSTSGPYAELP
FT                   YVSGGMIHFTFSYVGSDGNEHIGPSNNPVGNMYADVYTLNEPSTYNVAQAQIYNGWANN
FT                   NGGWDYLYQFYYPGAGQTTYGL"
FT   sig_peptide     complement(175953..176033)
FT                   /locus_tag="YN1551_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.328 at
FT                   residue 27"
FT   gene            complement(176070..176417)
FT                   /locus_tag="YN1551_0199"
FT   CDS_pept        complement(176070..176417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47390"
FT                   /db_xref="GOA:C3NJY8"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJY8"
FT                   /protein_id="ACP47390.1"
FT                   /translation="MRILKIVWILFILLNVYDVIISAIYWLKENAIFEENYFIWFYYYY
FT                   EGHISFILALLMLISVKLLFFTGVYWYTGLFDLLKVSKYKWLSLLPFVVLSILIDTQNT
FT                   FILLFNYAPPF"
FT   gene            complement(176427..176633)
FT                   /pseudo
FT                   /locus_tag="YN1551_0200"
FT   gene            176837..177860
FT                   /pseudo
FT                   /locus_tag="YN1551_0201"
FT   gene            complement(177812..178120)
FT                   /locus_tag="YN1551_0202"
FT   CDS_pept        complement(177812..178120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0202"
FT                   /product="zinc finger C2H2-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47391"
FT                   /db_xref="GOA:C3NJY9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJY9"
FT                   /protein_id="ACP47391.1"
FT                   /translation="MLYVSLRAVYKWVCPICLTPFETYQAFIMHLRYEEKEKTCRYCGK
FT                   TFANTDGLLDHIGKKHVWLPWGRHKERGGDGDPTTTLNPSKSYAICSILDNHSAYLR"
FT   gene            complement(178128..178529)
FT                   /locus_tag="YN1551_0203"
FT   CDS_pept        complement(178128..178529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47392"
FT                   /db_xref="GOA:C3NJZ0"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJZ0"
FT                   /protein_id="ACP47392.1"
FT                   /translation="MAFLQQVISTASGLSSVVSTVALVWTIYYYRKQTELLKTQIDEMK
FT                   KESSVQECLQLRDSTIRLHEVLSPLMLDEIGEIENFRDELNKVCSSPSVSCISYIHNLF
FT                   SRPEEIGEFKEKISRVSKECYREPVHARE"
FT   sig_peptide     complement(178455..178529)
FT                   /locus_tag="YN1551_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.732) with cleavage site probability 0.525 at
FT                   residue 25"
FT   gene            178564..179562
FT                   /locus_tag="YN1551_0204"
FT   CDS_pept        178564..179562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47393"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJZ1"
FT                   /protein_id="ACP47393.1"
FT                   /translation="MMESRIKEYLQSEDKELKHEAWNYVEAHYKELGKDFIIEMLKFPD
FT                   TGTRYRVWNFVKKLVEEKFLTVEECKALSPYFLEMLKDNNVVVRALSWYVTLIPLIDIG
FT                   IIDKEKVVKEYSRILRDLNSLKVNDARFKNYEEFVEDVYSSICNIPYSSSKGECELLEE
FT                   IERMKNEYSEIIKLTDVPLINDIKGNIMKEIELGKEVGKLGIDDLFDVVDKFSFIIDGK
FT                   CGDKTCKDVFPLRDVIEGKINPLKEMIENPKEFCKKYGLELGCDEYKPLLVKIREVVED
FT                   DEESKVFYSILYLNWISNQFKTMVNTIQLPSEIDIKVRMKAELERITCISS"
FT   gene            complement(179825..180622)
FT                   /locus_tag="YN1551_0205"
FT   CDS_pept        complement(179825..180622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0205"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47394"
FT                   /db_xref="GOA:C3NJZ2"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NJZ2"
FT                   /protein_id="ACP47394.1"
FT                   /translation="MNFLVSILLGIIQGISEWLPISSKTQELIASHYLLGLDVSIAYTF
FT                   GLFMEMGSIGSALIYFRQDVKRVFHDKFLLKFLVVVTALTGIVGVPLYVISDKLLQNAY
FT                   NPSIPMIFLGIALIADGIYIRYSRSRTREFKNLSTKEMILIGIAQGIAALPGVSRSGMT
FT                   VSTMLVLGINPEDAFHYSYLAYIPAAIGSVGTTLLFTRHHISYVVSLIGIDGIALAVIS
FT                   ALLTGLVVIGFLLKIAKTKKVYLIDFMLGGIAVLVSMLGLIIS"
FT   gene            180988..181176
FT                   /locus_tag="YN1551_0206"
FT   CDS_pept        180988..181176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47395"
FT                   /db_xref="GOA:C3NJZ3"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJZ3"
FT                   /protein_id="ACP47395.1"
FT                   /translation="MEHSPALTAFIILIGIIASTFAVVYVAYSLVSSLFTQQSSIILYS
FT                   SCVFENGTLKVNLFSPK"
FT   sig_peptide     180988..181056
FT                   /locus_tag="YN1551_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.710 at
FT                   residue 23"
FT   gene            181822..182355
FT                   /locus_tag="YN1551_0207"
FT   CDS_pept        181822..182355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0207"
FT                   /product="PaREP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47396"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJZ4"
FT                   /protein_id="ACP47396.1"
FT                   /translation="MESKIPTIEKHRNAYVKIRIIESLDELALGLKLLKEGFSRNSANK
FT                   VFLSWKAIISALTVMNLEKMPRNEKEKEWYYKSGFLAPTTGLKGISQRLEELGYNVNSL
FT                   TSVALELHRYAYNGLYKGASDYYEREEAINDIIYLSKEIMKVIKEFFKEYWDEEIEKHY
FT                   NLAEKELMSSTKNL"
FT   gene            complement(182384..183097)
FT                   /pseudo
FT                   /locus_tag="YN1551_0208"
FT   gene            183354..183737
FT                   /locus_tag="YN1551_0209"
FT   CDS_pept        183354..183737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47397"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJZ5"
FT                   /protein_id="ACP47397.1"
FT                   /translation="MESHENTHSQIMEYIKKNPDLQKAIELLRREGKVSRTALQFEFGW
FT                   TEWKARKVYEALRYMCYKGLAFKEDESHETICRTYHGYVELISVGRGSDSDMVIDEDLS
FT                   EEREEKMEEEEDWEEETEEEEEE"
FT   gene            complement(183791..183940)
FT                   /locus_tag="YN1551_0210"
FT   CDS_pept        complement(183791..183940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0210"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47398"
FT                   /db_xref="GOA:C3NJZ6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJZ6"
FT                   /protein_id="ACP47398.1"
FT                   /translation="MVVGKDTTRVVVYLPKDVAERLEKEAEEKGLSLSAYLRMLILDCT
FT                   KQRQ"
FT   gene            184011..184334
FT                   /locus_tag="YN1551_0211"
FT   CDS_pept        184011..184334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47399"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJZ7"
FT                   /protein_id="ACP47399.1"
FT                   /translation="MAQIQFGDKWVQVKGSIFYLTPHALEILKAWYDWSVNYDTEASEE
FT                   FRAEEVEYFAKAFEMLKPQSHDEAFHYLTILENAFVQTDYKIKEIIDRIHANKSGNILV
FT                   REL"
FT   gene            184331..184423
FT                   /locus_tag="YN1551_0212"
FT   CDS_pept        184331..184423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47400"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJZ8"
FT                   /protein_id="ACP47400.1"
FT                   /translation="MNLMKTDWDCIEELIEKALNDRIRVYDSYK"
FT   gene            184539..184781
FT                   /locus_tag="YN1551_0213"
FT   CDS_pept        184539..184781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47401"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJZ9"
FT                   /protein_id="ACP47401.1"
FT                   /translation="MKVKIPYRFLEDNTWCVKEYGEWYPYADDAEYEFTVDECEFDYAD
FT                   LEDIVNEYTADIIDILLRNHRKELEKALAKGMTRL"
FT   gene            184978..185130
FT                   /locus_tag="YN1551_0214"
FT   CDS_pept        184978..185130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0214"
FT                   /product="conserved hypothetical plasmid copy-number
FT                   control protein cop-6"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47402"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK00"
FT                   /protein_id="ACP47402.1"
FT                   /translation="MSTRTIAFVRLKEEDKMIIRKIAEYYDVSESDAIKIAVKHLAKEL
FT                   GLLSS"
FT   gene            185186..185530
FT                   /locus_tag="YN1551_0215"
FT   CDS_pept        185186..185530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47403"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK01"
FT                   /protein_id="ACP47403.1"
FT                   /translation="MRPGLNSSSVRKYKRFIEWLAESRKEVSNLLRYDKELEVLLIISR
FT                   FEEGVTKHRLEKEAHINGKRLNEILFRLRSNGLIYGLTDGKKHLIFLTEKGKEVVELIV
FT                   NLSKLEVKSE"
FT   gene            185729..186037
FT                   /pseudo
FT                   /locus_tag="YN1551_0216"
FT   gene            complement(186066..187310)
FT                   /locus_tag="YN1551_0217"
FT   CDS_pept        complement(186066..187310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0217"
FT                   /product="transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47404"
FT                   /db_xref="GOA:C3NK02"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK02"
FT                   /protein_id="ACP47404.1"
FT                   /translation="MTKSKNNPGRGNTIRESNTMKVMEEIREKIRKAIKEGVSLREIEE
FT                   IILQEAMMEEREAYLEVEDDHKNGTYFRYLGTGDGVLRLRLPRTRKGGFRPKILPEKYE
FT                   RTSPDYEDFLQQLVLSGMTPSQVKAVLAAKGIPYSEIVMNRVAERISNKLKEYKSRELP
FT                   HDLLALYIDVKIVKVRISESIMERAIYIAIGVDLEGNKFVLDYEVRDREDLDGWKSFLS
FT                   GLVSRGVSRVDVIVSDDFSGLDRVVSTLFPSSQHQLCITHMVRNLMRVLPDKEKEELMI
FT                   RVRDLKSSRNVEEGRKAILSLSQLVQPFSPARAKRLLDAADKYCSFLNFPREIRHYLYT
FT                   NNTSESFNSTLARFEEELGGYFPSLRSLEVYLYVSIHESNSRWKFRPMSVIRHYSYHLK
FT                   QLHASRFQVSLDEDF"
FT   gene            complement(187317..187433)
FT                   /locus_tag="YN1551_3230"
FT   CDS_pept        complement(187317..187433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_3230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47405"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK03"
FT                   /protein_id="ACP47405.1"
FT                   /translation="MKPWIEYYNGPVPYEHLSARHKTLVKMGATSYSCGSKR"
FT   gene            complement(187592..187747)
FT                   /pseudo
FT                   /locus_tag="YN1551_0218"
FT   gene            188304..189095
FT                   /locus_tag="YN1551_0219"
FT   CDS_pept        188304..189095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0219"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47406"
FT                   /db_xref="GOA:C3NK04"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK04"
FT                   /protein_id="ACP47406.1"
FT                   /translation="MSFLIILHNMIIRKIKREDLDNAAKVMVEAMNANLEGAKITFNLF
FT                   LELGECLLAEEEGEIIATACYIPYKILSWIGNVAVKPRYQRKGYGKRLMSELLKLISTK
FT                   VIRLDSTTEGYRLYRSLGFIEEYETILYELRDLKGSNNVKTSDKLEDWMMDLDKKAFGD
FT                   DRGKLLGRINGLILYTQGGYGILSRNILGPLVAEDDFIAESIIRKAVELGARIIITIED
FT                   KTEFIEDLGGRRLYTCTRMMLGESINENRSLIYGIYRYAFG"
FT   gene            complement(189636..190691)
FT                   /locus_tag="YN1551_0220"
FT   CDS_pept        complement(189636..190691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0220"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47407"
FT                   /db_xref="GOA:C3NK05"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK05"
FT                   /protein_id="ACP47407.1"
FT                   /translation="MLFDERPKERREDLFDRDNEILTIKNNIRRPLIVISGVRRIGKTS
FT                   VLLVALNEIKENFILIDCRKLKENYGRKDLYSLFSQALSSKLSYLRDILERVRGISILG
FT                   NYVEIKWKGREYLSLSDLLDNLNKKRLIIAIDEAQRLRGPMSNEVKDAIAHAYDYDKNL
FT                   TFILTGSEVGLLHDLLDIDNENSPLYGRYYFELSLERFSRDLSEGFLRRGFEEFSLKVE
FT                   DNIIKEIADYFDGIPGWLTFAGNAYLNMRKIEEVKERAISIAKRELEHLIEEKSNVSQI
FT                   TGRRYKNTLRCLARGKNTWSSLLQCLQEEEGSTISSSVFDNIITNLEKLSIIKDYEFLD
FT                   PIYKEAAKRLR"
FT   gene            191162..191575
FT                   /locus_tag="YN1551_0221"
FT   CDS_pept        191162..191575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0221"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47408"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK06"
FT                   /protein_id="ACP47408.1"
FT                   /translation="MVSSEANELMEKAKRYLELAKISLEKGFYSEAYFLSSLSAELYIK
FT                   GVSISLVGGFPTVHDIREILSYIRLKRKDLEIIEDFIRNNRDKLKDISNEYLVSRYNLS
FT                   YTYNRQDAEECLNTALMVIKFGENLLHSISGKD"
FT   gene            191535..191849
FT                   /locus_tag="YN1551_0222"
FT   CDS_pept        191535..191849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0222"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47409"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK07"
FT                   /protein_id="ACP47409.1"
FT                   /translation="MEKIFFIQLAEKIRPIFGKIAIILHGSRIKGNYYTASDLDILIIS
FT                   KNCLDRKGLKILYSFGEELNGIKLDYQLVCYKNKDYWIVKNVLSSPHLVIIDDFNEFMT
FT                   "
FT   gene            complement(192225..192356)
FT                   /pseudo
FT                   /locus_tag="YN1551_0223"
FT   gene            complement(192455..192529)
FT                   /locus_tag="YN1551_R0001"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(192455..192529)
FT                   /locus_tag="YN1551_R0001"
FT                   /product="tRNA-Thr"
FT   gene            complement(192773..193006)
FT                   /locus_tag="YN1551_0224"
FT   CDS_pept        complement(192773..193006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47410"
FT                   /db_xref="GOA:C3NK08"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK08"
FT                   /protein_id="ACP47410.1"
FT                   /translation="MGTIFGIIGVIALTYFTYLLLPFLVSDLIEHFLKFALEILSLGMD
FT                   TALILIEYPKLKIAFLPIIGEGIEVVIFIISL"
FT   gene            complement(193103..194632)
FT                   /locus_tag="YN1551_0225"
FT   CDS_pept        complement(193103..194632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0225"
FT                   /product="phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47411"
FT                   /db_xref="GOA:C3NK09"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK09"
FT                   /protein_id="ACP47411.1"
FT                   /translation="MKKLLILIILIPLLLMNNTFHANTSMTIKHVIIIIEENHSFDNLF
FT                   GTYPFGYPPIINNITLSVMWPDGLYDNYIQLENTKNGVLDWISVPTIPWLPLSYSHPYY
FT                   ANAYDTVDPSEGWTVYHGDYWLGKPIGFVFYSGTQSMAYFSYQQAGILWDYAEEYTLAD
FT                   AYFSPVLGLTEPNRVAYLTGFPPDFFSDEAYNVVPFNETIMYQLEKGNISWGYFVYNIN
FT                   GIPWPLTAFTGINMTYIYDLSVFFKDLDNGSLPAVSWVMFLGGNSDKYDMHPPYNVTAS
FT                   EMELVKVINAVMESKSWNSSVIFITFDEGGGYYDHIAPPAINYYGLGQRVPLFIISPYA
FT                   KEGYVDNYTISGYTLLAFIDYNWHLPWLTKYVENSDLQGLLQAFNFSSKPRSPIILSPS
FT                   NWTYPIPLQNPIHYGYIAVVTNDYKSYTTVYPAPSLQYLLPLEIVGIILIIVRKKILTP
FT                   IGLIVLLIVLGISTYYYTFYNLYSFIAEFYLYSSLIGVIGGTALLVRGRKK"
FT   sig_peptide     complement(194558..194632)
FT                   /locus_tag="YN1551_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.437 at
FT                   residue 25"
FT   gene            complement(194724..195134)
FT                   /locus_tag="YN1551_0226"
FT   CDS_pept        complement(194724..195134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47412"
FT                   /db_xref="InterPro:IPR018747"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK10"
FT                   /protein_id="ACP47412.1"
FT                   /translation="MVSDTELFSWFKELGMKVEQIKSGDLYFHFTVAPPMGGLPVSVIR
FT                   PRQDSTYYIVAVLLELDQEKLKNSSRLVEQIKKELLRMNVEFFFTPNDKEPKSIQVARL
FT                   MFTDGLTKNEALNNVTLVKNSALLVLQLLNES"
FT   gene            complement(195137..195709)
FT                   /locus_tag="YN1551_0227"
FT   CDS_pept        complement(195137..195709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47413"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK11"
FT                   /protein_id="ACP47413.1"
FT                   /translation="MIPYIIDLDAIFDLSSIEIYRIITSSLSNVRYYPPKDLLKTVIGD
FT                   LDISKFKPYPDSQYLEELNYRARIYVVTNLPKIDAKSLLLRHNIDTFVQDVITPEDTNK
FT                   YFPSKEVLMFISRKANSPLGSITFITPHIDYAIPISNMGARTILIRNLISLPKDIKVEI
FT                   RKNLIELAEITAQHKMESGMGDSALRC"
FT   gene            complement(195706..197187)
FT                   /locus_tag="YN1551_0228"
FT   CDS_pept        complement(195706..197187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0228"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47414"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK12"
FT                   /protein_id="ACP47414.1"
FT                   /translation="MLNAGLIVSKKAREIIGDEILKKVFEEAKLPYVAEMGDYIIDDVK
FT                   NNELKALLVVSENGRERWMEDIDQKLGISPLAILIIPPSWFKDKSKKYVFTLLTAYSLR
FT                   IELMDLAYRVQPTPTSSVSRRSLLKLKTCEYKPYPVLFDEVHAEREINRAIESCPQGLI
FT                   VKAPEGPSVGYPERCSVCGYCSASSYLGYLEIPTATTDQVVSFINVIVRYYEDKQAALL
FT                   FTDSIIDEVPEGIFPFLMPCTAGVHDSFVLASYAAGITPIVHVSSKCGSRDIALKRLDE
FT                   LPSHFPGTSFTISKAKDDEELKRTLLSIKLTQLSRSEIPLDVILQRSRRRALLIWSIEE
FT                   MSKKVKLNEDDVVPEVYNVEVDPNKCVLCGVCVRACQMLVPELKGNNTLELSYNIPYCI
FT                   GSQRCVRNCPEKAVVVTGFAKISNLKKKVVNKAEVAKCRFCGKPLGSEKIKTKVDTLLI
FT                   QYGFAGTAQYTDVCNECKQKILTKIWLEKLLSGKK"
FT   gene            complement(197187..197837)
FT                   /locus_tag="YN1551_0229"
FT   CDS_pept        complement(197187..197837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47415"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK13"
FT                   /protein_id="ACP47415.1"
FT                   /translation="MSVSVLLNVRHALYDLFADLFLYKFVEDEYKQLLEKIDVVDRELD
FT                   KQLEEVMGIRATEIKRVFSETKRSDYLLEYSTLFLSGFGVKPLLPVESKRLFQLMGEKV
FT                   ATFKYTDVIRFYKSKGIVMKFSSQFNPEPDHVSSIFAFMSLLIEEEYEHRSEGRDPFKI
FT                   VQDEKNFTLTHIFSWIPDWINDVINDPRSNIYKIVCSELAKFLQFERKYLGVN"
FT   gene            complement(197860..198702)
FT                   /locus_tag="YN1551_0230"
FT   CDS_pept        complement(197860..198702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0230"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47416"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C3NK14"
FT                   /protein_id="ACP47416.1"
FT                   /translation="MSSPQNTTTPQIKLDIRQGGVQHAPPFSLKANYAIITDLNKCFGC
FT                   GGCQMSCKEWNTSGMFGPIPDLNPYGELDVMFWLRVLYVEVGTYPQTKVYNIPINCFHC
FT                   VNAPCTEVCPVGATFKRTEDGIVLVDYNECIGTKYCIYACPYGNRFFDYVEGVTKKCTH
FT                   CFDRIYDPTLPPEERIPACIHGCMVQARIWANILDPTDPGTILFYDKGGFVMGPETGAQ
FT                   PASGYLPWRSKYAESDVQLLSEAEYYNVWTANGVVQLGAQGNNSTYTEGNGSNSNSSS"
FT   gene            complement(198713..204180)
FT                   /pseudo
FT                   /locus_tag="YN1551_0231"
FT   gene            complement(201195..202145)
FT                   /locus_tag="YN1551_0232"
FT   CDS_pept        complement(201195..202145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0232"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47417"
FT                   /db_xref="GOA:C3NKD7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKD7"
FT                   /protein_id="ACP47417.1"
FT                   /translation="MEAPVAGIDVSKDKLIMYFQGKLYEFPNDRQGFEEIRKILPKGCK
FT                   VGIESTGVYHVNLAKYLNNEYDVRIINPFILKKFKGFRGKKSDKNDAKKLAEIVVSMGS
FT                   GFTTSDARELTSQWDFVTRSIARVKNRLRRDLVLLGYRDSLSKKNLEEVLRGGDSIVLA
FT                   EVRFLLEELERLKTRKREIEKELENVVSKDSLIFTIPGIGKTLGCIILARVGDVRRFSD
FT                   KKRFVAYCGLDPLVESSGKSVVSRGISKRGDAVLRRAFYLAALTAIKVNPVIKRFYEEH
FT                   KGRLKGKKLITACARKLAVITWAVLYYNKPFDASE"
FT   gene            complement(204261..205085)
FT                   /locus_tag="YN1551_0233"
FT   CDS_pept        complement(204261..205085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0233"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47418"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKD8"
FT                   /protein_id="ACP47418.1"
FT                   /translation="MEDVIKQAEELLEKGRYNEVLKVLENFESVEVYLLRAEAYLRMSN
FT                   SKAALVELDKGVQTFPFSYAILSAKAEVLENEGRLEEALENINKALEILPFSSEYRFIK
FT                   ARILFKLERYEEANIELTEVSRLNPNNVDARVMKAFCYYNMGLKLDALSEINRALNVKK
FT                   EDSSLHELKGKIYFETGFYKLALSEFKIAAHYDPNNPDHYYNAAACYYNLKMYNDALTY
FT                   MDLALSKGEKANYHILKALILKELNMEFSQEVEEAIKLDPSIKSIIENLFKK"
FT   gene            205196..206272
FT                   /pseudo
FT                   /locus_tag="YN1551_3247"
FT                   /note="conserved hypothetical protein"
FT   gene            206440..207066
FT                   /locus_tag="YN1551_0235"
FT   CDS_pept        206440..207066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47419"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKD9"
FT                   /protein_id="ACP47419.1"
FT                   /translation="MSIKILDDRDTIILEFLVIYGYLTSYKLAIISDIPMATVWRILVN
FT                   LKSLSLVTKQKKGFTITPRGLVFAYYLTKKDNIRLQALQKLKESWKYDGSVNEIRSFLD
FT                   ALNQFLKKYEISLISVCFNHPLSVISLMLPKAKELDEFSQRLLARFILKAFPTVVLPTG
FT                   CKAIISFDEKGEPYALAADCKDEGVHIFHKCPYINKYFSVEVKPR"
FT   gene            207063..207962
FT                   /locus_tag="YN1551_0236"
FT   CDS_pept        207063..207962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47420"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKE0"
FT                   /protein_id="ACP47420.1"
FT                   /translation="MIQLQRKFFLNLSQLVKQGFHPALLLTGCQKRALPVMKIINSNGD
FT                   LRGDLKINLCIRMGLREDKSCEFFYPSTREITYKKEISTSKGNGLLLASSEGLLLVDAI
FT                   YPERNKEILRATLSNLITIWGVKWYEIETKDNIVGFVWGFTDRIYMEVKEGMKVGMINR
FT                   PGGTLPVKLLYKALNGNIEYLEKRGIGINYIYELAEETFSRATKILKLNSNVLPINITR
FT                   IGINNINSLFANYSLKIQLPTPWYAEIMREIAPLIQDPLQSELLVLVIGEKREVEDALQ
FT                   EAEKQGFPSFLVGEVLRR"
FT   gene            complement(207951..208943)
FT                   /locus_tag="YN1551_0237"
FT   CDS_pept        complement(207951..208943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0237"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47421"
FT                   /db_xref="GOA:C3NKE1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKE1"
FT                   /protein_id="ACP47421.1"
FT                   /translation="MKALVFDKNGIENLKFTDYKDPEIGNHEVLIRVKLAGVNPVDYYT
FT                   VERLKANPIPHIPGVEFSGEVAKVGDHVKSLSVGDRVTIYGRIFDGTCDMCMTGYETVC
FT                   RNGGRIGVDANGGWAEYIAVEEKYVFKLPNEYTWEMGSSLTVAALTAYHALKEAELRPS
FT                   QTLVIFGASGNTGMFLVQLGKKFGAKVIAVSRKSWLREYGADFVVDYNEVEEKVKEITN
FT                   AKMADVVVNSLGEQLWDKSFSVVGIRGKLVTFGTLLGGNVKVDLSQLYSKHISILGVNR
FT                   GNRKDFVELLDICKDCKVKTWKIFKLEEGKQALKELFSKERDGRIFLSP"
FT   gene            209108..210523
FT                   /locus_tag="YN1551_0238"
FT   CDS_pept        209108..210523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0238"
FT                   /product="cytochrome b558/566, subunit A (CbsA)"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47422"
FT                   /db_xref="GOA:C3NKE2"
FT                   /db_xref="InterPro:IPR017572"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKE2"
FT                   /protein_id="ACP47422.1"
FT                   /translation="MSIKRRSKYTLSVLLLASFLAIIMGLANVPMAQTSPQIPVYKVVG
FT                   SADLSNPGSASYWNQIPWINISLTANIPMAPTSGLTHYLLVKAVWNGSWIIILERWYAP
FT                   EPAFGAWSAAAAALYPPASGPGLFRQIMLTPSTTYTIEKNYTNYFSIVNGNTIQGRLVL
FT                   NYSGILLPTPNNTQISVMSNGTIILWHSPRPMEDLLYSDGMFYGYYTNSTWYYPDRAAI
FT                   MWYMGSVIPPTKDGMNIGGKVPGQTFDGVTFKDAGGSLVQSGGAANIWMWVSGATWNNA
FT                   TYDPAFKANLWQNTSLTGLSYVDPNNHGFAVPLYTNNTNMYEVDTSGIWYAPVASSGLN
FT                   GSLFFIWTGATYQNGYWTLEFARPLAVPSAYANWMPNITVGKTYYVALAVWQGKLGETL
FT                   FDKSITSNFLTLELVTTPPTSTTSSTTPTTSVTNTTSVITVTSIPSATIYVTIVGVVIA
FT                   IIALIILYVVFRR"
FT   sig_peptide     209108..209206
FT                   /locus_tag="YN1551_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 33"
FT   gene            complement(210840..211907)
FT                   /locus_tag="YN1551_0239"
FT   CDS_pept        complement(210840..211907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0239"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47423"
FT                   /db_xref="GOA:C3NKE3"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKE3"
FT                   /protein_id="ACP47423.1"
FT                   /translation="MVGSISEAKSSVSGVTDPYCRTEHCGKIHPYRCDKEVGVLGIDVS
FT                   KDNLITSRGGKYENNLKGYEKILDMKPCTIVLEPTGVYSIKPSQYFKERGVRVLQVSPN
FT                   VLSREKDFREKKTDFYDAEKLENMVDKAKEYEYNVLRELVTLYLFLKDMEVKQKNRLKR
FT                   ALFLVSDNDKINKERLERLASGDFAQEVLYQLEYTPIVLEEVKILAKALFETQEKLKEV
FT                   KEMIESQVPEDHVLLTIPGVGKLAAGIIIGVVGDIRRFPKPESFVAYCGLDPVVERSGK
FT                   AVVSKGISRRGNKYLHSLFYFLAQMNCSKNPTLLRFYEYHKDKLHGRKLYTALARKLAK
FT                   VVWSVWYNNKPYEPK"
FT   gene            212147..213205
FT                   /locus_tag="YN1551_0240"
FT   CDS_pept        212147..213205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0240"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47424"
FT                   /db_xref="GOA:C3NKE4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKE4"
FT                   /protein_id="ACP47424.1"
FT                   /translation="MVTPGLPHQNNIQQIGYKLLSMLNFKGKKGEEVARTLISACLWND
FT                   SVESKSRAYGVSPQTVRNYVEEQGVEVIEKLLESARKISLKVLKGVKEIDVSIDWTTKT
FT                   WYGRPVGGLGSSEEGNSWNYATATTKFNGKVLLLAFITQVKGMTKEEIVKALVEQVVAM
FT                   GFKIRLITLDAGFYTVDVLNFISQFKYIVAVPVGDVKVYEEFDGDYTTNSKRHRRDEQV
FT                   KFRLLVYSKEKVRRKKKSLVYFARATNLDLSKREVLDLYNKVRGPIETSYRNIKAFLPF
FT                   TSSTKFVFRTLIFVLAVAFYSLYTVFKGEVRREQFRILLILLFSDDLFYLKDFLFKSIE
FT                   PLINNIDLFSRR"
FT   gene            complement(213239..213574)
FT                   /locus_tag="YN1551_0241"
FT   CDS_pept        complement(213239..213574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47425"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKE5"
FT                   /protein_id="ACP47425.1"
FT                   /translation="MIYRQKFIGQNTAHIIPGEEYVSIYVEYSLNGVNWQPCTFSLKKG
FT                   VYEIHAKDKYNRTTEILLVEKKFVKAKKIKKKYIGSESFDWTATFIDIYYRLLIKDPSK
FT                   IRYLKRN"
FT   gene            complement(213739..213954)
FT                   /locus_tag="YN1551_3248"
FT   CDS_pept        complement(213739..213954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_3248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47426"
FT                   /db_xref="GOA:C3NJU1"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJU1"
FT                   /protein_id="ACP47426.1"
FT                   /translation="MFSMSLCCFSPYLFISFSLVILGFIRSLVLRGLPRRSFLGQVVEA
FT                   KLKFWAYAWMVHLANSLVGRAPGIRV"
FT   gene            214141..215301
FT                   /locus_tag="YN1551_0242"
FT   CDS_pept        214141..215301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0242"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47427"
FT                   /db_xref="GOA:C3NFN0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3NFN0"
FT                   /protein_id="ACP47427.1"
FT                   /translation="MELKVTNKAFAIDISQSKLTAAKGELVVEQEKSAVYVKEVKEFNH
FT                   DNEGIEELIKFLGEYKEGIIEATGIYYFYLHEKLTEKGYKVTVINPLHLTEILGKKTDK
FT                   LDAQRLLVAHMTGVIKGSYIPTGEIMELRELTRYRESLVEKTTQVKNEIRKILEFAGYK
FT                   IQPFDKKGRKLLEKLVKGEGLSKEEKEELKEKLGRNLNDAEKLALKQLVELLKNLEKMI
FT                   KEVEDMIISKIPKPVIELSKIPGIGLISAATIYAEFGDVSRFSSSKAARAYASFAPKTK
FT                   QSGDSESHSGMIRGNKYLRRALYLVAKVARGLEPFKGYYERLIARGKSVTQATCALAGK
FT                   LASICYHVIKDGVYKGVVKKSFRIPRGKEVNVKDFDVGDALDSLSP"
FT   gene            complement(215454..216074)
FT                   /pseudo
FT                   /locus_tag="YN1551_0243"
FT   gene            complement(216164..216340)
FT                   /locus_tag="YN1551_0244"
FT   CDS_pept        complement(216164..216340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47428"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKE8"
FT                   /protein_id="ACP47428.1"
FT                   /translation="MMFFSRKQNDIEMIGDNNETIKLNTINGTVNAKKILSVNGKHLVF
FT                   VDQYGNVKEALLK"
FT   gene            complement(216456..217253)
FT                   /pseudo
FT                   /locus_tag="YN1551_0245"
FT   gene            217251..218347
FT                   /pseudo
FT                   /locus_tag="YN1551_0246"
FT   gene            218344..219123
FT                   /pseudo
FT                   /locus_tag="YN1551_0247"
FT   gene            219160..220134
FT                   /locus_tag="YN1551_0248"
FT   CDS_pept        219160..220134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0248"
FT                   /product="Rieske iron-sulfur protein SoxL2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47429"
FT                   /db_xref="GOA:C3NKE9"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017586"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKE9"
FT                   /protein_id="ACP47429.1"
FT                   /translation="MIRFKSDKEDKPILDYSNLTFIRKLTSKMRDPKTKFDTKEFVNKG
FT                   EDYLFNYTNKNVGSVDEKRRKFLKSLIFGIAAAAVVGVIPGLKVLVPPTVTVTTGFPKS
FT                   LLVDSSGNPIKASQIPVNSPFIVIFEYPMTGEPNFLINLGDSSGKPVEIPSTTVEVPQN
FT                   GKTYTFPGGVGPNKSIVAYSAICQHLGCTPPYIHFFPPQYVGPSQLTASEPDQLTAAAL
FT                   LAAKQAKVPALIHCDCHGSTYDPYHGASVLTGPTVRPLPAVILEWDSSTDYLYAIGAVG
FT                   VATYPNGSNGVPTDNPTDDLSSSFGSSVSDKTTVQETENPFSS"
FT   gene            220180..221790
FT                   /locus_tag="YN1551_0249"
FT   CDS_pept        220180..221790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0249"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47430"
FT                   /db_xref="GOA:C3NKF0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKF0"
FT                   /protein_id="ACP47430.1"
FT                   /translation="MRSKLSDWFKERLGLDDLPFFKTPDYMYKVDYWLGALVASAFIYT
FT                   VITGLILLLYYNAQAGYNSTEFVINSVPYGSVVLYSHLYGAYAMIILAYVHMFRNYFAG
FT                   AYKKPRELLWIIGVIMLILTLGTAFLGYSLIGDALATSAVDVGEGIISSIPGLSIFIPL
FT                   LFGNYDAGDYGRVLAWHIIFTALIGLLFVFHFFMAEHYGMMPSRKVKDKVPAVYTKEEW
FT                   QKFNPWWPRNFVYMMSLIFLSWGFILIIPNALAYINGLPQQLNPFLNPKPAPPPNSPAA
FT                   AHITTYPPWFFLFLYKIADFTSDVVIFLFIGVIIPLIYLIIVPFLDRIEYLHPLKRKVF
FT                   VGIGILMLTYLIQTTIWGDLTPGVEIPVSQQVLVYLPPAIIVALGLAAIKPKTDNKGNI
FT                   KGTISPITALAFVLVSSLFVIAGIELLANPTILTVGVFISLAGIFILTTKKIAPIALKA
FT                   EQRSENMTISEERVPEWKKKLAEGLVAVLFIYAIILAAQIWTIPATGYFSNLFGIDLGL
FT                   IFLMLGEGISLYHYVVYRK"
FT   gene            221803..222096
FT                   /locus_tag="YN1551_0250"
FT   CDS_pept        221803..222096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0250"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47431"
FT                   /db_xref="GOA:C3NKF1"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKF1"
FT                   /protein_id="ACP47431.1"
FT                   /translation="MINVGFYYKVKIGFEKDFEDKFREVLSYLRANADGFIDAKLYKSV
FT                   DEPSEYLIYSVWRDLDSFKKFISSDAYRSTVNYGKSIIESRPTHRILQEINE"
FT   gene            222214..222492
FT                   /locus_tag="YN1551_0251"
FT   CDS_pept        222214..222492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47432"
FT                   /db_xref="GOA:C3NKF2"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKF2"
FT                   /protein_id="ACP47432.1"
FT                   /translation="MAEIDKILKNLSMGELKFWVDGVYCNNCVNRIHRALKTISGVEDV
FT                   EVKPNFKELRALVILKYRGEVSKKDIEEVLSEASDETPYHEYKPIWE"
FT   gene            complement(222837..223721)
FT                   /locus_tag="YN1551_0252"
FT   CDS_pept        complement(222837..223721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0252"
FT                   /product="protein of unknown function DUF929"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47433"
FT                   /db_xref="GOA:C3NKF3"
FT                   /db_xref="InterPro:IPR009272"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKF3"
FT                   /protein_id="ACP47433.1"
FT                   /translation="MRRQTLRYIYFTIVIVAIIVIAGSVLLQLRSTSSPLIGQSISNDV
FT                   YNQLLEISNQGYNISALPTNYFKVLPLNFSSNGKPAIIYVGAEWCPYCAAERWALIIAL
FT                   LRFGNFSNLEYMLSSSTDVYPNTPTFTFANSTYSSTYISFYGIEYQDRNYQPLDKVPTQ
FT                   IYNMWEEYGNLSIPFIITEYYYKVGTSIDPGLISGHNWTYVLEQLQNPNSLVYKEIYSE
FT                   ANLITEMICKVDGYKPYNVCSHFMQDSSNSSPLYLVPSLPSQRRDSSVSSSLIPPLIRE
FT                   YISHFVSSQKAPT"
FT   gene            223822..224904
FT                   /locus_tag="YN1551_0253"
FT   CDS_pept        223822..224904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47434"
FT                   /db_xref="GOA:C3NKF4"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKF4"
FT                   /protein_id="ACP47434.1"
FT                   /translation="MKKEPRAVSNAVFAGVVIVLVIIAAIGFVLYATKPSTISTTSPPT
FT                   TSTTTLTVTQTSTQTTTATATMTATVTQTATQTTTTTQVVTRPVTVNASGSFLDGKVIT
FT                   FLYTSQFMCTPNATVFFPNAVNQSKVAMGCEVGAGNISAFPKGAEPVFVLVPAFAGLSI
FT                   FGVQSLGATPQGFPTFHYNGQNYTIITQCGAALTQTACPDHMTLIYSPAFTVVEQYLGI
FT                   KNGVFGLPEGVLPTPAHDHIVTFATNTSIPWYIVVVLVFNPNIFPNPITGQCQQIVPSN
FT                   QTNPTGLCLNSINALEQAMGTYDSAVATANANNPIWQALGKPELDVVVPGISSPSQLLT
FT                   ATNSNMLLFFSDPAVYPYPI"
FT   sig_peptide     223822..223920
FT                   /locus_tag="YN1551_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.658) with cleavage site probability 0.592 at
FT                   residue 33"
FT   gene            224924..226342
FT                   /locus_tag="YN1551_0254"
FT   CDS_pept        224924..226342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47435"
FT                   /db_xref="GOA:C3NKF5"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKF5"
FT                   /protein_id="ACP47435.1"
FT                   /translation="MNIKVTIFNYILDRSYIFLLFILFISLIFPIVSAFISLIFVGLLF
FT                   QGIYLRRQSSANSPYIVLEILSMLLLIYTVQFFVYLLKITDIVPLSYSVVIFLSLYRLK
FT                   RGIKKKTNYLQNSKIAFALLLLAFLLSWFISGFLDLSQGNFSVFGQFGYFSYPFLAFMN
FT                   FISAFASVTASPWFMIDMGIWLGVIGIFRIIEYNKIENKIRYLLMMFAYAFYSIYLPTF
FT                   SPISSEVKYIPYMWFNGLGTYGPVKSSYLLDGIIGTFTVTAILSFMFGSRQICSVTCTA
FT                   PYMLQGTFLNSMKKYNRSSKVGRNTLTSRISSWYKWIITITWISLLILAILSYLKFSIL
FT                   GNDPTMLYTSLYFNVIWYFQFMLMPFLGNYACVNNGICAWGSFNQFFGYLGLFKLKVRD
FT                   PKKCLTCKTVDCAYACPVGLTDMRASFIKKGEFKSFKCIGVGDCVEVCPYNNITFYDAR
FT                   SWIKEKLHSINFNL"
FT   sig_peptide     224924..225028
FT                   /locus_tag="YN1551_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.816 at
FT                   residue 35"
FT   gene            complement(226538..227065)
FT                   /locus_tag="YN1551_0255"
FT   CDS_pept        complement(226538..227065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47436"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKF6"
FT                   /protein_id="ACP47436.1"
FT                   /translation="MVYACCESTFETEIDFKKHIRSRNWHRINHSDSLNLRIRNDILYN
FT                   ILRSPNLLFGISNVIVPMGDKAILYLPLSKDKMGLVLKRSIVGKLEGPKLNIDLIEYKF
FT                   TADKLIYNFGFKIKKINEENSQLVILSSMMVNIGFLGRLLPSAVIKELQKMITPQVFVD
FT                   KYLSKNISSLSI"
FT   gene            complement(227144..227914)
FT                   /locus_tag="YN1551_0256"
FT   CDS_pept        complement(227144..227914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0256"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47437"
FT                   /db_xref="GOA:C3NKF7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKF7"
FT                   /protein_id="ACP47437.1"
FT                   /translation="MDIIDKRILFYLLKDGRISQRRIASLLNLTPASLNYRFKKLMDSG
FT                   ILKGFKLYVNPNFFGKYQIFIAFKNYTDIDADWISFKLKCLEWLNVYGIYASDNTELKD
FT                   KIGYMTKELGEPILSYFPLQSLFRASNLDQKIVEILKVDPRLSSSEISKKMNISSRIIE
FT                   KHIRYLRHRGLILVAPQIDLGKTDIIIFSIFSKNIDEITVVLQECKLWQFTDGYAGITV
FT                   CYADNMERARKYIDLARQIDSTADVMIIYDYMFQ"
FT   gene            complement(227922..228125)
FT                   /locus_tag="YN1551_0257"
FT   CDS_pept        complement(227922..228125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0257"
FT                   /product="Protein of unknown function DUF1059"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47438"
FT                   /db_xref="InterPro:IPR009409"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKF8"
FT                   /protein_id="ACP47438.1"
FT                   /translation="MVFGIGKKKKFAFSCGSVGMDCGFEVKGASSEEEILEILKIHAKN
FT                   VHHMKEISDDMKNKIKQSIKKV"
FT   gene            228221..228580
FT                   /locus_tag="YN1551_0258"
FT   CDS_pept        228221..228580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0258"
FT                   /product="Protein of unknown function DUF1059"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47439"
FT                   /db_xref="InterPro:IPR009409"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKF9"
FT                   /protein_id="ACP47439.1"
FT                   /translation="MPKYTFKCEDVGMDCGFEVKNAGSEDELLEMLKIHAKSSHGVTSI
FT                   PPDLLNKIKQNIKKVGKYYFSCASVGMNCGFEIMGAQSEQELLEELMVHAKMSHGMSSI
FT                   PQDTLNKIKQNIKEM"
FT   gene            228929..229081
FT                   /locus_tag="YN1551_3249"
FT   CDS_pept        228929..229081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_3249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_3249"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47440"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKG0"
FT                   /protein_id="ACP47440.1"
FT                   /translation="MNWENQRDYTKIRVLVYLGITEEEKKIFNIRFSDVRVKKYAIALN
FT                   KSIEK"
FT   gene            229118..229282
FT                   /locus_tag="YN1551_0259"
FT   CDS_pept        229118..229282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47441"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKG1"
FT                   /protein_id="ACP47441.1"
FT                   /translation="MAVMNGRKNVVEVLIFKKEVEADPRFNVIGEVSLEDIDMLDHIGE
FT                   GIDVKLIPI"
FT   gene            complement(229535..229798)
FT                   /pseudo
FT                   /locus_tag="YN1551_0260"
FT   gene            230043..231563
FT                   /locus_tag="YN1551_0261"
FT   CDS_pept        230043..231563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0261"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47442"
FT                   /db_xref="GOA:C3NKG2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKG2"
FT                   /protein_id="ACP47442.1"
FT                   /translation="MDSTIMDYNLNIKSIFWRIEKLYKDKEIISRTHEGIVRYTYSDFA
FT                   LRVRKLASLLKANSIASETVASIAWNTHRHLELYFAVPLLGGVLHTVNVRFHESEMDYV
FT                   VKAIGDRAVFMDKDITYKNSTLPTFIFDERYDEDINSQEPTRNFPDVDERQGAIACFTS
FT                   GTTGKPKGVVYSHRSIFIHSLSLLAADVLGISSSETVMPIVPMFHISAWDLPFASLMTG
FT                   AKLVLPGPRPKAEDIVKLIKEFKVTVGAGAPTVWIDVVNYVERENLDLPLKVVVTGGAE
FT                   PPLGLIKKLKELGVKTYHAWGMTETEAIATVNKSDNIERISEQGYPIPAFEVTLMDPEG
FT                   NELPWDGKSTGELVTRGAFVTKRYLNDKSDTQIRWFRTGDVARINPDGSVKVVDRLKDL
FT                   IKSGGEWISSVDLENAIMTYEKVLEAVVVGVKDEKWGERPIALVVKKPGRDVSEHEIIE
FT                   YLKSLNKFPKWWLPDKIIFVDSIPKTSTGKLDKKLVRDQLRSMIESSK"
FT   gene            231603..232559
FT                   /locus_tag="YN1551_0262"
FT   CDS_pept        231603..232559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0262"
FT                   /product="Acetamidase/Formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47443"
FT                   /db_xref="GOA:C3NKG3"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKG3"
FT                   /protein_id="ACP47443.1"
FT                   /translation="MQYTIHAITHNKWDNSLPPITTISDGDIITVETKEASDGQVTPSS
FT                   TEKDLLKLDFSKIHPLTGPIEVKGAEPGDALEIEFLDFRHKGWGWTGVLPGFGFLADEQ
FT                   YTGPIDLQGPALKIWKVDERYAYAKFGDLNVKVPIYPFPGVIGTALPYRGKLSTIPPRE
FT                   NGGNMDIKHLTIGTKLYLPVFVSGALLSIGDTHLAQGDGEVCGTAIEAPMEVTMKVRLI
FT                   KNVGLTQPLFVAKKVKEMEYDEYIAYPGIDPNLWNAAKKAIKGIISMLSKHMAPVEAYI
FT                   LTSVAVNLRVSEVVDVPNWIVTAYLPKNIFDTNVDVF"
FT   gene            232645..232972
FT                   /pseudo
FT                   /locus_tag="YN1551_0263"
FT   gene            complement(233034..233828)
FT                   /locus_tag="YN1551_0264"
FT   CDS_pept        complement(233034..233828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47444"
FT                   /db_xref="GOA:C3NKG4"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKG4"
FT                   /protein_id="ACP47444.1"
FT                   /translation="MKLYIILVAVIAVILIVSGIVILIHNVSQQQTNLTKVVFPDQNQI
FT                   SSILGNGWNITGLFEENYSSAVNRQYPGGTALFQEYIQKGNQTITLNVIQLNSSTTTLK
FT                   GVKIGKYLVSANITGNSSKFDLSSIENLEIETLKSGNGLKPELNQLLFPANSSVSLLEF
FT                   GNAITKNYTLYFETIMYNNSYISIDLANSSNISSLFTYLLRSTGQNVTVSTINGVKYFN
FT                   LSFVSQYGSVYYFVGIKDNYLIFMQSQMPQAFQFFVEISNKV"
FT   sig_peptide     complement(233739..233828)
FT                   /locus_tag="YN1551_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.401 at
FT                   residue 30"
FT   gene            complement(234228..234710)
FT                   /locus_tag="YN1551_0265"
FT   CDS_pept        complement(234228..234710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0265"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47445"
FT                   /db_xref="GOA:C3NKG5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKG5"
FT                   /protein_id="ACP47445.1"
FT                   /translation="MSEQIKIRKAAKEDWEKIYQLYNSLSDEDLYLRFFHLYRITEEDA
FT                   KRIASNEDHVTFLAEVDGKVVGEASLHKDGEFSLVVDRNYRALGIGTLLVKTLIEEAKK
FT                   CGLSAIKFYTLPENTPMIKIGRKLGFKLRFYEDEVYGEMKLMEKEVNINLATSSSP"
FT   gene            complement(234835..235140)
FT                   /locus_tag="YN1551_0266"
FT   CDS_pept        complement(234835..235140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47446"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKG6"
FT                   /protein_id="ACP47446.1"
FT                   /translation="MLPLLRYCYINILMNRELTVKFEDDTETFYLINDNGLIVKMNRII
FT                   PKKIDILIVRQTDRNKVLDAVKMGYKLFECNGISREDCLVKVLNTVFPNCKTCKFM"
FT   gene            235478..237376
FT                   /locus_tag="YN1551_0267"
FT   CDS_pept        235478..237376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0267"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47447"
FT                   /db_xref="GOA:C3NKG7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKG7"
FT                   /protein_id="ACP47447.1"
FT                   /translation="MRISWMIGGAQGSGVDTSANIFGNAVAASGYYIYGNREYYSNIKG
FT                   RHSYFNLTISDKPPRSIAQQVEILTSFDAETIFQHFNEVKDVLIYSTEVESTKAEQVQS
FT                   MEPEITEHVIKFLKEKGYGTTVRDVINYLKKEKGVKVIPIDYMEILKKVADQAKVQLSV
FT                   ADRARNTIAIAASYKLLGLREQYLLNSITRTFRQEVFAKINTIASQLAMQPIQPMYNLP
FT                   ELPNNEEKINLDGNTAAAIGKIYGGLRFQSYYPITPASDESVFIEAHQTVFTVDPKTGE
FT                   KRKSTIVVVQAEDELAAINMASGAALTGVRAATATSGPGFSLMVEGMGWAGMNEVPVVI
FT                   TYYIRGGPSTGQPTRTSQADLMFALNAGHGEFPRIVIASGDHVEAFHDGTWALNLAQKY
FT                   QTPVIHLVDKALANSYSIIPKKQLGMENIRVEKGKIVINSSTPELKRFEITEDGISPFA
FT                   PLGTTRIHYTGDEHDEYGFIAEASENREKMYEKRIKKLFTADKEIPEENRVNIFGNTDS
FT                   KIAIITWGSPKGAILDAMEELESEGIKPMLIQIRMFSPFPKNLMKKLLSGREFIIDVES
FT                   NYFGQAGEVLKLNTEIEPTHHILKWNGRPMMRDEVKEAIKAVVQKGERKVVLHGGA"
FT   gene            237363..238280
FT                   /locus_tag="YN1551_0268"
FT   CDS_pept        237363..238280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0268"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47448"
FT                   /db_xref="GOA:C3NKG8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKG8"
FT                   /protein_id="ACP47448.1"
FT                   /translation="MAALKVEWNDWCPGCGNFGILSAEQQAIQELGLDPKKVVLVSGIG
FT                   CSGKIPHFIRLPVSGVHTLHGRALTFAIGVKLANPSLEVIVNGGDGDQLGIGVGHFVSA
FT                   GRRNVDLTVIVHNNGVYGLTKGQASPTLKLGVKTKSLPKPNINSDVNPIALAISAGYTF
FT                   VARGYAYDVKHLKEIIKKAIKHKGLAMIDVLQPCPTYNDIHTKEYYDKRVYKLDDDPGW
FT                   DPVVKKPEEAEDKMSKAILKSTEWGNRIPIGVFYQNELVSTYEQRIAERSPSYLDNPPA
FT                   HDVIEFEGKPTTDIEDILKERRVV"
FT   gene            complement(238580..239509)
FT                   /locus_tag="YN1551_0269"
FT   CDS_pept        complement(238580..239509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0269"
FT                   /product="Transposase, ISC1234/ST1916"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47449"
FT                   /db_xref="GOA:C3NFA5"
FT                   /db_xref="UniProtKB/TrEMBL:C3NFA5"
FT                   /protein_id="ACP47449.1"
FT                   /translation="MKPWIEYYNLPVPYDKLSSRHKTLLKMHYILITSKALSSLDLYIL
FT                   RVLIVMMIWQCSYRDVEAYYYTDIVVRWFLGERKSKSENHRRAKKLRGEIKKAFKEYAK
FT                   ELEEKLSKLENYLPSSALYGKVNKLWAIDSNIIEVPFGKRNKETLKKKLELNLRQGKFR
FT                   EAANLIYYYMRAKIHRRFKGEFAKKRGRSFFGFKVLYAISPTMILHAIQVEFANFPDNK
FT                   VGFGMSGYKVVDRGFLGMPSTWIIGFSSFRRYVEFFGIFLKRYWRPYAINKDMVEVFVY
FT                   VIGIIYNSLIYTSVLAKVPQEEFVKLSS"
FT   gene            239749..241581
FT                   /locus_tag="YN1551_0270"
FT   CDS_pept        239749..241581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0270"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47450"
FT                   /db_xref="GOA:C3NKH0"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKH0"
FT                   /protein_id="ACP47450.1"
FT                   /translation="MPELKVVVSIKQVPDVDELRIDPVTNNLVREGVPAVINPPDLHAI
FT                   EEAVRLKERYGAKTIVITMGPPQADSALREALAMGIDEAYLISDRAMAGADTWATSYTV
FT                   SKAVQKLGGADLILFGRRAVDGETEQVGPQTGKWLGLPVIGYVSEIKKLEKDKIIVTRT
FT                   TEFDEEVIEAPIPTVLTMLEVANKPRQPDILSLIKAKTAKITVWNKDDIKAEPDKIGLA
FT                   GSPTKVIKVQPPPKTRKAEIIDGRKDIEKAAKWFLDKIFESLKEDESTLKEYVKPKPKV
FT                   KVNGEIWVYIDHIGEKPNRASFEIMGEARRIADLMDTSLSAVIVGGEATKSLIDETFEY
FT                   GADKVYFVETKGFDRYDNEVYTRALATVIKKYKPEAVFFPGTKNTRELASTTAIEVNTG
FT                   LIADCTNFDVDDKGVLLSTRPDFGGKEMSTIICPKHRPVMVTVRAGVFMPLPRVQGRKG
FT                   ELVREEIDDLFTRLKVLDYRVIEKRNILAEADIVVGVGRGIRSPENIKMAEELASLLGG
FT                   VVGVSKPLADMGWYPKERQVGQTGTTIRPKVYIALGVSGAVQHLVGILSSRKIGAINLD
FT                   PSAPIFENCDFGVVGDIFEIVPKMVELLKKKEVS"
FT   gene            241584..242771
FT                   /locus_tag="YN1551_0271"
FT   CDS_pept        241584..242771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0271"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47451"
FT                   /db_xref="GOA:C3NKH1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKH1"
FT                   /protein_id="ACP47451.1"
FT                   /translation="MKFDIVVVGAGPAGSSAAITAARGGAKVLLLERGPEPGSKNVSGA
FT                   MIRLEDFSSVYDIASIPIERKVKNVDLILLSNSNRTRISVNVESNLATVARLKLDKWMA
FT                   QQAEKAGALLITKTTVLGVEREGNEYKVETDRGEVRADRVVLAEGVNALVSMKANIRPD
FT                   LTPDHAVQTVKEVYSLNKDEVNKRFGFKADDEGVSWRILGIDPVPYAGFLYVYKDAVAI
FT                   GAGIPMKILIKRKITPYTVLDEVKERLGFNELVKGASLREYSAKVIPEYGFPSWKACSG
FT                   KIYLAGDAIGLVDPLTFNGIGPAVASGVVAGKAALESYECSKYESELMKNREVRRVVNG
FT                   RPLVKELIEEENFKYYVKTINDLLHGWVYSDFSKVKLDTSKLLKHLLLGMGVFKS"
FT   sig_peptide     241584..241646
FT                   /locus_tag="YN1551_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.265 at
FT                   residue 21"
FT   gene            242768..243055
FT                   /locus_tag="YN1551_0272"
FT   CDS_pept        242768..243055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0272"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47452"
FT                   /db_xref="GOA:C3NKH2"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKH2"
FT                   /protein_id="ACP47452.1"
FT                   /translation="MRVEEKLYTLRYKKDEQPHLAIIDPNKCLKCEEVNGVPQPCIAVC
FT                   PANVYSWIDKRIVVSYENCVECGACRIACPYSNISWKYPRYGLGIALRYG"
FT   gene            243289..244263
FT                   /locus_tag="YN1551_0273"
FT   CDS_pept        243289..244263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0273"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47453"
FT                   /db_xref="GOA:C3NKH3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKH3"
FT                   /protein_id="ACP47453.1"
FT                   /translation="MLNFQGEKVEKVAKTLISACLWNNSVENKSRAYDVSPQTVRNYVE
FT                   KQWMEVIEKLLERARKISLEILKGVKEIDLSIDRTTKTWYGKPVKGRSEKGNSWNYATT
FT                   KYKGKVLLLAFIPQVNGMTKDEIVKVLVEQVMAMGFKIRLITLDAGFYTVDVLNFISQF
FT                   KYIIAVPVGDVKVYEEFDGDYTTNSKRHRRDEQVKFRLLVYSKEEVRRKSLVYFAGATN
FT                   LDLSKREVLDLYNKVRGPIETSYRNIKAFLPFTGSTKFVFRTLIFVLALVLYSLYTIFK
FT                   GEVGREEFRLLLILLFPDLFNPENFTFNLVETLIYTIDLFSRR"
FT   gene            244260..244652
FT                   /pseudo
FT                   /locus_tag="YN1551_0274"
FT   gene            complement(244681..244809)
FT                   /locus_tag="YN1551_3250"
FT   CDS_pept        complement(244681..244809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_3250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_3250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47454"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKH4"
FT                   /protein_id="ACP47454.1"
FT                   /translation="MRRSAYPVAPRFKSPLKGIKIADKGFSPSPTQLIAMERGYWV"
FT   gene            complement(244772..245167)
FT                   /locus_tag="YN1551_0275"
FT   CDS_pept        complement(244772..245167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0275"
FT                   /product="Transposase, ISC1234/ST1916"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47455"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKH5"
FT                   /protein_id="ACP47455.1"
FT                   /translation="MGGESSTMARTLRRIPNLVYYSLPPREDMPWREKWLTDIKPVLDT
FT                   LDLERVLREGTLVYLKLLIVMVLYSCSYRDAVKMVNVNVVVAWFVGRKVGKSTLHDFVG
FT                   RVYEVRKKLLEISFKLEEKCLPSSPEI"
FT   gene            245324..245593
FT                   /locus_tag="YN1551_0276"
FT   CDS_pept        245324..245593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0276"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47456"
FT                   /db_xref="GOA:C3NKH6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKH6"
FT                   /protein_id="ACP47456.1"
FT                   /translation="MTLKVEVGKKGYIIIPKDIRDLLGIKEGDKLILNVYDGKIILEPE
FT                   RKVDINEILKRLEGHHAKISAYAKSAKLGDLLYSSLEEEFDDFS"
FT   gene            245580..245969
FT                   /locus_tag="YN1551_0277"
FT   CDS_pept        245580..245969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0277"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47457"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKH7"
FT                   /protein_id="ACP47457.1"
FT                   /translation="MIFLDANFIIYLNLGVKEVENFYIKVLQEDRLALDPLVIDEVIYI
FT                   SKKKYNVNFNDTISFLDEIVLPNSLILPIRKEDYDKAKEIMLQYNLKPSDAFHVAVMLN
FT                   NSISKIISEDKDFDRTKEIHRVWIT"
FT   gene            complement(246073..246411)
FT                   /pseudo
FT                   /locus_tag="YN1551_0278"
FT   gene            complement(246241..246345)
FT                   /locus_tag="YN1551_3229"
FT   CDS_pept        complement(246241..246345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_3229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_3229"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47458"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKH8"
FT                   /protein_id="ACP47458.1"
FT                   /translation="MGGKVIKGPYGQEVGVQEVSLIDEFKELFGTEKN"
FT   gene            complement(246911..247294)
FT                   /locus_tag="YN1551_0279"
FT   CDS_pept        complement(246911..247294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0279"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47459"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKH9"
FT                   /protein_id="ACP47459.1"
FT                   /translation="MKVVLDASTLILYFYGNKKAKEIIEKNMNEAFVNSVNLTEFLYSY
FT                   AKVKGWKESLLKYSLIRNTFELIDVNDEDIIKSTAKLKIKYNLSLGDAFLLASAKSINS
FT                   TAVTSDHELSKVKEVKVILIPKE"
FT   gene            complement(247278..247508)
FT                   /locus_tag="YN1551_0280"
FT   CDS_pept        complement(247278..247508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0280"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47460"
FT                   /db_xref="GOA:C3NKI0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKI0"
FT                   /protein_id="ACP47460.1"
FT                   /translation="MYRLKVYKKGIIVIPKEIREKFNLKEGDEVNVIVDDDGIYIFPRD
FT                   DIRKYFGSDKDAIKALDILEEERRRERESST"
FT   gene            248088..249239
FT                   /locus_tag="YN1551_0281"
FT   CDS_pept        248088..249239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0281"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47461"
FT                   /db_xref="GOA:C3NKI1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKI1"
FT                   /protein_id="ACP47461.1"
FT                   /translation="MERKIKPKVFAIDVGESRLVATKMEINNNTVKEADTREFKYNEEG
FT                   LKELIKFLEGYEEGIMEATGVYFYHVYNVLRDKGLKVNVINPVQTVEVLGKKTDKNDSI
FT                   RLAIAYAAGTVKGSYIPTGEMQELREMTRHREGLVERKTQVKNEIRKVLETAGYKLPPF
FT                   EKKTKEIVRKLATDEKLTDEEIKEYSKLLGRKLTRIEAFILKQLLDLLNIIEEQIKEVE
FT                   NEIMKFLPEEAVELTKIPGIVPISAATIYAELGDVSRFESSKQAASYAGVSPRTKQSGK
FT                   TEFHNGLIKGNKHLSRVLFLVARSAKNTVQFNGFYQALLKRTGNSKKATLALANKICRI
FT                   VYHVLKDGEYKGETKKTRYRGGGGEGPQVDPNQVVPSALQAIA"
FT   gene            249434..250480
FT                   /pseudo
FT                   /locus_tag="YN1551_0282"
FT   gene            complement(250539..251477)
FT                   /locus_tag="YN1551_0283"
FT   CDS_pept        complement(250539..251477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0283"
FT                   /product="Pyruvate, water dikinase"
FT                   /EC_number="2.7.9.2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47462"
FT                   /db_xref="GOA:C3NKI2"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKI2"
FT                   /protein_id="ACP47462.1"
FT                   /translation="MNYTYLLEEVSLSMVSIVGRKSAYLGELYKMGFNVPKGFIVSSRG
FT                   VNEAIKDLDDEIRGILSSVNLNDTTDLEKKSEMIKNMIIMSKLPEEMEKEIYERFSQLG
FT                   SKYVAVRATATSPLSGASFAGEYETDLFVTKENLIPSIKRVIASYFNPRAIAYRILTHN
FT                   EAGMAIFVQTMINPVSAGTAFSIHPITEEPDYVFIESSFGLGESVTRGMVTPDQYIVSK
FT                   TTRSLVSKRISEKVMKLTYDFEDRKIKSVELSKEEASAESLSDNDAIRIANMVIAVENI
FT                   FKRNINIEWAMEDKKVYLLEVRGIRRLYPEF"
FT   gene            complement(251540..252307)
FT                   /locus_tag="YN1551_0284"
FT   CDS_pept        complement(251540..252307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0284"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47463"
FT                   /db_xref="GOA:C3NKI3"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKI3"
FT                   /protein_id="ACP47463.1"
FT                   /translation="MQVKRFNLVRVKENEEYKDSDFVAVEEPLNIRVCFEKCEDFAIIM
FT                   RTPGHDKELSLGFLYSEGVINSIHDVESIEQVKNNAVEVRLSKPVKVRIRDLIVNSSCG
FT                   VCGRAFLYTLNILKSDLKVKKELIFSFPEKLREKQSVFNISGGLHATALFDPHGELLLI
FT                   YEDVGRHNAVDKVVGKLLLEDKVPASNYIMQVSGRLGYEIVSKGIKAGIPIVCGISAPT
FT                   SLAIEIAEEAGLTLIGFLRGKSFNIYTHDERIY"
FT   gene            complement(252288..252644)
FT                   /locus_tag="YN1551_0285"
FT   CDS_pept        complement(252288..252644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0285"
FT                   /product="protein of unknown function DUF1641"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47464"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKI4"
FT                   /protein_id="ACP47464.1"
FT                   /translation="MEEGGVQTIDKLIEQLIESREAIESFLKLINALQKTGILPLLVGI
FT                   VNSLDHNLAFLAEQNAMLIRNVNVIYGVLSGKEEAKDISLTELIKQLNDPDVKRGLYLL
FT                   LKILKAIGSASKEV"
FT   gene            complement(252608..255547)
FT                   /locus_tag="YN1551_0286"
FT   CDS_pept        complement(252608..255547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0286"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47465"
FT                   /db_xref="GOA:C3NKI5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKI5"
FT                   /protein_id="ACP47465.1"
FT                   /translation="MIFMSIKIAIDNKEIVANEGETILSVLKRNGIYIPHICYNEGLVP
FT                   IESCDSCLIEVNGKLVRACSTRVKDGMNISVNSKRSMEARKNAISRILRYHKLYCSMCE
FT                   NNNGDCVLHESVIKLNINSQKYIEKPYQVDDSGPFYVYDPSQCILCGRCVEACQDFAVN
FT                   EVIWINWDLNPPRVVWDNGNPIGNSSCVNCGTCVTVCPVNALMEKSMVGEAGYLTWINN
FT                   DLKKKAIEAIGKAEDNFSLLMTFSEIEANARSSQIKKTKTVCIYCGVGCSFEVWTKGRK
FT                   ILKVEPKPESPANGILTCVKGKFGWDFVNSPERITKPLIREGDRFREASWDEAISYIAK
FT                   RLKEIKERYSPDSIGFIASDKMSNEEAYLLQKLSRAVIGTNNVDNSARYCQAPATIGLW
FT                   RTVGIGADSGTIKDIENANLIIIVGHNTTESHPVIGSKVKRAKKIKGSKIVVIDVRKHE
FT                   IAEKADLFIKPKPGTDAAVLAGVTKYLIDQGWVDKEFIDKKVNGFEEFKESIKGFTLDY
FT                   VESITGVPREKIVKLAEIVHNASSVAVLWGMGVTQHLGGADTSTIISDLLLITGNYGKP
FT                   GSGAFPMRGHNNVQGVSDFGCLPNYLPGYQKLEDENIIGKFEEAWGVKLNRKAGLQIPQ
FT                   MIEGVLEGKIHALYIVGEDTVMVDCGTPLTKQALEKVDFLVVQDMFMTETAKLADVILP
FT                   ATASLEKDGTFVNTERRIQRFYKAMEPMGDSKPDWEIIQMVANALGANWSYKHPAEIMD
FT                   EIAKLCPIFAGVSYSRLEGFNSLLWPVNEDGSDIPLLYTNAFATKDGKAILYPLTWKPP
FT                   ELKDEVHKVTVNTGRVLEHFHVGNMTRRVEGLRRKVPETFVEVSKELASKYSIKDGDLV
FT                   LVKSKFGGEIRARAIVSDRVEGEEIFIPLYASDPSKGVNNLTGLVIDKASGTPGYKDTP
FT                   VVIEKIEEGKGGSPLPLDNWRFHVNERRRQIGIEVEKKWKREEFKPLTS"
FT   gene            complement(255822..256298)
FT                   /locus_tag="YN1551_0287"
FT   CDS_pept        complement(255822..256298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47466"
FT                   /db_xref="GOA:C3NKI6"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKI6"
FT                   /protein_id="ACP47466.1"
FT                   /translation="MRKSNIGMIISAIIPSFSLIYQPVWILGLMIGSISSTKAFDPTFK
FT                   DSIYSPNFRKNTSIILLILSILEGISGFGAGPQTSNIISTLTFNLLNRGNSLELHLAII
FT                   IPLALFFILHTVSGFGSLLLSKGIKNPILFKYVIPLVWIIMYLVVVYLDLYYFL"
FT   gene            complement(256285..256914)
FT                   /locus_tag="YN1551_0288"
FT   CDS_pept        complement(256285..256914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0288"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47467"
FT                   /db_xref="GOA:C3NKI7"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKI7"
FT                   /protein_id="ACP47467.1"
FT                   /translation="MKLTNRRNFLKLLLISSSLLVLGRLSISEMQHAQNGLTPFGSWYV
FT                   VQYSQIVPDILLNNYVLTVDGDVENPVQLTYQNLLNMPSIEVKDTIQCVSDPYFLRANV
FT                   VWKGVPLSNIIEIVKPKPSVIKVVGYGADGYTADLPIEKANDPNVLVTYMADGKPLPQV
FT                   HGYPVRLSVPGWWGYTYIKWLVRLHFTSKNILGYWESLGYPDYAKK"
FT   sig_peptide     complement(256813..256914)
FT                   /locus_tag="YN1551_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.930 at
FT                   residue 34"
FT   gene            257000..258019
FT                   /locus_tag="YN1551_0289"
FT   CDS_pept        257000..258019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0289"
FT                   /product="TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47468"
FT                   /db_xref="GOA:C3NKI8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKI8"
FT                   /protein_id="ACP47468.1"
FT                   /translation="MDKGKIWNRIVIPILENLVAPYSVFKRIYIQIMLLGVAVLINAIV
FT                   FVNYQHLDWISAIYAGVNVVTTVGLYSPNIYQMTSTEKIILTLTIILAVGLYTSIIQSI
FT                   VATLISRVTWNDAKARWRGRHMKGHTILIGNGTEILSAVRRLNRLGVDYIVLTSSKDIA
FT                   NNNRGDAVILGDPKDDNNLISAGVNYAKNAIVIMENDMEALLITLKLQKLNPPLKVIVA
FT                   IRDYSLTDIFKTAGADLVIPREDIIGRIAASAALSINIAGLIFPERTGDMIIGIFEVKK
FT                   AKKISDLPSEVVPLAIIRNNKIDPYFNKDTELKPRDQLIILGSPSTFQKVRELLELPD"
FT   gene            258229..258513
FT                   /locus_tag="YN1551_0290"
FT   CDS_pept        258229..258513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47469"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKI9"
FT                   /protein_id="ACP47469.1"
FT                   /translation="MEIMLDILRSCDPECGVTRVIYGAGINYSVAQKYLDQLIKVGALS
FT                   IKTENGKKIYGITEKGKLLRMHIEEFIKIRENLNLAREKVIELLKTNFR"
FT   gene            complement(258525..258938)
FT                   /locus_tag="YN1551_0291"
FT   CDS_pept        complement(258525..258938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47470"
FT                   /db_xref="InterPro:IPR021578"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKJ0"
FT                   /protein_id="ACP47470.1"
FT                   /translation="MEWQKTIKTKHDADTIVKILADPEFFIPLVLPVRKFLLNSNKLYR
FT                   CEGAIGRLPVIFQGGEYIGSYNITHVIEFERPPGVSGKINIQAIEDKINITILLQNLYI
FT                   IYLPLRVYISNKLNELEETFDEKIRLERIKRKL"
FT   gene            complement(259059..259994)
FT                   /locus_tag="YN1551_0292"
FT   CDS_pept        complement(259059..259994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0292"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47471"
FT                   /db_xref="GOA:C3NKJ1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKJ1"
FT                   /protein_id="ACP47471.1"
FT                   /translation="MILVGLYSIIPGNTLITLITHDLKFYTMDYKPFIKILFTLVILAL
FT                   VDYLANVILKALTFYFPKIFTYTSDAFTAITVIIIAIGGFYIIRILQGLIYSQLLTKLE
FT                   KSTASSIKVALDIIFYTVLVLVILAALKVNLTGVLVGGAVGGIVIGLAVQTIAQNILSG
FT                   ILVTSSRTIRLNDSVSLISWIWGNPIIGEINKISLLFTEVKTINGNVIKIPNSAFLGNT
FT                   VFQKLESEHSLTYPYQLLVNADVPANDLLNLARAYINNSFSKMKIGLPEIYFTGKNGGT
FT                   NVFTVILHFNDINQLNNILSLVNEEFDKAY"
FT   gene            complement(260084..261712)
FT                   /locus_tag="YN1551_0293"
FT   CDS_pept        complement(260084..261712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47472"
FT                   /db_xref="GOA:C3NKJ2"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKJ2"
FT                   /protein_id="ACP47472.1"
FT                   /translation="MHPKGLVKKDDIIYLSVFVLVFLIALRNYMLSPPYTLGDTTILPP
FT                   TNPGLYTPSATIQYYLSLLMGENNLIKTLNFLAFLIAPISIYFTLGRKGDLFKRLILPL
FT                   IFTLNPISISIFYTGDGESILLVYSLQPLVYYLTHKMLYDVKNKFKYLIYLGIVEVIGQ
FT                   IFFFQMFLFSFFFQLPFILLSIKEKKYLFFLYPILADLLGFLSELSWEIYLYIGVVPNV
FT                   LISPSNTLVRLGLAYYSTIVSSLLFTIVITTAFIYKNKYALATITSVGLLLIIYAILQN
FT                   FQLNIPIISALLASITTFQTKVYLLSFGLLDLSLFYLKRTREFIIPLLSLLLIVLLVNT
FT                   GGLQATTYSIFSFKPQPMPTWYYELYDYLSQNNPNNVYSLATQYQCLQYLPGFSGFIYN
FT                   PSFIHNLTNPFYGMKYLISASQINYTGLRLVKTFGPVLVYYNENFTGLAHYLNGSSVRN
FT                   YSISDVEIRIYGDKPPFVVSLPYSGYWTNSKNYNGFLELTSNISQNSLTTLIHELFFVS
FT                   LFFLILPFILLIFEKTPMKSLIVGR"
FT   gene            complement(261919..263676)
FT                   /locus_tag="YN1551_0294"
FT   CDS_pept        complement(261919..263676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0294"
FT                   /product="AAA ATPase central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47473"
FT                   /db_xref="GOA:C3NKJ3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKJ3"
FT                   /protein_id="ACP47473.1"
FT                   /translation="MSTVSSNNSSILIGLSNNTIQLVLEIILTILFFLVPLIFWFYFSR
FT                   RMMIGNTTRSRRPKIYIPNIRWDEVYDLKEVKMRLEEIAKMVQDGRAYGVILFGPPGTG
FT                   KTTIAKALANKLGWAYFELRPSKILSKWYGESELLLDNFFDQVEMNTPAVVFIDELDSL
FT                   AMSRQSDLHEVTHRLVNIMLMRLQDLHDKSLRVIIIGATNVPQEIDEAFLRPGRFDEVI
FT                   YVALPDEKSREEIWRGYIKREDIDYSLLAKRSERFSPADIKNVVDKVLSKNNSPNTEDF
FT                   LREIGNYKPSIQLSTIIKFENVARKYERSKLIIKTYGVPNISWNDLGDLEEVKRIIRES
FT                   IVLPITSKEFAEKLGIYPVKGILLYGPPGTGKTSIAKALANDLRFNFIELSGEEVSSAG
FT                   PLDAPKIIAEKFYVALDNAPAIIFIDEIDMIARNRMANEWRNALTELLRQMDGLREIHN
FT                   VIVVGATNRPWDLDPAILRAGRFDKIIYVPPPDKDGREKILQVLIKDLIISKNIISKVA
FT                   ELTENYTPADLKLVVEEVKRNLLKEASISGNLRTEVKLEDFMNVLNRVKTSLDRQTLMM
FT                   YEKFGFERR"
FT   gene            263862..264563
FT                   /locus_tag="YN1551_0295"
FT   CDS_pept        263862..264563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0295"
FT                   /product="Creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47474"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKJ4"
FT                   /protein_id="ACP47474.1"
FT                   /translation="MKLIEITRDEIREDLVGLVPVGSIEQHGPHLPMGTDSIISENVAS
FT                   KAEEKLKETTLLFPTVYYGVSLEHKGFPFISLSFQTAISFFNDLLESIFKDLGLRRIII
FT                   VNGHGGNSYFLPLVQREFNMKYSNAKVMIFNIFGEEEKLLFNVNDLHAGTVETSKIYAI
FT                   DKRVVRLNKIEEIKSYDVRDGVFVYYSTKEANQFGVLNDGKPIRIDEELGKKILADTVN
FT                   KLIWLILNFKV"
FT   gene            264560..264943
FT                   /locus_tag="YN1551_0296"
FT   CDS_pept        264560..264943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47475"
FT                   /db_xref="InterPro:IPR012372"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKJ5"
FT                   /protein_id="ACP47475.1"
FT                   /translation="MIKYVRSRDGEDLLRDIVIILGLDYINLDRVRVVYSYGAKSKAIA
FT                   RIWAVPKIVIETFNLEPLYVIELVSERFDRLSNEDKIKVMIHEILHIPYKFSGGLRAHG
FT                   RKVNSREVNKLYKKYIKLKEKRI"
FT   gene            265401..265910
FT                   /locus_tag="YN1551_0297"
FT   CDS_pept        265401..265910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0297"
FT                   /product="PaREP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47476"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKJ6"
FT                   /protein_id="ACP47476.1"
FT                   /translation="MYEVLDYKADPRSYVYVKVMETLTEGKLALEMLKKGMITNASSKA
FT                   FITVKAMVSALVIKNFDKIVQSKSEKEKDWYERVGYSAPTTGLIGISYDLEKLGYDVQL
FT                   IVKTALLLHSFSYNGFDPNFVNYKDKGEVERDILTVVEFIKRNIKKYFEDIWDEKLEDK
FT                   LKELSY"
FT   gene            complement(265933..266196)
FT                   /pseudo
FT                   /locus_tag="YN1551_0298"
FT   gene            complement(266331..266546)
FT                   /locus_tag="YN1551_3251"
FT   CDS_pept        complement(266331..266546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_3251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_3251"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47477"
FT                   /db_xref="GOA:C3NJU1"
FT                   /db_xref="UniProtKB/TrEMBL:C3NJU1"
FT                   /protein_id="ACP47477.1"
FT                   /translation="MFSMSLCCFSPYLFISFSLVILGFIRSLVLRGLPRRSFLGQVVEA
FT                   KLKFWAYAWMVHLANSLVGRAPGIRV"
FT   gene            266733..267893
FT                   /locus_tag="YN1551_0299"
FT   CDS_pept        266733..267893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0299"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47478"
FT                   /db_xref="GOA:C3NFN0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3NFN0"
FT                   /protein_id="ACP47478.1"
FT                   /translation="MELKVTNKAFAIDISQSKLTAAKGELVVEQEKSAVYVKEVKEFNH
FT                   DNEGIEELIKFLGEYKEGIIEATGIYYFYLHEKLTEKGYKVTVINPLHLTEILGKKTDK
FT                   LDAQRLLVAHMTGVIKGSYIPTGEIMELRELTRYRESLVEKTTQVKNEIRKILEFAGYK
FT                   IQPFDKKGRKLLEKLVKGEGLSKEEKEELKEKLGRNLNDAEKLALKQLVELLKNLEKMI
FT                   KEVEDMIISKIPKPVIELSKIPGIGLISAATIYAEFGDVSRFSSSKAARAYASFAPKTK
FT                   QSGDSESHSGMIRGNKYLRRALYLVAKVARGLEPFKGYYERLIARGKSVTQATCALAGK
FT                   LASICYHVIKDGVYKGVVKKSFRIPRGKEVNVKDFDVGDALDSLSP"
FT   gene            complement(267882..268715)
FT                   /locus_tag="YN1551_0300"
FT   CDS_pept        complement(267882..268715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0300"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47479"
FT                   /db_xref="GOA:C3NKJ9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKJ9"
FT                   /protein_id="ACP47479.1"
FT                   /translation="MGKSKYKRDWSKYDENVITRYELMFPFYVFQHWWELLAEENRNAK
FT                   KTYKAPKEFNDFLAFLHLFLPYRAIEGVLRALERLKIIPTSLDYSTIWERVRNMNIKFP
FT                   EANDQLEVIADATGISTNKGGQYIIAKWGKTKDSKFLKIEIVMDKDQFNVINAEVTSNE
FT                   VQTAVKTVKDLQDKGKKVKKFYGDKAYDANEVYKTGVEVVVPPRENASTRRGHPARRKA
FT                   VREFKRLGYNRWREDKGYGVRWRIESLFSAVKRTFGESVRATRHYMLTPLTNLWG"
FT   gene            268054..269467
FT                   /pseudo
FT                   /locus_tag="YN1551_0301"
FT   gene            269464..270315
FT                   /locus_tag="YN1551_0302"
FT   CDS_pept        269464..270315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0302"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47480"
FT                   /db_xref="GOA:C3NKK0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKK0"
FT                   /protein_id="ACP47480.1"
FT                   /translation="MRPVIKASLHYLALAIISVIWLIPVYAMLINGFKSNFEVLSTPVL
FT                   VPPTKITFEAYASVLLSLAKPLINSLIIVIPTSFISAFLGAMGAYFFYTLSYSFSRASS
FT                   AISDVLFSLISLATFIPQEATLLPLTRLMVSMGFLDTYIGIIFALLIFYIPTGALLMSM
FT                   FITVIPRSLIEAAKMDGTGDLKIFMKIVFPLSMPGFISTLIFIIIQTWNNFFIPLVLVT
FT                   TPGMKPTSIAVLSYSGAYGTLYNDTFAAGMLASIIPLAIFVFLGRYFIRGLMALGGGGK
FT                   GV"
FT   sig_peptide     269464..269547
FT                   /locus_tag="YN1551_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.656) with cleavage site probability 0.628 at
FT                   residue 28"
FT   gene            270319..271379
FT                   /pseudo
FT                   /locus_tag="YN1551_0303"
FT   gene            complement(271411..272754)
FT                   /locus_tag="YN1551_0304"
FT   CDS_pept        complement(271411..272754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0304"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47481"
FT                   /db_xref="GOA:C3NKK1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKK1"
FT                   /protein_id="ACP47481.1"
FT                   /translation="MEPEKFTWDSGKAIISQFIGFLLDSYDLTMILSIAPVLAKVILPP
FT                   ASPLIATFNIILSYSLTIIFRPLGSAIFGNLGDKIGRRADLIITVLGLGITSALTSALP
FT                   TYAQAGILSFALFVLIRVAVGIFAGGEYSAGHPFAMEWTPYKWRGFVSGLVQGGFSFGA
FT                   ALAAVVEGIFIGIYGVSGVVEFAWRYVFLTAVIPAFIALAVRLAMKETPVFEDVKKKNL
FT                   IRRTPLVDLFKPPYRRDFFQVMAYMTGMFFFAYSLFAFVPTILEHSPSIFGLGEANYIY
FT                   SIGTYAAFAGAVMFGTLSQYVGRRRLTIIWSIITFIIAIPIYYGLITAAIAGNAITAML
FT                   FSIIIGIITQGPWGIIPIYLSERFKASMRASGVGFGYSSGIFIGGWFSIYVPLMHNYLF
FT                   KSLDTPNNIWFSTAVLLMIGALIVGIAQYFGPETLGTKLAEEPQKTIE"
FT   gene            272870..274000
FT                   /locus_tag="YN1551_0305"
FT   CDS_pept        272870..274000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0305"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47482"
FT                   /db_xref="GOA:C3NKK2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKK2"
FT                   /protein_id="ACP47482.1"
FT                   /translation="MKEINRIAIIGGVRSFSGSIIWPFIGFALYKVYGFSLDTISIFYL
FT                   IQALLNVIASIGGGIVVDYIGRRNAMVLSTIVSSLALFTAYLVNLPIPIAGLILLQTFF
FT                   NTIYNISSTAIVGDIYKRADLVKAFSRQRVGINAGWALGPLIGGYIFTFYGFKTLLLVS
FT                   SLIAIIPIPLVRLLPEFKGGGNILNFNVNNQFILFLISTFLTFVLVGQLGFGLLTYYNA
FT                   QLHFTEFQVSILFAINGIMIVALQDLVGRLISKRLWLIVIGTLIYASGYFGVAFITNFL
FT                   VASIDIVIITIAEMIVTPLSQAIANSLTNQSSRGRQIGLYSMVTGIGRVSGSSLIGELM
FT                   NYYLYTPVILWGIMSSFGLVSATIYLYQIKIKRIKI"
FT   gene            complement(274003..274419)
FT                   /locus_tag="YN1551_0306"
FT   CDS_pept        complement(274003..274419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47483"
FT                   /db_xref="GOA:C3NKK3"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKK3"
FT                   /protein_id="ACP47483.1"
FT                   /translation="MINRRGLTIMTVFSFIYAILELGIQWDPSKVLSSPAWMKSVFTPT
FT                   VSLYFYRVIYILIFGFPSYLASGKLLSVETVWYLIYGSIVEDIMYWIVDLKLPFSWAWF
FT                   YPVYFGIPIDDLIGVVILAAMYKLIKQKSKAGMS"
FT   gene            274453..274638
FT                   /locus_tag="YN1551_0307"
FT   CDS_pept        274453..274638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47484"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKK4"
FT                   /protein_id="ACP47484.1"
FT                   /translation="MLDKVREIVRKIDPNAEIQISRNKKFTKIRVKSNRYCDRAKIWIS
FT                   LYELFKDHEDIIIEVE"
FT   gene            complement(274619..275176)
FT                   /locus_tag="YN1551_0308"
FT   CDS_pept        complement(274619..275176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47485"
FT                   /db_xref="GOA:C3NKK5"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKK5"
FT                   /protein_id="ACP47485.1"
FT                   /translation="MLPLTLIAILSLGIVEGLDPYKGLLFSYYFYSFRKVNESYIVPII
FT                   SSITYYMIGIMIAVLFNISDNILTRGIMFSLLLVHVLIKLVIAKVLHYPSNMRPKILNV
FT                   IQWSTLNSIIQMNFIILLTLSILSKLSLILLPIIVVIVRETTYCLSVKNNKILFKLTEY
FT                   NFDYFYLMTVLLLAIVIILPLL"
FT   gene            complement(275145..276545)
FT                   /locus_tag="YN1551_0309"
FT   CDS_pept        complement(275145..276545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0309"
FT                   /product="selenium-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47486"
FT                   /db_xref="GOA:C3NKK6"
FT                   /db_xref="InterPro:IPR008826"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKK6"
FT                   /protein_id="ACP47486.1"
FT                   /translation="MELPSVFAPFKRDPTFYPSPKMAMKSPPEDLAYVACLYTGTGINR
FT                   PDFIAVVDVKPESETYSKVIHKVELSYVNDELHHFGWNACSSALCPNGRPNFERRFLVV
FT                   PGLRSSRIYIVDTKLNPRQPNIVKTIEPEEVKKVTGYSRLHTVHCGPDGIYISAFGNEN
FT                   GEGPGGILMLDHYSFEPLGKWEIDRSDQYLAYDFWWNLPNEVMVTSEWAVPNTIENGLR
FT                   LEHLKDRYGNRIHFWDLRRRKKVSSVTLGEENRMALELRPLHDPTKLMGFINMVVSLKD
FT                   LSSSIWLWYYEDGKWNGEKVIEIPAEPSEGGLPEILKPFKAVPPLVTDIDLSLDDKFLY
FT                   VSLWGIGEIRQYDVSNPFKPVLTGKVRLGGIFHRADHPSGHKLTGGPQMIEISRDGKRV
FT                   YVTNSLYSTWDNQFYPEGLKGWMVKLNANPDGGLDVDKEFFVDFGEARSHQVRLRGGDA
FT                   SSDSYCYP"
FT   gene            complement(276595..277038)
FT                   /locus_tag="YN1551_0310"
FT   CDS_pept        complement(276595..277038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0310"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47487"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKK7"
FT                   /protein_id="ACP47487.1"
FT                   /translation="MDSQNYDIEKILQRYDSDYVFHYLGVKILEIKEGYAKTQIPFKKE
FT                   LTRRGNILNGGMIVASIDYTGGLAVLSINDGMDQVTQELKVNFLEPMYRGPFTVEANVI
FT                   RKGRTAVAVEITFKDVEGSLGAIGLGTWYIIRDKKINMNVQPQ"
FT   gene            complement(277113..279113)
FT                   /locus_tag="YN1551_0311"
FT   CDS_pept        complement(277113..279113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0311"
FT                   /product="acetate/CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47488"
FT                   /db_xref="GOA:C3NKK8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKK8"
FT                   /protein_id="ACP47488.1"
FT                   /translation="MSVTWALPFDQKINPKLNLNRLVSITTYKEIHSQTVKDYKQFWAS
FT                   VASEIDWFKPWEKTLDDSNPPFYKWFVGGELNASYLTVDRHVKSWRKNKVAIIWEGEPV
FT                   DEKGNPKEVRKLTYYDLYREVNRVAYLLKEKYGLKKGDAIAIYLPMIPELPIFMLAAAR
FT                   IGVVFTVVFSGFSADALASRINDAEAKLLITADGGWRRGKVVDLKGIVDKALEKTPTIK
FT                   DVIVVRRIGNKVNMVEGRDKYFDEVIKDIPQNVYVEPERMKSEDPLYILYTSGTTGKPK
FT                   GIVHDIGGYMTLLHATMKWVFDIRDDDIYWCTADIGWVTGHSYIVFGPLMEGATEIMYE
FT                   GALDYPQPDRWVSIIERYGITILYTSPTAIRSFMKYGDNWVKAHITSTVRLMHSVGEPI
FT                   NPEAWEWLWKLVGREEVPFGSTWWMTETGGILISHLPGLYLVPMKPGTNGPPILGIEPD
FT                   VVNEDGKQVNLEERGYLVIKNPWPGMPLTIYKDPERYVKAYWSRFPGMFYVGDYAVKDK
FT                   DGYFWILGRADEVIKVAGHRLGTYELESALIEHPAVAEAAVIGVPDPVKGEVPYAFVIL
FT                   RQGYTPNTQLSQEILKTVRDKVGPIATIDKIFFVGKLPKTRSGKIMRRVVRAVATRAEV
FT                   GDITALEDEASVEEIKKALEEFKAEFEKINK"
FT   gene            279207..279767
FT                   /locus_tag="YN1551_0312"
FT   CDS_pept        279207..279767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0312"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47489"
FT                   /db_xref="GOA:C3NKK9"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKK9"
FT                   /protein_id="ACP47489.1"
FT                   /translation="MTEQKRANPAPLGLSGFALTTLVLSTFNAGLITQGASVVLGLAAF
FT                   YGGLAQLLAGILEWRAGNTFGYTAFFTYGAFWEWYFLTAGGFFGGVTPQAIGLVLIAFG
FT                   IFTLAMWFGTFKANLGLFMTFLLLWITFFLLGVGAMIGNVGLSHAGGYVGILTAIAAWY
FT                   TGLAIVVAESLGKSPPVGRPIMK"
FT   gene            complement(279797..280108)
FT                   /locus_tag="YN1551_0313"
FT   CDS_pept        complement(279797..280108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0313"
FT                   /product="Muconolactone delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47490"
FT                   /db_xref="GOA:C3NKL0"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKL0"
FT                   /protein_id="ACP47490.1"
FT                   /translation="MLFLLWFKIKQPTNITQKQLMEIWKREAEAAMPAVKAGKIKGLYK
FT                   VTGRREVVAIIDVNSHEELDGILETLPIVKELGHSLTIEVTAIHPYENFYELMKKLLQ"
FT   gene            complement(280169..280510)
FT                   /locus_tag="YN1551_0314"
FT   CDS_pept        complement(280169..280510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47491"
FT                   /db_xref="GOA:C3NKL1"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKL1"
FT                   /protein_id="ACP47491.1"
FT                   /translation="MNIWLVSAGIAILQTLLGNIIVFYNSPYLLLLHVLVAIILLALAI
FT                   YGYFRVKLQMEKRILAGNIGLIVITGALGYLYTINASPIISIIHLLLAIGIVSNFSVLY
FT                   GFERGQKYK"
FT   gene            complement(280507..280839)
FT                   /locus_tag="YN1551_0315"
FT   CDS_pept        complement(280507..280839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0315"
FT                   /product="protein of unknown function DUF1291"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47492"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKL2"
FT                   /protein_id="ACP47492.1"
FT                   /translation="MAKVLFLIMSGDEKFDLAMRMAYNSVKNKRYEDVKVIYFGPSQKK
FT                   LTQLDGDMKNMFQELLQNKIVDSACIGVAQAMNIKPHLENLGVSLMPAGERVSYYVNQG
FT                   YEVITF"
FT   gene            complement(280871..281695)
FT                   /locus_tag="YN1551_0316"
FT   CDS_pept        complement(280871..281695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0316"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47493"
FT                   /db_xref="GOA:C3NKL3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKL3"
FT                   /protein_id="ACP47493.1"
FT                   /translation="MKILKYLLPYVTITSFNYYFSKDAITFSSPIFFNLIRYVISSIIF
FT                   LSISRGKIIFNRDVIQLAVYTTVSSLLWAYGLLYVSPAESAVLSYTMPLFSIPISFIIL
FT                   LERPAVLEIVGVVIGFSGVILYGLPLVHGLTLFGSIITIVNALFWGLFTVFYRKLKGYD
FT                   PITVNASQFSIGSIILALLLPIHHNIDPNPEFYIGIAYTSTLGGAISFFLWNMMVKAEK
FT                   IPKVTVLSFSVPILTTLVEFLLYHVLPFPIQLFGIFLMFLGILISRSRTLLS"
FT   gene            281768..283066
FT                   /locus_tag="YN1551_0317"
FT   CDS_pept        281768..283066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0317"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47494"
FT                   /db_xref="GOA:C3NKL4"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKL4"
FT                   /protein_id="ACP47494.1"
FT                   /translation="MIYFFMVDAVELSRKYEGKIEIYPKVPITSYNDFALIYTPGVAEV
FT                   SKAIYKDPDKSFELTSRWNTIAVVTDGTRVLGLGNIGPTAAMPVMEGKSLLFKYLGGVD
FT                   AIPLPINVKSADEFTNVVKALETSFGGINLEDIESPKCFYILEKLQSMLNIPVWHDDQQ
FT                   GTAAAILAGLINAMILTNKDPKESKVVFYGAGASNIAAARILAKYGFKYENIVMIDSKG
FT                   PLYADREDVDHLMLHHKWKYELAIKTNKWEAKEIKDAFSGADAVVAASTPGPNVIKKEW
FT                   ISLMNKEAIVFALANPVPEIWPQDAKEAGAKIVATGRSDFPNQVNNSLIFPAIFRGVLD
FT                   SRAKAITDEMTIAASEALAKYARDRGINENYIIPRMDEWEAFYEEAAAVASKAVELGLA
FT                   RVKKSREEFREIAKERIIRARKIMNLVISTWSP"
FT   gene            283054..283518
FT                   /locus_tag="YN1551_0318"
FT   CDS_pept        283054..283518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0318"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47495"
FT                   /db_xref="GOA:C3NKL5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKL5"
FT                   /protein_id="ACP47495.1"
FT                   /translation="MVTIRRATKEDVKTLIDFFSRMYRLNSEFDPLLLTPENLEERINK
FT                   VVEKSLEDQNEMIVVAEDQGRIVGAARVLIIDRIFYTPEKEALIREFYVHPSYRRQGVG
FT                   NEIVNFIISELKERGIEILGAEFPSRNLIAISFYRKMGFREIYCEFVKKI"
FT   gene            complement(283526..284638)
FT                   /locus_tag="YN1551_0319"
FT   CDS_pept        complement(283526..284638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0319"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47496"
FT                   /db_xref="GOA:C3NKL6"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKL6"
FT                   /protein_id="ACP47496.1"
FT                   /translation="MIRNVLVVGAGTMGHGIAEVSAIAGYNVYLSDVSKDILNNAIQKV
FT                   KWSLEKLYEKGNLKESVEDVLGRIKTIEGLSNELREIDISIEAIPEKLDLKRQLFSKLE
FT                   ELLPNNAILATNTSSLPITEIASAVKRQERVIGTHFFNPPVLMQLVEIIRGSKTSDDTV
FT                   KQTYEFIKSLRKIPIMVNKDVPGFVVNRILLRIITTACMLVEKGICEYTAIDAVARYKL
FT                   GFPMGIFELVDYTGVDVNYYVSSAMMERGFKAYPCKTLEEMTKKEDLGVKSGKGFYTYP
FT                   SNKYIKPNLPPQLAEKINPLYIIAPAISEANWMVKNGIASKEDIDLGVRLGLSFPKGIF
FT                   DYEREFGRESVTKTLEDLRRISGMEEYLPE"
FT   gene            complement(284645..285181)
FT                   /locus_tag="YN1551_0320"
FT   CDS_pept        complement(284645..285181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0320"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47497"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKL7"
FT                   /protein_id="ACP47497.1"
FT                   /translation="MSLNEIRDKMQKEISQSLLMLDNAIKTTKLPIVNEQKTNNPLWID
FT                   VREIDLRYQIPVKRIFKFFEGLREGKILATKCPKCGSIYFPPQDDCPKCKISNLEWIEM
FT                   PKEGEIVAYTVVNVKPPSFSHYQDYIVGIARMSNGVNVLGWVRAKEVRVGMKVKLEVIE
FT                   RKPEGYLTYELVPVG"
FT   gene            complement(285178..286365)
FT                   /locus_tag="YN1551_0321"
FT   CDS_pept        complement(285178..286365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0321"
FT                   /product="Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47498"
FT                   /db_xref="GOA:C3NKL8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKL8"
FT                   /protein_id="ACP47498.1"
FT                   /translation="MRNVAIIGTGHTKFGVRTDVNLQELAWEAVKQALEEANIDQNEIQ
FT                   YFVVGNVGNWSSEELPAVIVGEYCNLTPKGTMRVEAACSTGSAAIRDAYLAIKSGEADI
FT                   ALVVGVEQMHQAPNPQVVELIGRAGGYFWEFENFGLTFPGYYALHASAYMAKYGMKEED
FT                   LGKIAIKNHYYGAKNPYAQFQKEITMEEYLKSKPVAYPLKLLDSSPITDGAAAIVLASE
FT                   EVAKKITDSPVWIVSQGVASGTANLSRRTDFTHIEAAHIAAQQAYKRARIEFDNAWKNF
FT                   DVADVHDCFTIAEIMAYEDLGFAKRGEGYLLAREEQTYIGGKIPVNVDGGLKAKGHPIG
FT                   ATGVSMAVSITRQLLYRAHKGTQVEVRNGMGITHNVGGTGHYAYVTIYSTRRPST"
FT   gene            complement(286389..288002)
FT                   /locus_tag="YN1551_0322"
FT   CDS_pept        complement(286389..288002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0322"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47499"
FT                   /db_xref="GOA:C3NKL9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKL9"
FT                   /protein_id="ACP47499.1"
FT                   /translation="MNSEYYESQLTIDKILDSGSRSFPDREIVYRDIRRYTFRSFANSV
FT                   KRLANGLRKIGVKKGEKIGVIDWDTDVYMHNYYAIPMVGAVLHTVNIRYPLELIAKTIL
FT                   HAEDRYLVVRDEFMPLIEKAKGIMPVGMKVISYSDSKEKVRSPLDTIDFWELIESNEPL
FT                   EEEINVNENDMATIFYTSGTTGEPKGVWFNHRKIVLHAMSVSLVGARPPLSLTSNDVYM
FT                   ILVPMFHVHAWGYPYVALMAGVKYVLPGKYDYSFILRLMDKENVTYSAMVPTILYLLLT
FT                   NPDAPKYLHVFKRWKVTIGGSALPEGLAKKAKELGITVIGGYGLSETCPVLSVGYYNSA
FT                   IEGLDDNTKFMEQITAGAPIPLVQIKIVDPATGKEKETGKIGEIVVRAPWLTQEYYKDP
FT                   EKTKALWKGGWLHTGDLAYMDQYGYIHIVDREKDAIKSGGEFIPSLLLENAISLHPKVS
FT                   QVAVVGIKDEKWGERPAAFIVPKEQVSEEEIRQFLLKLADEGKIQKWWIPDRFIFISSM
FT                   PLTSTNKIDKKVLRDMTQTK"
FT   gene            complement(288037..289239)
FT                   /locus_tag="YN1551_0323"
FT   CDS_pept        complement(288037..289239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0323"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47500"
FT                   /db_xref="GOA:C3NKM0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKM0"
FT                   /protein_id="ACP47500.1"
FT                   /translation="MVLPFNSVEAFSVNVSEKHELFRRAVREFMERDVAPYVEKGEKEG
FT                   TVPKEVLEKAKEIGLYGVAVPEQYGGQGGDTLMTAIAQEEISRVWASLSTRVSVGGLFI
FT                   TPILLFGNEEQKKKYVTPVARGDKVAAFANTEPAAGSDVAGIQTIAKKINGKYVINGRK
FT                   IFITNGGIADYYVVTARTSPPEPNARWKGISMFIVEREWKGVKVLNRIETMGLRASNTA
FT                   ELAFEDVEVPAENLLGEEGNGFKYAMATFDRTRVGVAAQGVGVAQAALERMVTYSTQRF
FT                   AFQSPLIGFQMVQEKIAESLTEVNTARLLTYWAASLFDRGLENEAIVAASMAKLYATDI
FT                   AEKVAIRAITVHGGYGVATSTGVERLLRDVEVMRIYEGANDIQKLVILRETARRLLGIK
FT                   M"
FT   gene            complement(289423..290355)
FT                   /locus_tag="YN1551_0324"
FT   CDS_pept        complement(289423..290355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0324"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47501"
FT                   /db_xref="GOA:C3NKM1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKM1"
FT                   /protein_id="ACP47501.1"
FT                   /translation="MKAAILTQFNSPFVIGNAEPKGVGVKVNVAYAGICGRDLVIWKGG
FT                   FKNLKLPLILGHEIVGYYKGRPVAVYPNLNCGSCEYCKSGKENLCDNARILGEGEITGG
FT                   YAEEVIIPERNIIPLPDDKLEKYAATMDPVATAIHATKLANLNRDSKVLVTGAGGGVGI
FT                   HLVQYLKYLGISSVYGLSSKGEKLQELGVTPISDIRSEKFDTIFELVGSKTINDSLRAL
FT                   KKEGTLVLIGNTEGEPITLLRPAMTIMRQQKIIGSASYTKAEYEEAIRLVGEGKIKAIY
FT                   EIYELERINEAYRKMMERKVLGRAVLKVV"
FT   gene            complement(290387..291190)
FT                   /locus_tag="YN1551_0325"
FT   CDS_pept        complement(290387..291190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47502"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKM2"
FT                   /protein_id="ACP47502.1"
FT                   /translation="MSSCEIFPLISKLSAEGKRFAIVSIYKGNRLERTLVSDGKVLLGS
FT                   LDKEVIGLALEALEKGEVIQKDVEDGKLVITPVEPRPAIIVVGSGIIAKFIAKLAVDMG
FT                   YYVAVVGSSDVKEEDFVGVYAISNDLNLLEQMVSEDSFVIVANEGGKPYDIDALYIAMK
FT                   KKARFVGLLASQKRAALMISLLIKRNIPLEEIKKRLHSPLGLDIGSKTSEEIALSILSE
FT                   VVLELRGGTGKRLQEVKNPYLLLDDALAGKIEDKCMFVPKSLSQQ"
FT   gene            291389..291538
FT                   /locus_tag="YN1551_0326"
FT   CDS_pept        291389..291538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47503"
FT                   /db_xref="GOA:C3NKM3"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKM3"
FT                   /protein_id="ACP47503.1"
FT                   /translation="MPQQNTERVGLENVRKGAIYFLVYSILNIIASAGVFSNTIVSIPF
FT                   TFNN"
FT   gene            291543..291683
FT                   /locus_tag="YN1551_0327"
FT   CDS_pept        291543..291683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47504"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKM4"
FT                   /protein_id="ACP47504.1"
FT                   /translation="MLAHYGIYAEIALVTEAILLQKLEVRGRKTSPAGMDSPLYLNNPF
FT                   F"
FT   gene            complement(291932..292358)
FT                   /pseudo
FT                   /locus_tag="YN1551_0328"
FT   gene            complement(292396..292833)
FT                   /locus_tag="YN1551_0329"
FT   CDS_pept        complement(292396..292833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0329"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47505"
FT                   /db_xref="GOA:C3NKM5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKM5"
FT                   /protein_id="ACP47505.1"
FT                   /translation="MGSLFDKDPELKRLYDKGLEVRKKVMGKEYVERSLSQATDFNREL
FT                   QEMVTIFAWGLIWTREDIIPRKIKSLINIGILSALNRQNELKLHIKGAIRNGCTEEEIK
FT                   EVLLQVGVYCGLPAAMESFRIAQEAIKELEDEEKSEKHKDN"
FT   gene            complement(292892..293806)
FT                   /locus_tag="YN1551_0330"
FT   CDS_pept        complement(292892..293806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0330"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47506"
FT                   /db_xref="GOA:C3NKM6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKM6"
FT                   /protein_id="ACP47506.1"
FT                   /translation="MEKKTLGWTNEKISPLILGSWEFGTPSIVDETNAIKVIQKSIELG
FT                   INAIDTAESYGNGLSETIIGRAIGKFKREDLFIITKVSIDHLRYDDVLRACEGSLRRLN
FT                   TSYIDLYLVHWPNHYVPIRETAKAMERLFNEGKIRYIGLSNFSLPLLREFREHLSKTDV
FT                   AANELHYNVLFREVEKEILPYMLRENIPLLAYDALGLGYLIGRKEIRNEYKWYVLAREA
FT                   YVKNLEPLVDEISSIAKEIDRTPAQIILNWLVSKDNVFAIFNTTKEDHLRENLGSLEWS
FT                   LRDSDLKRLDEAVKKVVIDYFIR"
FT   gene            293900..294466
FT                   /locus_tag="YN1551_0331"
FT   CDS_pept        293900..294466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47507"
FT                   /db_xref="GOA:C3NKM7"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKM7"
FT                   /protein_id="ACP47507.1"
FT                   /translation="MEREIIRILSVIEFHPLIMAFHLGLMLVGVSLLSYSVFSIIIKKV
FT                   DIMFQLLTGFMVYLMSLILLILILLLETYRFLIVNGKILVKNSLLRKNRFEFNLKDKNL
FT                   IIGFYDKPFLAKFAIIYGDRLLFKFLTRQKNIALIKNFVLKSSYRMGGTYKICSFCGSI
FT                   NEENAEYCDFCGSRELSPYDLYWID"
FT   gene            294967..295770
FT                   /locus_tag="YN1551_0332"
FT   CDS_pept        294967..295770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0332"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47508"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKM8"
FT                   /protein_id="ACP47508.1"
FT                   /translation="MPCRGLHAIPAGPPEFPELATVYVICGEKLNVMIDAGVTNSIMDS
FT                   SFLDKLDLVILTHIHIDHIGLLPEILDRYKNVKVMVRSGFKKFLTTDDGVKRLNESSEK
FT                   VLGDLYYIYGEFTKIDPDKVVEVEGGEMIDLGDGKTLKVIYTPGHAKHHISVISEDILF
FT                   TGDSGGAYFNGIVIPTTPPPLDYDNYVNSLRLQISLKPKVVGLAHGGLVSPNVLEQHLE
FT                   QMLGKESLNISEEIDIGGIGGEILRKQVEVNLRGLNEALERRRKI"
FT   gene            295856..296185
FT                   /locus_tag="YN1551_0333"
FT   CDS_pept        295856..296185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0333"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47509"
FT                   /db_xref="GOA:C3NKM9"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKM9"
FT                   /protein_id="ACP47509.1"
FT                   /translation="MVWKRTISAKALEKAKSAAVKVEDKVVFIANIKGVLYAMDAVCSH
FT                   ARCILGQLDEEKLTVKCYCHHALFDLRSGQMLEPPYVAPDAPKEKLGLKTYQIRDNGGW
FT                   IEVDI"
FT   gene            complement(296182..297285)
FT                   /locus_tag="YN1551_0334"
FT   CDS_pept        complement(296182..297285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0334"
FT                   /product="FAD-dependent pyridine nucleotide-disulphideoxido
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47510"
FT                   /db_xref="GOA:C3NKN0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKN0"
FT                   /protein_id="ACP47510.1"
FT                   /translation="MKRLVVVGGGNAGTLIANLLAGKLEITVIEPNEYHTYQPGLVDYI
FT                   TGEVDETKIQMPTRLLLKPSVEWVRAKATKIIPEDRAVVAEDGKTYEGDYLVIAIGGQN
FT                   KDIYNLKGYHGIDDSKVIRNEVLNPRGKNFVIGSLPGIIKCPAAPWELSFLMKRKYPDA
FT                   NVSVIVPAKQPPPLQVPMSNMFNKKANELGIKVYKGFVIEEVNHNERYVVSTEGDKINF
FT                   DHLIIDTPISTNFPEFADKSGLIPVDKSTLVYRDGVFVVGDANNTPTPKTGAAAHFQAE
FT                   VVVNNILAEIEGNRSKESYDGTAMCAVYSGPNEGMLVWLNYEKSKALGPTSIYRYMKKA
FT                   FTSLYWASLSGGVDFVLKPLVESVRKN"
FT   gene            complement(297354..297605)
FT                   /locus_tag="YN1551_0335"
FT   CDS_pept        complement(297354..297605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47511"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKN1"
FT                   /protein_id="ACP47511.1"
FT                   /translation="MKIIEKVKLDKLESCGSRSPLSIMLEVIMKIKECDEGVEILINDY
FT                   DWLLSLKYILKINDLKMKIEEKGKEDNFLKLEVLRDCT"
FT   gene            complement(297602..298483)
FT                   /locus_tag="YN1551_0336"
FT   CDS_pept        complement(297602..298483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0336"
FT                   /product="Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47512"
FT                   /db_xref="GOA:C3NKN2"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKN2"
FT                   /protein_id="ACP47512.1"
FT                   /translation="MSQVQEQQVIVDNKWVLDHLKDQKVRIVEVDYDPNTAYNVWHIPG
FT                   AVLVRWREDLRHPVLRDFIEPSQFEKLMESKGISNNTTIVLYGDYNNWFAVYAFWLFKS
FT                   YGHDDVRILNGGRTKWAKENLPTEQGAKEPQYPKGSYKVKKVDWGSHRAFFWEVLQKIT
FT                   KGEVGRTTILVDVRSPKEYTGEIRAPPEYADEQTQVGGHIPGAVSFPWAQAVNPDTGEF
FT                   KSIEELRRLVESAGITPEKEIITYCRIGERASHTWFVLKYLLGYPAVRVYDGSWAEWGN
FT                   IVGAPVKKGTEP"
FT   gene            298618..298950
FT                   /locus_tag="YN1551_0337"
FT   CDS_pept        298618..298950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0337"
FT                   /product="ORF1 in transposon ISC1058"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47513"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKN3"
FT                   /protein_id="ACP47513.1"
FT                   /translation="MGKSKYKRDWSKYDENVITRYELMFPFYVFQHWWELLAEENRNAK
FT                   KTYKAAFNAKFKNKNNRVSKHIYQLDFHKIHLNLTTSPKTSMEGVAKLPILVNSLKLIT
FT                   FTFWSK"
FT   gene            complement(298821..299435)
FT                   /locus_tag="YN1551_0338"
FT   CDS_pept        complement(298821..299435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0338"
FT                   /product="Uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47514"
FT                   /db_xref="GOA:C3NKN4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKN4"
FT                   /protein_id="ACP47514.1"
FT                   /translation="MADVIVYDKLVSRELISYAKPSCSVILLSSDDIEIELLRRYALEN
FT                   KLVIRLKNGDPYVFGRGGKICQELIKDGIECEVVPGVSSVNSVPAYAGIPLTFNGISDM
FT                   ITVISAVTKGGRLFDFEKIPADGTLVVLMGGKRLEEVSKELMTKRDPSEEVAVIQRGTY
FT                   FDQKVNVINLRELTKIGNLATPSMLVLGDVVKLRCILWKSS"
FT   gene            complement(299506..301401)
FT                   /locus_tag="YN1551_0339"
FT   CDS_pept        complement(299506..301401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0339"
FT                   /product="nitrite and sulphite reductase 4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47515"
FT                   /db_xref="GOA:C3NKN5"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKN5"
FT                   /protein_id="ACP47515.1"
FT                   /translation="MRIPIEPNFRTDPKDYSEEERVKLKTKGLTEDTIGIYSSFHDFTR
FT                   DDLEKEVSLIAKSFGIYMEFNRDKMKSNAIKDWIYMVRLPIPGGGPIRLDQWRILDDVS
FT                   NKYTISDAYTGYPLPSLKLTTRQAIQFHHVKKKDLPNLIREIAESGFLTINGCGDNLRN
FT                   TIACPLSKFWIFDSNTLARKIADYFRLPSELYLQVFEIPLSEERQFNNEESFKYADNLL
FT                   PRKFKIGIAGVMRTIDGKYIIDNCVEVRANDIGIVPLIEGEKVIGYQIYVGGSMGENNS
FT                   YPTFSALGLPIGTVSKDKELLRVLDAIVRLHEQWGDRKNRHWARFKYVVYKMGLEWVRE
FT                   KVWEYSGIRLCKIVNVNLDHSDLHLGWIDLGNSEWAYGVFVEDGRLIDGKNGKVKSMIR
FT                   YIADNFHNLTFYITPGQHLLITEIDDDQREEIEKTLRDFNYGFRDGKPYSNLRTNSIAC
FT                   VGFPTCKLSFTDSERFLPSLIDELERRGWKDIPVSIGLSGCVAQCSRPAVHPISWIGSG
FT                   YELYMLKIGGGNGNLGEPLIDWDENVIYLYQVPANRLADVTEALFELYERNKDISEEPG
FT                   KVFRVIGNRKIIEWLKSHEKTRDLMRPHKFNKKIEGYREYHDLLRKRLEEVNRYR"
FT   gene            complement(301398..302117)
FT                   /locus_tag="YN1551_0340"
FT   CDS_pept        complement(301398..302117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0340"
FT                   /product="adenylylsulfate reductase, thioredox independent"
FT                   /EC_number="1.8.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47516"
FT                   /db_xref="GOA:C3NKN6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011798"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKN6"
FT                   /protein_id="ACP47516.1"
FT                   /translation="MLSKEELDSLNKWFEDKEPLEVLKWGIEKFHPKIVLACSLQAEDL
FT                   VILDMLSKVVEKPKVFIIDTGRLHQESYELIEEINKKYNTDLRIYFPDYKEVEALVNKH
FT                   GINLFYRSVELRKACCEVRKVLPLRRALEGMQAWITGLRREQNFTRGGIKKIEIDEVNG
FT                   GIVKLNPLADWTWEQVWEYIKKNNVPYNKLYDKGYKSIGCVPCTRPVKPWEHPRAGRWW
FT                   WEQNSDKECGLHYRGVK"
FT   gene            302218..303438
FT                   /locus_tag="YN1551_0341"
FT   CDS_pept        302218..303438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0341"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47517"
FT                   /db_xref="GOA:C3NKN7"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKN7"
FT                   /protein_id="ACP47517.1"
FT                   /translation="MNLIGHGKVEIVERIRRISDFEELQKIEVKRQLAHEIVSIAYGFL
FT                   SPLKGFMNYEEVDSVVENMRLPNDVLWPIPIMFDYSQNEIVKEGDTIGITYLGKPLAVM
FT                   EVKEIFKYDKVKLAEKVYKTRDIKHPGVKRTLSYADAFLAGDVWLIREPQFTSPYSEFW
FT                   LTPRMHRVIFEKKGWKKIVAFQTRNVPHTGHEYLMKFAWFAANENQKVHEPRTGILVNV
FT                   VIGEKRIGDYIDEAILLTHEALSKYGYISKKVHLLSFTLWDMRYAGPREALLHAIIRSN
FT                   LGCTHHVFGRDHAGVGNYYSPYEAHQIFDNINEDDLLIKPIFLRENYYCPICGSIENEI
FT                   LCDHKDEKQEFSGSLIRSIVLDEVKPTKMVMRPEVYEVLMKAAKQYGFGSPFVTEEYLE
FT                   KRQSIVG"
FT   gene            303445..303744
FT                   /locus_tag="YN1551_0342"
FT   CDS_pept        303445..303744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47518"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKN8"
FT                   /protein_id="ACP47518.1"
FT                   /translation="MKIYIWLSEEMSRKLEELELNYAREVLGGMKRIEIDVEQEIVEEI
FT                   VKLFPNAKVDSSTTKSIELLPRSFKNEILRIIVEKRIEPKKALMEAIKRLNGDI"
FT   gene            303768..304597
FT                   /pseudo
FT                   /locus_tag="YN1551_0343"
FT   gene            304634..304825
FT                   /locus_tag="YN1551_0344"
FT   CDS_pept        304634..304825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0344"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47519"
FT                   /db_xref="GOA:C3NKN9"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKN9"
FT                   /protein_id="ACP47519.1"
FT                   /translation="MEKPDFEEILYIVSGVIFLASLGVGLVIVGDYVIGDIMLFLSILW
FT                   ALSIFLFMRYVERKDSEE"
FT   gene            complement(304833..305747)
FT                   /locus_tag="YN1551_0345"
FT   CDS_pept        complement(304833..305747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47520"
FT                   /db_xref="GOA:C3NKP0"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKP0"
FT                   /protein_id="ACP47520.1"
FT                   /translation="MAINLFIIKLSIICMNLTDILGQPICFTMLMGIAGISIASYLGKL
FT                   TLLSLISFWIALVFLILLTSFFILNLKRLKYEMVDLISIISGLTLLITRLRLSYPSPFY
FT                   FIPLMILSIFYFVIAYKVFVSLKQVTFKHHLLGVAITLLSIGLRSYITLLSLIFASIGI
FT                   LIYFTITALILKSIMTTKRDIIGIINGATWIQMGLSALISFAITPFSKLVSLVFYYLAL
FT                   FLLPIVILVSILKLISVKIIRYHPSLWSVIFPQAVFSTDTFSLIREHLIVLPILYDVSF
FT                   SVLLSAFSLFILFLSFTIFSVTR"
FT   gene            305473..305763
FT                   /locus_tag="YN1551_0346"
FT   CDS_pept        305473..305763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47521"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKP1"
FT                   /protein_id="ACP47521.1"
FT                   /translation="MSKVRPEIIEIRSTISYFNLFRLRMKKEVRRIKNTRAIQNEINES
FT                   RVNLPKYDAIDIPAIPISIVKHIGCPRMSVRFIQIIDSLMIKRFIATNKLI"
FT   gene            complement(306238..307776)
FT                   /pseudo
FT                   /locus_tag="YN1551_0347"
FT   gene            complement(307773..311628)
FT                   /pseudo
FT                   /locus_tag="YN1551_0348"
FT   gene            complement(309658..310875)
FT                   /locus_tag="YN1551_0349"
FT   CDS_pept        complement(309658..310875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0349"
FT                   /product="transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47522"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKP2"
FT                   /protein_id="ACP47522.1"
FT                   /translation="MKLRVRVDYSTYSALKEVEKEYREVLEEAINYGLSNKTTSFTRIK
FT                   AGVYKTEREKHKDLPSHYIYTACEDASERLDSFEKLKKRGKSYTEKPSVRRVTIHLDDH
FT                   LWKFNLDRISISTKRSRILISPTFPKIFWRYYNKGWLIASEARFRLMKGNVVEFYVIFK
FT                   KDVKPYEPKGFIPVDLNENSVSVLVDGKPMLLETNTKKITLGYEYRRKLTITGKSTKDR
FT                   EVRRKLKRLRERDKKVDIRRKLAKLIVKEAFESRSVIVLEDLPRRTPEHMIKDVKDKQL
FT                   RLRIYRSAFSSMKNAIIEKAREFGVPVVLVNPSYTSTVCPVHGAKIVYQLDGGHAPRVG
FT                   VCEKGKEKWHRDVVALYNLAKRAGDVSPVPLGSKESHDPPTVSKWLRAKSLHSIMNEHK
FT                   MIEMKV"
FT   gene            complement(310859..311500)
FT                   /locus_tag="YN1551_0350"
FT   CDS_pept        complement(310859..311500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0350"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47523"
FT                   /db_xref="GOA:C3NKP3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKP3"
FT                   /protein_id="ACP47523.1"
FT                   /translation="MERLLRPKEACQLLSISYSTLLRWIREGKIKVVTTEGGKYRIPYS
FT                   EIKKYLERREETRAVIYARVSSTDQREDLERQINYLTNYATAKGYKVVEVLKDIASGLN
FT                   TQRKGLLKLFKLVEGRSVDIVLITYKDRLTRFGFEYIEEFFSTMGVKIEVVFGEEPKDD
FT                   AQELVEDLIYIITSFAGKIYGMRSHKKTLLVQGVKKLIGELSGEDSEVKG"
FT   gene            complement(311634..311897)
FT                   /locus_tag="YN1551_0351"
FT   CDS_pept        complement(311634..311897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47524"
FT                   /db_xref="GOA:C3NKP4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKP4"
FT                   /protein_id="ACP47524.1"
FT                   /translation="MKKDGKESTYFVGRPHKQKPITDIGYKIEGDNIICPFHLVVFSLI
FT                   TGELIKPPESKTPCSPNCKLIRARLINGEVLFDKPFIPKTKG"
FT   gene            complement(312418..313278)
FT                   /locus_tag="YN1551_0352"
FT   CDS_pept        complement(312418..313278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0352"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47525"
FT                   /db_xref="GOA:C3NKP5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKP5"
FT                   /protein_id="ACP47525.1"
FT                   /translation="MAKYVSFYVGNLRKIGVVEGNYVYEVSEIGEDKERGNSYKLNEIN
FT                   LDIPIQPLAIICTLVNSPKMVGVNNKNEAREMVKSPKFFIKLPTVAIAHRQPIISPPDA
FT                   IRPEVEIGIITRLKMKDINRSDVKKYILGYTVFNDITYPPGLKEDSYYAMRRDPTDGNV
FT                   KKLLMRGTHFRNKVRDTFAPMGPYIVTEEEIGDVNSLRMRSYYNGELVQDGYSSEFIFS
FT                   IEEILVELSKIVTIPPFSVVSTGSIGYTNVSDASEFTLKPIEYALMVAEVEKIGRLENP
FT                   IKIYQ"
FT   gene            313382..315439
FT                   /locus_tag="YN1551_0353"
FT   CDS_pept        313382..315439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0353"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47526"
FT                   /db_xref="GOA:C3NKP6"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKP6"
FT                   /protein_id="ACP47526.1"
FT                   /translation="MIKEDLPKISGKGMYIDDLNPMNTVYLGIVRSPIARGIIKSISKP
FT                   EKALLTLTWEDAKIYMPVRADPETLKQSNIVKMPILADGKVNFVGQPVLAYVVEDRYEI
FT                   EDITDEVSIEYEELKPIINIEKAMNSNDEIHSGAKRNISVDKLLEGGELSAKKRAEIIV
FT                   SRKINQTRIISNPMEPKGIIAFWDGEHLNIYGSFQSSFRVKNDLREALNLPPEKIRVYS
FT                   PQNVGGGFGNKVPAHPEYVIASMASMKLGRPVKWIETRYEHLKNPTVGRGVLSDIKMYA
FT                   TKQGEILGIEGYIAVDLGAYNYTLNPTTPAFIAQLLTGPYKMKFASIRAYGIFTNLPPT
FT                   GPYRGAGRPEAALIHETLVEDLANELGMDPVEIRRKNLIGDNGYVTPLGVKIDPAGYNQ
FT                   VLNEAEKYYRKAREVYKGKGVSITVFTDIVRLSPGEGARVRIENGKIKIFVGTGPHGQA
FT                   HGYTFSKLASEILGVPQDLIEVITNTTDGVKEGIGSFGSRSATAGGSAVIEACKQLLSK
FT                   INMPIEKALKEINGVEAEVFYKSDDIFSPGSHVAVVDVDKDTGFVKVLEYYAVDDVGRT
FT                   LIKEEVEGQIIGGVLQGISQVLWEHAPYDENGNPLFSSIADCGVPTAVEANYKIYVNEV
FT                   EYPSVTSAKSRGIGEAGTTGALPAVFLALEKITHKKFNKTPIYPWDIIEQ"
FT   gene            complement(315492..315599)
FT                   /pseudo
FT                   /locus_tag="YN1551_3253"
FT   gene            315759..316704
FT                   /pseudo
FT                   /locus_tag="YN1551_0354"
FT   gene            complement(316767..316913)
FT                   /pseudo
FT                   /locus_tag="YN1551_3254"
FT   gene            317037..317849
FT                   /locus_tag="YN1551_0355"
FT   CDS_pept        317037..317849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0355"
FT                   /product="Protein of unknown function DUF1626"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47527"
FT                   /db_xref="InterPro:IPR012431"
FT                   /db_xref="InterPro:IPR024271"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKP7"
FT                   /protein_id="ACP47527.1"
FT                   /translation="MSLEEEIKKVLLNNPSILVDVLTAKPEIVYQVLARITPWQNLATK
FT                   QDIERLDRTINEIKNTMATKQDIERLDKEIEETKKIMATKQELEEIKNVMATKEDLKGM
FT                   ATKEDLKTMATKEDLKGMATKEDLKTMATKEDLKRLETIITGLGARWGIMNEDSFRQGI
FT                   GELLSNSGWKVSREVLYDRSGYVYDEPSDVEYDIVIKDGSVILVEITSSLKRGDLPTIK
FT                   RKKEFYEKVKNIKVNLVYVVTPFIHDRYPERVKAMAKDMGIEIIYPSS"
FT   gene            complement(318011..319041)
FT                   /pseudo
FT                   /locus_tag="YN1551_0356"
FT   gene            319347..319580
FT                   /locus_tag="YN1551_0357"
FT   CDS_pept        319347..319580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0357"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47528"
FT                   /db_xref="GOA:C3NKP8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKP8"
FT                   /protein_id="ACP47528.1"
FT                   /translation="MEVRVKVNKKGIIVVPKAIREEVRINEGDIVKMRVEGGKIIIEKI
FT                   DLWDKVWKCCKGSTEDAERELDEEEEEFWKRA"
FT   gene            319565..320002
FT                   /locus_tag="YN1551_0358"
FT   CDS_pept        319565..320002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0358"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47529"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKP9"
FT                   /protein_id="ACP47529.1"
FT                   /translation="MEKSIIVDTYAILAMAYGELTKRGEEVMAGIRSGLYEGVIPSTVV
FT                   FEFIVYWLRSRIPSLKSIDEARTFLFTYFKVNELTSDDFIDSAKIKKEGDDILAKEING
FT                   RRLSIVDSTIIHLAKKLGVGIITGDKDLTLVARKLGIEIIW"
FT   gene            complement(320301..321182)
FT                   /locus_tag="YN1551_0359"
FT   CDS_pept        complement(320301..321182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47530"
FT                   /db_xref="GOA:C3NKQ0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKQ0"
FT                   /protein_id="ACP47530.1"
FT                   /translation="MWCLLIALFDFLILTVIRSLGYYARTLLDKYGEFIDYNSIQQIFF
FT                   LGASIIALIIAGLFNTYLPRTYLPIIGFPLLIVVLLSMRLNDVKITLSSTNSFKVWVNY
FT                   IKSNRIFMFLETRVYPVMALANASTVLFLKLVYVNKETFPEYITVVLVVSILAQAIGAI
FT                   IALKWKSETTRKFLLLSLPAISIEYVFPFIRGDLITISVLTFLQSVLVAYVFIHINSIY
FT                   QYIINKDVYVNVTVTQAVLTQVSIFIVSTLVSIIATVVGITYTYIGNATIMLLIVLFTI
FT                   FSNTIKDIKAKD"
FT   gene            321362..322281
FT                   /pseudo
FT                   /locus_tag="YN1551_0360"
FT   gene            322435..323040
FT                   /locus_tag="YN1551_0361"
FT   CDS_pept        322435..323040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47531"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKQ1"
FT                   /protein_id="ACP47531.1"
FT                   /translation="MKTLDFLITYIHIIREMLAYVFWHQRARDFPANEYESSLLNFHDY
FT                   FNKKAKIEGYLGSLVVKVDHVPWIEGEVYEDWYFIETSKTLDLLNDIILESNDIKAVHD
FT                   SIAKIARNGKGGLYKLLNGEQLSPSYRFGYWISKPVGMRYEDFYTEIKPFSQNLWRKQL
FT                   AMGPLSEFCIFSNEYFKVPEKYFPVYQQRILLYSSVLS"
FT   gene            complement(323037..323516)
FT                   /locus_tag="YN1551_0362"
FT   CDS_pept        complement(323037..323516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0362"
FT                   /product="deoxycytidine triphosphate deaminase (dcD-2)"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47532"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKQ2"
FT                   /protein_id="ACP47532.1"
FT                   /translation="MILSHQSIKKLLGKVIMNYVEENVRENGYDLRICGEKYYEVEEGA
FT                   KLPSIKAKIREIPFKEVANLSPLNTYLFESCEEFNMPDNLAVLITLKSTMARNGFLAPP
FT                   TVIDAGYKGKIYLAITSVYGSSLAKGISTHHLIFLELDQKTERIYSGKYQGGIPI"
FT   gene            complement(323561..324715)
FT                   /locus_tag="YN1551_0363"
FT   CDS_pept        complement(323561..324715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0363"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47533"
FT                   /db_xref="GOA:C3NKQ3"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKQ3"
FT                   /protein_id="ACP47533.1"
FT                   /translation="MSSPFHYSQFTKFTIFSVFAGFSFIQNELTTYWLFILLFRQEITL
FT                   FGLGVIARPLVRVFVSYFMGYISDKYNRAKLFYITRGVAAILLLPLTLAFIYHSIPWIF
FT                   GVYYIRTIIVELSNNVGYVAYYAVVPEQVRAKAIFYIRIFSMASRVVSGAIWFLIYQSI
FT                   GAYDLLLTAILGLIGLAMLKGFNIGGGSERVKLTTGIDFFRKDERIRGIILLYSVTDGL
FT                   TYSINYLLPLLILVYYGTEEIYSLSQTVLYGVLVIASFIMTKMKDPVKIAVTYILSGFL
FT                   FYMVLVYPSPYVLLISLLLYGFGSGFIENYVMATIKQSVGDEFLGSVLGLDVLVTSSLE
FT                   ILIILLAQYLITINVIYYIILGIAGMVFVLASWLLHPKLREVKL"
FT   gene            325273..325368
FT                   /pseudo
FT                   /locus_tag="YN1551_0364"
FT   gene            complement(325372..326310)
FT                   /locus_tag="YN1551_0365"
FT   CDS_pept        complement(325372..326310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0365"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47534"
FT                   /db_xref="GOA:C3NKQ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKQ4"
FT                   /protein_id="ACP47534.1"
FT                   /translation="MSHATSIVEIENLRVSYKVREGKKIAIDNVTLSITKGETLAVLGE
FT                   SGSGKTTLGLAILKLVKVDEGKIYFKGNDITNLKEKEMREIRKLMQLVPQDPYSSMNPK
FT                   LRIKDIVGEPLLANPDHVIDKIRNSLEQVGLDPSITERYPYELSGGQRQRVLIARALIS
FT                   NPEFIVLDEPTSNLDVSIQAQILNLLLDLQIQKNLTYLFITHNISVAKYMADRIAILYH
FT                   GKLVEIGKSKNVIMKPLHPYTTKLIEAVPLNGYKANIREFEISEIDDSKNQSKGCSYFS
FT                   RCPFAKDICKVKEPQLITIDNDHMVACHLYT"
FT   gene            complement(326285..327304)
FT                   /locus_tag="YN1551_0366"
FT   CDS_pept        complement(326285..327304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0366"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47535"
FT                   /db_xref="GOA:C3NKQ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKQ5"
FT                   /protein_id="ACP47535.1"
FT                   /translation="MSNKLLSLENLWITYYKGNKSAYAVRGVSLEVNYNQVVGIVGESG
FT                   SGKSTLGHSIIGLLPNNAKVEKGKIIFEETDLAKINKSDFYRFRGKRGIFMIFQDPMTS
FT                   LNPTIKVKEQLVEIIKNRPNENSVNTLSHWFIGKVNKSEIVRDEKQLIESLKKVGFRNP
FT                   DEILDKYPHQLSGGERQRIMIAMAYLLKPKLLIADEPTTALDVITQAQVLKMLLELKEE
FT                   YKSSIIFISHDITLVSQISDKVIVMYGGIVMEEASSEEILKNPLNPYTKGLVASIPNYF
FT                   KGKGKISSIPGFPPNIFELPQGCPFNPRCNLAMSVCKSQLPKLKSIGESHSVACHLYS"
FT   gene            complement(327297..328160)
FT                   /locus_tag="YN1551_0367"
FT   CDS_pept        complement(327297..328160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0367"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47536"
FT                   /db_xref="GOA:C3NKQ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3NKQ6"
FT                   /protein_id="ACP47536.1"
FT                   /translation="MNLKDITKNMNLTVGLIIILSFLVLTIISTADLHILTPYNPNQLN
FT                   FSQANLPPSSNHVFGTDQEGRDVFTRSLTALRIDFSIPFLIVGISMLIGTIIGILSGYF
FT                   GGLLDEALMRITDIFLAFPGILLALAISEILGSTHLSLRLYLSALALAIVNWPIYARLV
FT                   RAQILQVKNMQYITLAKVAGLNNFQIIKKHIIPHLVSLLLVYTTLDMGTIILNYSILAF
FT                   FGLGAPPPTPELGRMVYDGLSALPQNWWSSIFPAIIITLMALGYSLAGDGLRDILDPRL
FT                   GERTNV"
FT   sig_peptide     complement(328065..328160)
FT                   /locus_tag="YN1551_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.848) with cleavage site probability 0.321 at
FT                   residue 32"
FT   gene            complement(328157..329218)
FT                   /locus_tag="YN1551_0368"
FT   CDS_pept        complement(328157..329218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0368"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47537"
FT                   /db_xref="GOA:C3NL23"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL23"
FT                   /protein_id="ACP47537.1"
FT                   /translation="MISYKFLIKRAIEAFLVIMAELIIVFYLANIAAPNPASVWAGPEA
FT                   SPEQIQIVTELYHLNQPWYIQLYYYLGNFFTGKWGISPLYQTPVISLIEEYLPVTIELA
FT                   IIALILKIILEISLGILSALKPNGLLDNSIRVVYTITRSAPPFIVALLLLLILSYYFHV
FT                   FPSSYYMNPILALHESKFYIQIGGHKYYFWFIDNMPILNSLLVGDIPAFVSALDHSILP
FT                   ALALTLFGFGGIVRLTRNSMLEVLNTDYIKTARAKGLKERIVITRHALRNALLSSITLI
FT                   SVIFAGLMQGSLVVETIFNYYGIGYLVAESLLNLDTPTLIAATVVITIVVVISNLVADI
FT                   SYALLDPRIREAL"
FT   gene            complement(329245..331302)
FT                   /locus_tag="YN1551_0369"
FT   CDS_pept        complement(329245..331302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0369"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47538"
FT                   /db_xref="GOA:C3NL24"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL24"
FT                   /protein_id="ACP47538.1"
FT                   /translation="MKSRKAFKGLSRTFIAIIVVVIVVIGIAVGVLLGNHPSSNNISTT
FT                   TTSSSIISTTTLPSTSSSTSPPNSVSIPSSITVEEAATPVSVDPASSYDIAGGEIIQNV
FT                   YQTLVFYNGTNTSSFIGVLAENWTVENNGTTYIFHLWPFITFSNGNPLNATDVWFSIYR
FT                   TMLINLGISIYTSQALAVNNGLGFVGKLPNGKYGTIMLPNGILQALEYAGYNFSSNKTI
FT                   AMEQAAYDLAYILSHFNVSNTTIQKVMSYPHQAVVVIDPYTVEFNLDYPYSAFLAALST
FT                   STGAIVNPVFVDENGGVQIDTSNTYLSTHALGSGPYILETPIGGSYVVLNASPNYWASK
FT                   VPTKDLNPMLETPKIKTIIIDYQTNEAVRILDLQQEKAQISQIDVINLQELIGSSGVQQ
FT                   LQNLVNGKTFPTTYTSGNVTIYIWGPSAQIDFLAIDAYQYPFNITAVRLAISHAINPVQ
FT                   IQQQVYKGFAINYVGPLDPSLPYYNSSIIGYTYNPSLSIQLLEEAGFKLTLPNGTTVNP
FT                   NGKPFPTITLTYQTGSTALQDEALLVQQQLAQIGITVQLNPESAVTIVESYINPPNSSA
FT                   YPAFQLAGNFPPVLSPIDPAIYLLSQARLHHGNPAFVDNSTINQLIVEAVRTNNPQQLQ
FT                   HIYNEITLLTLAQAQYVWLDDFLAYTVASSSIHGFWYSPGLDGLFYADLY"
FT   sig_peptide     complement(331210..331302)
FT                   /locus_tag="YN1551_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.513 at
FT                   residue 31"
FT   gene            complement(331798..332379)
FT                   /locus_tag="YN1551_0370"
FT   CDS_pept        complement(331798..332379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0370"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47539"
FT                   /db_xref="GOA:C3NL25"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL25"
FT                   /protein_id="ACP47539.1"
FT                   /translation="MSMFNNTHPEFMRIGITIENVDTRYKPLMRMGISIDEMIYLARRL
FT                   YPLIRDGKKILDLACGNGLITVILSRLMSDAEFHAVDDWKKVSRDDLIRNIEIDKARIM
FT                   LGEFKDQFTLSYQDTYFDSVYSVMFLSNIGKDGRVKISDEVYRVLKEKGKFVVIDTLVF
FT                   RGKIKKDLEHKFKLDWYGEENGFSFFVWSK"
FT   gene            332411..333091
FT                   /locus_tag="YN1551_0371"
FT   CDS_pept        332411..333091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0371"
FT                   /product="protein of unknown function DUF929"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47540"
FT                   /db_xref="GOA:C3NL26"
FT                   /db_xref="InterPro:IPR009272"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL26"
FT                   /protein_id="ACP47540.1"
FT                   /translation="MTTNDLGKIFRRMLVLLLMNRRNLITAIIGIIVIITGVIAYVTHF
FT                   VVSAQHIPAGKFIKISNVDLAPKGKVIIVEQSWYGCPVGAAASWAIYDFLQHYGNLSYK
FT                   LWYSDPYRTPANIPGLLFTNFTSNSIVDFYIAYVYNEYLNASYNGTPIPQNELVPVGEQ
FT                   IIKEEYTQMGALSSSPLHYPIRNASTNTAVWRAFSVLWQTIALKFCNTNLWSEWYLHCD
FT                   YTDS"
FT   gene            complement(333301..333510)
FT                   /locus_tag="YN1551_0372"
FT   CDS_pept        complement(333301..333510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47541"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL27"
FT                   /protein_id="ACP47541.1"
FT                   /translation="MMNVVDLKKIYSQILSLSEECKRCIDCEACDRVEELIDYVVENID
FT                   KMSIEGQTETRRILNSIIELRKEI"
FT   gene            333573..335351
FT                   /locus_tag="YN1551_0373"
FT   CDS_pept        333573..335351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0373"
FT                   /product="sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47542"
FT                   /db_xref="GOA:C3NL28"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL28"
FT                   /protein_id="ACP47542.1"
FT                   /translation="MDYALLSLMLLFTLLLAFILTRLKVSPVIAYLLGGLIAFNYFHFD
FT                   FNSSYFEILNFLALNLLAFEIGTSFDISRAKELFRRAIGIALTELILILLISYFIGLYL
FT                   LHLDPFDSLFLVMASIDTSTSILYKIAGNKLAKNDRDLLIAVASVEDVEVFFLYSVAIA
FT                   INGYFNFFRTFFVVLEVFIASLIIYAFAKYFLTGLSIFRLTSLEDESILILLPIVLVFV
FT                   FEYISQVTQVPTTLTMILAGIAFSSISGSDKIIKYTAPIREFALIFFFLSVGSYLKITT
FT                   AITTFILISFIILVIKYFSFSTASWVTGTTFVKAFTNGLYMLPLSEFGIIVSLEAMQQG
FT                   VNIAIVYYISVVVVLVSSIIASILAVRVNVLQRIIGIVYSQSYFLRQLDSTMVWLNKTL
FT                   NANLSPILRSVVFRGFVKMFLYLILPYVLFPIINSLVTSIIDPINNLILQYVLYAGEIS
FT                   IALFLLYLFLSQGSRLYSTINNQILVKITKVRSRLFREFWFGLTSFSSTFYSVILTVVY
FT                   ITFEIIPLLYNFPIRLIFIPLLVSLYFIYRYRVPPITFTRISNKNGEELVKLTVKVIKR
FT                   MRKKRRPKGISRIIHS"
FT   sig_peptide     333573..333647
FT                   /locus_tag="YN1551_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.752) with cleavage site probability 0.396 at
FT                   residue 25"
FT   gene            complement(335442..336200)
FT                   /locus_tag="YN1551_0374"
FT   CDS_pept        complement(335442..336200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47543"
FT                   /db_xref="GOA:C3NL29"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL29"
FT                   /protein_id="ACP47543.1"
FT                   /translation="MKLYFLSIIPIVISLVLTYMFPFNELIPIVTFWIFLTYLLFNTIL
FT                   RGELQVMRLYKRKRTKWGLFFSYLITHYIVYSIAIVELLTYIYKPALSYPQTAFVSLFS
FT                   TPFGSSPSLTNLGLSLIFNPTITAFIPPNIVIDLSLYSISMGLYIAILVTSSLVTLISL
FT                   NKKLGYLAFIPLIGIIAGASCCVSIPVLLAESIEVSNLVFLTTSLWQAVFIAYVSLPII
FT                   TVIFLKHLSSSLHKLNGGLKQFNISGRMTK"
FT   gene            complement(336230..336670)
FT                   /locus_tag="YN1551_0375"
FT   CDS_pept        complement(336230..336670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47544"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL30"
FT                   /protein_id="ACP47544.1"
FT                   /translation="MKKGKIIVPITVIVVIVLLVFSSGVLAGRNPFISTSAVSKALGGN
FT                   WSVQNYYTGNNTMTEILIDSQGDVLVITQYSFPSSSLAQNFFYANSLGNIEQYGSNIIS
FT                   YYSHGLSESLYVLNGGKVYYISYVATASTSMPSISQLLSLIK"
FT   sig_peptide     complement(336587..336670)
FT                   /locus_tag="YN1551_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            complement(336867..337313)
FT                   /locus_tag="YN1551_0376"
FT   CDS_pept        complement(336867..337313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0376"
FT                   /product="quinol oxidase-2, putative subunit (SoxI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47545"
FT                   /db_xref="GOA:C3NL31"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL31"
FT                   /protein_id="ACP47545.1"
FT                   /translation="MSTNKRMTPKDYVLWIVTILAFFFFFLWIGDFGNLVYLTQSPITT
FT                   YVQTLWSVTYIAAGGVFAVFMGSIVFLSVKFRAPSEVQTTRRAINIMSYYYVALILDLL
FT                   FAIIVTYEMFIMSTYQFITGILASADLLLFASIIYLVYKLYYPE"
FT   gene            complement(337315..337755)
FT                   /locus_tag="YN1551_0377"
FT   CDS_pept        complement(337315..337755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0377"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47546"
FT                   /db_xref="GOA:C3NL32"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL32"
FT                   /protein_id="ACP47546.1"
FT                   /translation="MEKARIFELSTIVFAIVILTVLGIFSDIYLNSINTGAYLSTTQRQ
FT                   DAIPIKVIAMQYAWEFVYPNGTTTTNELVLKANQTYVLEIQSKDVIHAFYIPQLGFKFE
FT                   AIPGYVYDFYIIVNKPGVYDIWCAEFCGPGHYLMKGTLIVVS"
FT   gene            complement(337733..339265)
FT                   /locus_tag="YN1551_0378"
FT   CDS_pept        complement(337733..339265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0378"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47547"
FT                   /db_xref="GOA:C3NL33"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL33"
FT                   /protein_id="ACP47547.1"
FT                   /translation="MVDEQKAGLFDRFMKWLDDRLGIYGHTLRPAPRYAYSIDYWLGGL
FT                   VLSAFILEVITGALVALYYTPSDPYTSTTYLISKIPYGALLFSLHSWGAYAMVFLLLVH
FT                   MTRNFFVGAYRQPREIMWVVGAGLAGLTLTEAYLGYSLPYNLISWVATTTGLNLFSYMP
FT                   FNLGYLISLFTVVNPDQPGIMSGVDPLVQRFFVFHWIVGGLILALIGLHLYIFEKHGIT
FT                   PPVSQVRPGYPELIDEYQDKIRSDLKWELQPLMRSIGMVIMIFLLTFGAIFLIAGAIPF
FT                   NIAITGGTPKYIMPAFNPVEAAQTPPVPDWYFLFIYFFYKAVSPTNASLIFLGWVVVTV
FT                   LFPFIEEYIFRHKAPHPALRPASIAIGSGFIVSFIVNSVWAALTPGRDIGPIGAEVDGI
FT                   IFLVCFAVIWPLLRYVVQPRVLAKWQSSPLTDGGVVIEYKERRILSGLAVLLINVSILG
FT                   GLIYSLYEVFSLSSNPMINQFLIGQFLGTSLILFSISIFINVVMGIGKSQDI"
FT   gene            complement(339267..340022)
FT                   /locus_tag="YN1551_0379"
FT   CDS_pept        complement(339267..340022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0379"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47548"
FT                   /db_xref="GOA:C3NL34"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL34"
FT                   /protein_id="ACP47548.1"
FT                   /translation="MMNRRTFLRLYLIVGAAVAIAPLIKPLADYVAYFYNELGTMSKQY
FT                   LVVNNTDGLAGFPKYKIANIKDIQQQLSSGCPVYFFAYPLTNEPCFLVDLQVLLGQPVP
FT                   EIPNPYYGQYAGPLGQMKTISGVGPNNSIYAFSDVCVHLGCQLPAQVLVTSENNPGLDT
FT                   QNSVLHCPCHGSLYLLAKGGVVIGGPAPRPLPIILLEYDQSSGDIYAVGTNAPYFSASI
FT                   PRTTPSDNLLYDPRYDYSVPSNPSCSKGG"
FT   gene            340163..340756
FT                   /locus_tag="YN1551_0380"
FT   CDS_pept        340163..340756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0380"
FT                   /product="sulfocyanin"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47549"
FT                   /db_xref="GOA:C3NL35"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010532"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034246"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL35"
FT                   /protein_id="ACP47549.1"
FT                   /translation="MKAQSSMLPVIVGILVAIIAVGVSVYAYYEYQVLSAPTPTVTSTS
FT                   TSTSSQIPLNNNSANKTVFLTIAVLTSGPTFNFNGTSNGQLKIYIPAGWSVYVKFVNEQ
FT                   SLPHNLILLQNTTATPSNPDVGQFGKILYVVGASTSNYQTSGISSGQLDSGLWGPLNAG
FT                   TYMLVCGILGHAQSGMWAVVIVSSNVTTPYATTS"
FT   sig_peptide     340163..340246
FT                   /locus_tag="YN1551_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.728 at
FT                   residue 28"
FT   gene            340866..343238
FT                   /locus_tag="YN1551_0381"
FT   CDS_pept        340866..343238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0381"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47550"
FT                   /db_xref="GOA:C3NL36"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL36"
FT                   /protein_id="ACP47550.1"
FT                   /translation="MMNIKRVLKVALYTTSASDIGQMYITLGIIALLAGAVNAALIRYQ
FT                   LTYQSLSAVDYYNAVSLHGIFMIFFMVMPISVGFANYLIPRMIGAHDLYWPRINALSFW
FT                   ILVPAVFLGLIAPWFGPINTGWYMYAPLSIETSVNYGLGVTLVEIALILSGISSTLTGV
FT                   NFLMTIIKLKKIPYFKMSLFTWSFFATAILLVVAMPPLTAGLVFAYLERLWNLPFFDQA
FT                   LGGSPVLWQNLFWFFGHPEVYILMLPAMGLVGEILPRMVGRQIYGYKALALSSMAIAFL
FT                   SVLGVWMHHMFTAIDNTVAQIVSSATTMAIAVPSGVKVFNWTATLYGGEIRYKAPAILV
FT                   ISFIAIFLVGGITGVFFPLVPLDYAFNGTYLVVGHFHYMVFAILFALLAGLIYYFPYFT
FT                   GKWYHEDLVKSGTIMIVAGAFLIATGMIIDGVLGMPRRYAAVPSVIYIPFQQMTDVGGV
FT                   LMGIGLIMAFGDLLYSWIKGKVVETIDPWNAIQIGLPDFYIKPVKLPLSFGKSLDGAHY
FT                   EEYHGVSFPYYSILGIVMSFIPLGFMFMFINLIPIGIILLLAFIGTGLYWAYDQWFKQI
FT                   PPPMQLDGGSPVSAGSVNNGMALTPSLGTIVMRDARSAVLWFILAEICLFGSFIGGYMF
FT                   VASPITNPIAYANVPPLRVEYFPLPVIMTVILLSSSIPAHLAYEEFKKGDMKMFKALGI
FT                   LTAVMGFTFLMGQVYEFTHVIHFTPQQSAFTAFFFSTVSLHGFHVIMGLVVWAFVLLRA
FT                   YKGVTPYGGSVAATYYWHFVDAIWVVVFSTFYLHLFV"
FT   sig_peptide     340866..340985
FT                   /locus_tag="YN1551_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.733 at
FT                   residue 40"
FT   gene            343250..343819
FT                   /locus_tag="YN1551_0382"
FT   CDS_pept        343250..343819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0382"
FT                   /product="Protein of unknown function DUF1404"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47551"
FT                   /db_xref="GOA:C3NL37"
FT                   /db_xref="InterPro:IPR009844"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL37"
FT                   /protein_id="ACP47551.1"
FT                   /translation="MNNYFFIAVLIFCIFLIAVSVNPFTEEYMFISPIPYMLAHYSLFG
FT                   AGILLSYYIIRRKIVDKSIAVIVGASIAFLWHYSYFFNLGAEILSVRLIEEVSLVIGGL
FT                   MIGSSLKELSRNFKVLLLALWMIGDSILSLILMISPSLYTTVYAPQGLEYLGIIMFLMM
FT                   NLIAVYLLLKYVNNLLRDEKDVVNEN"
FT   sig_peptide     343250..343327
FT                   /locus_tag="YN1551_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.800 at
FT                   residue 26"
FT   gene            complement(343784..344032)
FT                   /locus_tag="YN1551_0383"
FT   CDS_pept        complement(343784..344032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0383"
FT                   /product="conserved hypothetical SSV1 ORF C-102A
FT                   membrane-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47552"
FT                   /db_xref="GOA:C3NL38"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL38"
FT                   /protein_id="ACP47552.1"
FT                   /translation="MMLDVITTALGLSKGLMESNPIINALYSSLPFPIFVVVFLLIKVG
FT                   VLGLIYVLYKYTKLDLVLILGIGISLLVFINNVFLIS"
FT   gene            344188..344595
FT                   /locus_tag="YN1551_0384"
FT   CDS_pept        344188..344595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47553"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL39"
FT                   /protein_id="ACP47553.1"
FT                   /translation="MSLEDQVLKFLTDISRKEEEIEYLIVNMFKPQLESKGVKLAKIKR
FT                   EFLIDDEGILRIGFSLPIMYYEEGDEIYLFLAKNYADYSTIEQLLIREKILKNKFSKKV
FT                   RSFLIVFAIPKKYYDLALKLGIEVISEKIIS"
FT   gene            complement(344592..345557)
FT                   /locus_tag="YN1551_0385"
FT   CDS_pept        complement(344592..345557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0385"
FT                   /product="protein of unknown function DUF95 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47554"
FT                   /db_xref="GOA:C3NL40"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL40"
FT                   /protein_id="ACP47554.1"
FT                   /translation="MRVLTKIILIVFVFEVVLFLIASSIPQNNPSLVSAFNSTENQVLN
FT                   QSYFGKVLMIFGNNVRVAFLDFIPAVGMIILAVSIYSTGAVLSAFSSSLNVPGILSALG
FT                   LMTLPHSWLELPSYAVAASSGLYIVIRPREWVRGLLTLIIVPIELFLAALVESSEFYVS
FT                   NPYILWLYSIPAFVFLYFLYEFLQKRADKYIKVKTPVTQQQNVIQIQQPTYADYITRYN
FT                   QSWNTASYYETQGNLAEAMRYYWEAIFYLITAVGNKLGMPTLTKEDQDNVIKSVAYKVG
FT                   NPQLYDIYNEAFKIRIENRLSDFQIFKEYLSQLARYLNSI"
FT   gene            complement(345600..346700)
FT                   /locus_tag="YN1551_0386"
FT   CDS_pept        complement(345600..346700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0386"
FT                   /product="translation initiation factor, aIF-2BI family"
FT                   /EC_number="5.3.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47555"
FT                   /db_xref="GOA:C3NL41"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL41"
FT                   /protein_id="ACP47555.1"
FT                   /translation="MKLTVKEVKELFKPKLLPIIWKDESNTLTILDQSLLPFQKVYVDL
FT                   KDVENTALAIKNMQVRGAPAIGITAGYGMVLALINNKNVKTLDDAIRELTRAKTILDSA
FT                   RPTAVNLVWATSRMLTLAKNTVESGNAKAVNELIELMKVEAKKIFDEEYDAEIQMGLYG
FT                   LEKLNDGDTVLTQCNAGGLATGTGLGTALASVKLAKALGMSVSVIAPETRPWLQGSRLT
FT                   VYELMEEGIKVTLITDTAVGLVMYRDMVNNVMVGADRILRDGHVFNKIGTFKEAVIAHE
FT                   LGIPFYALAPTSSFDLKSDVNDIKIEERDPNEVRTIRGIPIAPEDVNVYNPVFDVTPPK
FT                   YITGIITEKGIIYPPFHENIRKIVER"
FT   gene            346753..347715
FT                   /locus_tag="YN1551_0387"
FT   CDS_pept        346753..347715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0387"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47556"
FT                   /db_xref="GOA:C3NL42"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR034239"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL42"
FT                   /protein_id="ACP47556.1"
FT                   /translation="MNLTIIEFESNVLRDNPLKDPNRRRVGIIYPEEYEGRPILIYLSG
FT                   YLSSSLTQINYNPLGEDMKRKVERLINEGKMKGSVIVLPDMFTKVGGNQYINSSAVGMY
FT                   EDFLIKELIPFLKDKFKSDKIGIFGHSSGGYGALALGMKYSNVIKAIADHAGDSYFEYV
FT                   YLPTFPKAIEQLRRFKTPEEWLENYWKKENKQHREDLNTLNVIGMAAFYSPKDEKIELP
FT                   FDLETGEILEEVWRKWLDKDPVRMVDKYADNLKMLKFIFIDVGKKDEFNIQYGSRTLHK
FT                   KLQKYGINHYYEEFNDGHLHTTYRYDISLSLLEKALMSE"
FT   gene            complement(347701..348087)
FT                   /locus_tag="YN1551_0388"
FT   CDS_pept        complement(347701..348087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47557"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL43"
FT                   /protein_id="ACP47557.1"
FT                   /translation="MQVIKILMIMCTVVDDSNRLDLFSRGKFVVLFDSKNREILFKEEN
FT                   PALNSSTKRPLVAKECVRLRAEMVIAAHGSLCYPSYSILRKANIKMLVGNIGDSIYTEN
FT                   LRAVSKWEVTYSSFLAIKERLFGH"
FT   gene            complement(348112..349047)
FT                   /locus_tag="YN1551_0389"
FT   CDS_pept        complement(348112..349047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0389"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47558"
FT                   /db_xref="GOA:C3NL44"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL44"
FT                   /protein_id="ACP47558.1"
FT                   /translation="MLFCKNVNMKILTFGGTGFVGSNFVRYALSKGHDVLVYARNMNDY
FT                   AKALQNAGANIIFSYDDHSKDVDCLVYFIGAMWTKDPKEFQYLQVKFPTEIGRKFFQVN
FT                   SGKFVYISSIGVSENIDSKERPILEESPHGEGLKPNTLHGITKLEGEKSISKFPNYVIL
FT                   RFPIIYGPYSRILMWRIFMWLTSHGIGIKNDNMFSVVSTRNASKAIELACKYKSNDYFY
FT                   ITDKEPVNLTSLFSDAAKAINREIKSWFPFSVKLIEPFKSSHEMLKMAYDVLSRELVYS
FT                   YKKAERELGYIPEDVRVETFKEMARYYKII"
FT   gene            349104..349316
FT                   /locus_tag="YN1551_0390"
FT   CDS_pept        349104..349316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47559"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL45"
FT                   /protein_id="ACP47559.1"
FT                   /translation="MNYSKFWTRFKEWALTTNDEDILPYKLRKIIEIIRQNPDITLVRL
FT                   AGYLDTDALYLARYLLNSYKSLVET"
FT   gene            349362..350330
FT                   /locus_tag="YN1551_0391"
FT   CDS_pept        349362..350330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47560"
FT                   /db_xref="GOA:C3NL46"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL46"
FT                   /protein_id="ACP47560.1"
FT                   /translation="MKKSEIKEIEPWGVNIPFIFLAIAYWALGSLSLPLNWSYHPYFMM
FT                   LGAYALYFGMIQRLFFPAKNYLALHIASLIFLAIPIYYFQIIASVALAITEVKALLDLR
FT                   NYGYNAKKLPINALVLSSPFASIITWLLYPNYWLLITPLLLYILGVNVGVFSVNLRTRP
FT                   VFGLYQLPIFLIIISSYFFPILFPFIGVVYFLTIYRKTFTFKNTSAISSLLSLIVIPLL
FT                   SLYFGDFVHAFTLGIMSTLFFSCITYSTSRYNYDKIVISIILSDLAYILRFFYFKISGI
FT                   FWVIAVLYFLYLIRDNFYLTSIKLGLSMRFIRMQKESHESP"
FT   gene            complement(350293..351513)
FT                   /locus_tag="YN1551_0392"
FT   CDS_pept        complement(350293..351513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0392"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47561"
FT                   /db_xref="GOA:C3NL47"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL47"
FT                   /protein_id="ACP47561.1"
FT                   /translation="MRVLAIGNVFNPSGVSVHIKNVLKELVKMGDEVTLYVPSFLVRRN
FT                   YEVLKDLENAHVNVHHSVYEVKEAEEVGTLPYFIKSHTVYLRWNDLGQDRKYIDELKEI
FT                   KPDVIYDMHEDSITLRLSYHISKKLDKPLVKLLHDEPFRNSFGRGYKRFLGIKGLAYDI
FT                   LMWMFYKFDKRAFLRSINDGVLRGIAGVSKASFYLSGIEEIARDVRLKVYEVGNAFNRD
FT                   IIYKYRKTKGKEDYAVFFARLVPQKGIRELPRIADLLNSKIVVFGKIFNERDRAILMSH
FT                   PKIEYMGYRPIEEVYSTVAKAKVLIYPSHQDGFSLVVLDTLALGTSVVAYDIPAIRFVF
FT                   SNLKPVRAVREYDVKEMAKIANNILSMKDEEYESEHEDENVKKFLELHSSWANVAKETH
FT                   DFLSAFL"
FT   gene            351778..352296
FT                   /locus_tag="YN1551_0393"
FT   CDS_pept        351778..352296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47562"
FT                   /db_xref="GOA:C3NL48"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL48"
FT                   /protein_id="ACP47562.1"
FT                   /translation="MDPIILSLLLGLSHGIEPDHVATARLLRSRWKIIQFALAHSAGFI
FT                   IIAIPLVILIGDNKFLEMISDIVGIIFSILLLVQAIFNKEIDIGANKAGLLQGAFVITP
FT                   TKVLVIVIASTGYTLLYSIEIVSSFIIASAASIISLSLFNLIPKRIYKIVDIGIGLLTM
FT                   AYLIFLLVS"
FT   gene            complement(352258..352569)
FT                   /locus_tag="YN1551_0394"
FT   CDS_pept        complement(352258..352569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47563"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL49"
FT                   /protein_id="ACP47563.1"
FT                   /translation="MRRTRDDIIGDILEAIDSNINRISSIMKNVNLSASLAKKYLSMLT
FT                   DDGLIQEVDGEYKLTEKGRKVLEHFRNMRKIELELATIIYEVRKELSANKKEDQVSHS"
FT   gene            complement(352759..353367)
FT                   /locus_tag="YN1551_0395"
FT   CDS_pept        complement(352759..353367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47564"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL50"
FT                   /protein_id="ACP47564.1"
FT                   /translation="MEFLSKRERLVLVAIAQSGPSGTTYSQLSALGYILSKNTIQETIE
FT                   NLYLQGYINVLKDGDEIRYIASKNVRNAIINLEFHKYRLAKNLTELKKKVEDISKMEKQ
FT                   QQAIAFKGILKDLLSSISSSIVSLLDELPALTLPEYMEVLENLYKEFLSKLSPLIQESM
FT                   TEDEINTFISLVGKYRGEKDAEEIKNTLQKIKGGTENQR"
FT   gene            353419..354387
FT                   /locus_tag="YN1551_0396"
FT   CDS_pept        353419..354387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0396"
FT                   /product="GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47565"
FT                   /db_xref="GOA:C3NL51"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL51"
FT                   /protein_id="ACP47565.1"
FT                   /translation="MIRISAPGKILWIGSYSVVFGGISHVIAVNKRVSCRLREIQERSL
FT                   IFHTSYGDFKNSGNELINSVLDTFRERFTQLPQGYEIELYNDKEFILDGKKTGLGSSSA
FT                   ATVSLTACLYYAINGKLDLFEIHKLAQIANFKRQKGIGSGFDIASAVFGSIVYKRFTDL
FT                   EKMDFYYEKLKLGNYDMVLGFTGKSSETVGLVKKFVEKSNLEDFREIMRLIDEENNMAI
FT                   RLVKLNKIDEAVEHVRLGRKYLNYIAERIVGVKLVSKEEEELIKIAEDEGALIALSPGA
FT                   GGGDSIFALGNDLSKVREAWKRRGIITIDVKENEGLKLDSN"
FT   gene            complement(354397..355374)
FT                   /locus_tag="YN1551_0397"
FT   CDS_pept        complement(354397..355374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0397"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47566"
FT                   /db_xref="GOA:C3NL52"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL52"
FT                   /protein_id="ACP47566.1"
FT                   /translation="MLKSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSV
FT                   ITKVTLSDKNIVIVNERILPEDEMKEYAGRVLEAFKKIVGKEFHVKVESKAKFPVNAGL
FT                   ASSAAGIAALTFGLNELLELELKPEELSKIARLGSGSACRSMFGGFVVWNKGLREDGED
FT                   SYCYQIFQHGHWSELVDIIPILSEKEKKISSRKGMIRSAETSELMECRLKFVEKTFNEV
FT                   IEAIRNRDERKFYYLVMRHSNSMHAIILDSWPSFFYLNDTSIRIMEWIQEYGKAGYTFD
FT                   AGPNPHIFTTERYVQDILEFLKSLEIKRIIVSKVGDGPKILNRE"
FT   gene            complement(355393..356073)
FT                   /locus_tag="YN1551_0398"
FT   CDS_pept        complement(355393..356073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47567"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL53"
FT                   /protein_id="ACP47567.1"
FT                   /translation="MNKVIVNKYVIRTDCNDDNILNDLVQTLRKYNVKAYNYKVEFLRD
FT                   KVSVRVIRGNAVLNLSNLYIKELEDILKESKELYTTRFGIEFHNIPSKREILDRLESTE
FT                   LPYSKVDVFKDKVKIRTVNGFTFIDETNLEATYYLSLIFDKVNLKPFNVGRIKKVKDMR
FT                   ALLLLKYYGVRDLELIEKLIDLDLRIEDNEIIIGDITIGEKGILKKEEEVSKKELYELV
FT                   KVNK"
FT   gene            356233..357227
FT                   /pseudo
FT                   /locus_tag="YN1551_0399"
FT   gene            357411..357983
FT                   /locus_tag="YN1551_0400"
FT   CDS_pept        357411..357983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47568"
FT                   /db_xref="GOA:C3NL54"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL54"
FT                   /protein_id="ACP47568.1"
FT                   /translation="MILNILFLEIILTSAFLLIISTGLQFYLESRLPSLSKDLDKITFL
FT                   AKLEALLSLVQLLSSDKVSDMLEGTIIASPLNVKIEELKKYVSANWDSLKGSINILNEK
FT                   IKNVDRIIFLSEEVSVAVSHIVNENKISLVLLIFSSLFLLLNLVSIAFIFSGLAFGILV
FT                   IAITSSLNCVKYANELKSFYSKYTLHR"
FT   gene            358024..358896
FT                   /locus_tag="YN1551_0401"
FT   CDS_pept        358024..358896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47569"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL55"
FT                   /protein_id="ACP47569.1"
FT                   /translation="MVYRQCIRWKKGLVNTQCEIEVQISDDDEVYIIKNGIVKRVKGEN
FT                   DIIPYINAISPAFRALVLSKLPNTMSENLYRLVYKTQPFNEIRKISERTFSIWNGSYPS
FT                   FITFLNLPSEVIKYLPPSRMIEIDPQYYVHIEPLYKSIEKHSEWANDTVYFYGQQVCIA
FT                   LRGCTYFGDEAYSVKDIDQSLNVIKLWLFHIILGSGTVVVDGNVKNLEKFLMLRYDKGF
FT                   EFLESKEEAGKLEIEVNDRKIRMTLNDNELLSLDYTSPRYIKFSYPLSWKSRYSISDFI
FT                   SSLKMWKGT"
FT   gene            complement(358893..360077)
FT                   /locus_tag="YN1551_0402"
FT   CDS_pept        complement(358893..360077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0402"
FT                   /product="manganese transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47570"
FT                   /db_xref="GOA:C3NL56"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL56"
FT                   /protein_id="ACP47570.1"
FT                   /translation="MSIREIVRLFGPAWIVMMADVDAASVLTGVANGQEYGYRLIWLLL
FT                   LLAFPLYVIQEAAGRLGAVNNGKGLGEIIRERYSVKISLLASLSMFMVDVFTYIVEYVG
FT                   IAVGGLVLGVPPYITLPIFFIFHLIIISTKKYDKIEKFLIPISLILIVAFMLEAILRGI
FT                   IPGENVFYFSLSKSFTFLVAANIGAVVMPFMIFYQTSATAYKYQDVASPIETKVKWSSI
FT                   ETFIGAIVSELIMVAIEMATTGISPSVDPLNYKEMSYSLSLISGPISPYIFGIGLISAA
FT                   FLALIVESLGSAWGTLEALGKNSFSNFLLLYISESIPSLAITLLFTNNYDNVINFALTL
FT                   MSIAPFIVIIPSVLIGILIKDKNLMMNYKYGRTRMIIYWITVIIILTGGILAII"
FT   gene            360194..361348
FT                   /locus_tag="YN1551_0403"
FT   CDS_pept        360194..361348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0403"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47571"
FT                   /db_xref="GOA:C3NL57"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL57"
FT                   /protein_id="ACP47571.1"
FT                   /translation="MTIKKIGVVGAGTMGHGIAEVSALANYKVSVVDISWDFLNRAKER
FT                   IMESLNRFYEKGQIKERPEDVMKRIEFSTSYDIMRDADFIIEAVPEIIELKRKVFETLD
FT                   NITPSHAFLASNTSSIPISTIAEVTKRKEKVIGMHFFNPPPIMKLVEVVPSKYTSDETI
FT                   NVTIDLVKKMNKIPVRLKVEVPGFVSNRIFLRLMQEACREVESGEASIEEVDSTARNKL
FT                   KLPMGIFELSDYVGLDVAVDLWNVIVNSGTAEDVKCEMYKRKYEAKELGVKTGRGFYNY
FT                   PAAGKYKKVDLPISSKVDPARLISLAVNEGARLIQNGIVSAKDIDTVMIYGFNFPKGLM
FT                   QMADELGIKNIYNHLVDIYSKGYRAYRPNSLIEELAKSSKGFYD"
FT   gene            complement(361462..362721)
FT                   /locus_tag="YN1551_0404"
FT   CDS_pept        complement(361462..362721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0404"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47572"
FT                   /db_xref="GOA:C3NL58"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL58"
FT                   /protein_id="ACP47572.1"
FT                   /translation="MELKITDFKVFVAQANFEWAFVRIYSKDLYGTGEAGPAPGLKGME
FT                   SEFRQLLIGEDAFKINRIVEKLRYAALYSGTTVYHLISAINIALYDIIGKFLNVPIYKL
FT                   LGGDKTEIPVYVDAHGGKGLEAINALHLPVNLPWIKEAEVETSRLLTTNNPVHGRLSME
FT                   KWNEDYSPEAYAKRALKMKNEGYKAMKFDLDVPTPYIDLRRVRNGDLSLKDIDYMAEIV
FT                   KAVRESVGNEVEIMFDLHWRYNLNTAIRICKSLEPYRLRWLEDPTPAIMAVPNYDELKL
FT                   LTSQCSVPIETGENLYTVYQFKDLLNTGTRVWAPDIVKAGGITEGRRIAELAAMYDIEY
FT                   SPHNIASPIGTMAHAHVGSIANTFGFVEFHGHDVPFWNEIVKPKRRIIGDGVIKLTEDP
FT                   GLGVDLDDEVMRKYWPDYNL"
FT   gene            complement(362767..364374)
FT                   /locus_tag="YN1551_0405"
FT   CDS_pept        complement(362767..364374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0405"
FT                   /product="thermosome"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47573"
FT                   /db_xref="GOA:C3NL59"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL59"
FT                   /protein_id="ACP47573.1"
FT                   /translation="MAYLLREGTQRSTGNEVILNNITVAKILLEMLKSSLGPKGLDKML
FT                   VEGQDVTITNDGATIVKNMEVQHPTAKLLIETAKTVDTEVGDGTTSVVVLAGLLLEKAE
FT                   DLLNQKIHPTAIIEGYRKALNSSLDLLKNIADKISPEDRKIIHDLVYTTLSSKFFSTEH
FT                   TLEKIINLVIEASLAVLDKRDGTYDLDIKNIKIVKVNGGEFDDSELVNGIVVDKEPTNE
FT                   NMPRRLENVKVMLADFPLKLEKTEISMKLGISDPTQIKGYLDEQTAYVKQMVDKIKAMG
FT                   VKLFITQKDIDEVASYLMGKSGIIALKNVKRSDIELLSRATGAKIASSMKDANESDLGE
FT                   AKLVEVRNLGKNKYLFIQSDKAKAVTVIIKGSNNMVTDEAERSLNDAFNSIRNLLLEPY
FT                   IVAGGGAVEEELAKRLRENARKVPGKEQLAFNAFADALEEYVSILSETAGMDPISALTE
FT                   IRHKHANGLKNAGIDIVKARIYDNMFELKVIDSLKVKEQVLKSATEAATAILKIDDMIA
FT                   AAPAKQQPQPQQPNPYLG"
FT   gene            complement(364476..365915)
FT                   /locus_tag="YN1551_0406"
FT   CDS_pept        complement(364476..365915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0406"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47574"
FT                   /db_xref="GOA:C3NL60"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL60"
FT                   /protein_id="ACP47574.1"
FT                   /translation="MSINEKLVKIFYIDGLIVYTRTYMRLDITFYLLVSTLISILTILY
FT                   ISFTLPLAFTYRPKSSQASIKRSEITVLIPVYKEDVDVFKEVIDSVKKQDLKFIVVGDG
FT                   CDEPYKSIVRTKGGLFIKLDKNMGKRRAIREGFKYVKTPYVLLLDSDTILPDDSVDLLS
FT                   SKLIGDIVAVSPEISVLPGKNIIAYHVSEMMQRLREISYRALGRFGSIVSLNGQCILVR
FT                   TDVIRPLIESEEFNSVKLWRFSTILGDDRQITNYIYSNGYKATVTKDVVVKTKAPDTIS
FT                   GLLKQMVRWYRSNNFFLIKEIGDGTIFKKGFFYMFTVLYWYALPLLTLLSYSLYTEIIL
FT                   SHVAKHWDFIVRAIITNPTKFIENVIVYRIDNLFDIDPTPIFHKFSHFFPHHFNPSGIM
FT                   LIYGNKLSTEMVLFHYFYVFHTFVGEVSTIVSIVMIVSILLYTRRIRGFALGLLAFPLM
FT                   FFADIFALMTIWRQKKWSGRS"
FT   gene            complement(366090..367190)
FT                   /locus_tag="YN1551_0407"
FT   CDS_pept        complement(366090..367190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0407"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47575"
FT                   /db_xref="GOA:C3NL61"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR026583"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL61"
FT                   /protein_id="ACP47575.1"
FT                   /translation="MKAIIVKPPNAGVQIKDVDEKKLDSYGKLRIRTIYNGICGTDREI
FT                   VNGKLTLSTLPKGKDFLVLGHEAIGVVEESYYGFSQGDLVMPVNRRGCGICRNCLVGRP
FT                   DFCETGEFGEAGIHKMDGFMREWWYDDPKYLVRIPKSIEDIGILAQPLADIEKSIEEIL
FT                   EVQKRVPVWTCDDGTLNCRKVLVVGTGPIGILFTLLFRTYGLEVWVSNRREPTEVEQTV
FT                   IEETKTNFYNSANGYDKLKESVGKFDVIIDATGADVNILSNVIPLLGRNGVLGLFGFST
FT                   SGSVPLDYKTLQEIVHANKTIIGLVNGQKPHFQQAVVHLASWKTLYPKTSKMLVTKTVS
FT                   INDEKELLKVLKEKERGEIKIRILWE"
FT   gene            367346..367468
FT                   /pseudo
FT                   /locus_tag="YN1551_3255"
FT   gene            complement(367463..368362)
FT                   /locus_tag="YN1551_0408"
FT   CDS_pept        complement(367463..368362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0408"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47576"
FT                   /db_xref="GOA:C3NL62"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL62"
FT                   /protein_id="ACP47576.1"
FT                   /translation="MKKVSIVTGGAKGIGAAIGYRLGKQGYAVVIADIDENAGKYRENH
FT                   FRSEGIDSFFIKTDVSSEMDVSNMVERVYDRYGRIDALVNNAGIGFSGKSIEEQTLHEW
FT                   RRVIETNLTGVWLCSKYVVKYMKNTGGVIVNVASTRAFQSEPNTEPYSASKGGIIALTH
FT                   SLAVSLSKYNIRVVSISPGWIDTSSWQVPPRESYLSSLDHGQHLTKRVGKPEDVASLVA
FT                   FLVSDDASWISGVNFTIDGGMTVKMIYIDENVIQDSLTMLFNDVEFSYQIRKLIEKIRK
FT                   ADNKENIKSKLDEFLKLL"
FT   gene            complement(368363..371332)
FT                   /locus_tag="YN1551_0409"
FT   CDS_pept        complement(368363..371332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0409"
FT                   /product="Alpha-mannosidase"
FT                   /EC_number="3.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47577"
FT                   /db_xref="GOA:C3NL63"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL63"
FT                   /protein_id="ACP47577.1"
FT                   /translation="MNFFIFKNHNFIFIYFYARSIFMRSVNELEARLILILGNSFRNLR
FT                   QLRWNLENHNKAYLEVEGKGNSYLVIVDHKGSGLIRLNGKPYFELDRYHTLIPIPFGSH
FT                   KISLELSNYMDFGEKVDISPGIPFYTEIDSNAYRLYIYGSQILDLIRSINDNEVKDDLS
FT                   NSLSKALREAYFESISKEQLFVLSKLIRTTLDVSRMIQEIDDPLDIYKEDENRGKYERA
FT                   LNVLKSELSRLVGKYGKRGELVGTGHAHIDTAWLWPFDETRRKVLRTFSTILTLLDKYD
FT                   FHFIQSAAIYYEWIKADSPELFERIKEKVKEGKWELAALYVESDANMVSGESLARQFLY
FT                   SQRFYLENFGRIANILWLPDTFGFSASLPQIAKLGGVKAFATHKVFWNDTNAFPFNVFQ
FT                   WVGPNGDRLPAVTFGHGKGGYNSDFSASSVLEQYNNWAQKDQPILYSYGYGDGGGGPNE
FT                   DMLIRAEAINLLPILPKVELSGVNDYIQRIVPVEEWRGELYLETHRGVLTSHSKMKLLN
FT                   RMAEIALREAELWSTLARTYDKEVFIKLWKVVLKDQFHDVLPGSAIKDVYKVAYQELED
FT                   VINRANNIAYEAMQKLVGGNGDKTFVFNSLSWDREEFVEVNGKLVKVKVPSVGFSLLEP
FT                   LEVRDKVTVSENKDEYLIENKYYRIRVSKIGQLLSIFDKEANREVLKDRGNLLVAYENI
FT                   PGWADAWDIEKGFEETHFEIKASSSEIVNNDGIVASIKFSYKFRRSEIIQIIRVYADSR
FT                   RIDFITTLKMKDREVLIKSWFKFDLNVERAVSDIPFGVVERFTWTNTSWDKARFEVPIQ
FT                   KFVDFSESDYGVALLNNGKYGATLRGSSVGLSLTKTPIYPDPSTDLEEITFVYSLYPHV
FT                   GDWKRAEVVKRAYELNVPLRVVGGISEVKSESFIRVSDKLILEAVKVAEGDSNSIILRL
FT                   YEYENTRGEAVVELPFNVIEARSLDLLELNEISRDIRTDGNRIKVKYKNRDILTISVRG
FT                   "
FT   gene            371319..373103
FT                   /locus_tag="YN1551_0410"
FT   CDS_pept        371319..373103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47578"
FT                   /db_xref="GOA:C3NL64"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL64"
FT                   /protein_id="ACP47578.1"
FT                   /translation="MKKFILGFNYWPRISNIKMWSRFEIEEIKRDFELMSELGINTIRA
FT                   FVLDEDCADQLGNLKHECKGKIGRFLEEAERHSIKVLLTLIVGHMSGKNWGIPWDIDNT
FT                   IYDKIEQTKRFVGDVVNSFKQSKAIMGWILTNEISLVRVPQNDDVFLRWLKELYSYIKG
FT                   IDDQHVVSVGDNVSPFSHNFLRPENVKGIVDYASPHIYLYDQDPVRHSFQYFMTLEYDQ
FT                   SSRLPVILEEFGFPTSLYSEESHAKFIGLILRGALVYGADGALIWCFSDFPREGDEPYL
FT                   WEPHELTFGVIRQDGSEKIAAKVVKDFSSKIKDIELSSYKVPKRDSAILVPSWFYRNFQ
FT                   FVYEQNKRWDFARVLNQAFTFARLSNIQVTFAREEDENLSSYKLLIIPSVTRLLTTTWR
FT                   KLLKVVENGSTIYFSTYTLTHLSATHLWEELFGVIPSNYAGSKGVKVPERIRLDNNIYE
FT                   LGQSNLYTYSFKEKDAKVIGVDDNNNGVIFIAKRGKGNAILSTIPLELISSNNEIMDKR
FT                   HLSLYNYIGRVANIEQSFPKQDFGVEIQYLEGKGESLIAVLNHTWEDKEYELNVKVKED
FT                   MDSCQGVVRAKSGCLMRV"
FT   gene            373141..374376
FT                   /locus_tag="YN1551_0411"
FT   CDS_pept        373141..374376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0411"
FT                   /product="oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47579"
FT                   /db_xref="GOA:C3NL65"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL65"
FT                   /protein_id="ACP47579.1"
FT                   /translation="MALGIAFLGSGFSARFHLRGLVGVRNVEVKGVYSRNLNSSKEFAG
FT                   LSEQLGLGKPKVYDDISKMLSDKEINAVWLTVPNDAHLEYTKLISEEVSQGRSNVNGIA
FT                   VEKPLARNVKEAKEMIRLVEKAGLLHGYLENQIFMPSVVRAKEAIWEMGARNSGRPYLA
FT                   RAAEEHSGPHNSWFWKPTISGGGALIDMTCHSLEATRFLLTDPSKDKSSLKPKHVYAVI
FT                   ETLKWNKEEYARHLKERHNVDFVKEPAEDYALTVITYEDDIGNLIMAETRTSWNFVGAG
FT                   LRLSVEVLGPEYSVNINTLQSELSTFFSRNIKLPPSETFVEKQNADQGLMPIISDEAVT
FT                   YGYQGEDRHMVESFLSRKMPLENWYDGLLIVQLMMHAYLSAENGRKISFDPQQVEDFIP
FT                   KVARESVPSANN"
FT   gene            complement(374552..374833)
FT                   /pseudo
FT                   /locus_tag="YN1551_0412"
FT   gene            374876..376120
FT                   /locus_tag="YN1551_0413"
FT   CDS_pept        374876..376120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0413"
FT                   /product="transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47580"
FT                   /db_xref="GOA:C3NL66"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL66"
FT                   /protein_id="ACP47580.1"
FT                   /translation="MTKSKNNPGRGNTIRESNTMKVMEEIREKIRKAIKEGVSLREIEE
FT                   IILQEAMMEEREAYLEVEDDHKNGTYFRYLGTGDGVLRLRVPRTRKGGFRPKILPEKYE
FT                   RTSPDYEDFLQQLVLSGMTPSQVKAVLAAKGIPYSEIVMNRVAERISNKLKEYKSRELP
FT                   HDLLALYIDVKIVKVRISESIMERAIYIAIGVDLEGNKFVLDYEVRDREDLDGWKSFLS
FT                   GLVSRGVSRVDVIVSDDFSGLDRVVSTLFPSSQHQLCITHMVRNLMRVLPDKEKEELMI
FT                   RVRDLKSSRNVEEGRKAILSLSQLVQPFSPARAKRLLDAADKYCSFLNFPREIRHYLYT
FT                   NNTSESFNSTLARFEEELGGYFPSLRSLEVYLYVSIHESNSRWKFRPMSVIRHYSYHLK
FT                   QLHASRFQVSLDEDF"
FT   gene            complement(376149..376814)
FT                   /locus_tag="YN1551_0414"
FT   CDS_pept        complement(376149..376814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0414"
FT                   /product="Transposase, ISC1234/ST1916"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47581"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL67"
FT                   /protein_id="ACP47581.1"
FT                   /translation="MKHWIEYYNGPVPYEHLSARHKTLVKMNYMLITSEVLSRLSDLFI
FT                   LRALIVMIVWTCSYRDVRSYYESDVVVRWFLGEYKSKSEIHRRAKKFRGEVKTLFKEYA
FT                   KELEGKMSRLADYLPSSALYGKVGKLWIVDSFLIEVPFGKRNKETLKKKFELDLRQRKY
FT                   REAANTLFFYIKCKVRRRFKGEFTKKRNRSYFGFKVFNLMSPTMIVHEIQVELGGYWV"
FT   gene            complement(376982..377104)
FT                   /locus_tag="YN1551_0415"
FT   CDS_pept        complement(376982..377104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47582"
FT                   /db_xref="GOA:C3NL68"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL68"
FT                   /protein_id="ACP47582.1"
FT                   /translation="MLKNFTFIILSKKYIFYNYSIETLNLSVILLNVLFLNGGI"
FT   gene            377333..379504
FT                   /locus_tag="YN1551_0416"
FT   CDS_pept        377333..379504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0416"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47583"
FT                   /db_xref="GOA:C3NL69"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL69"
FT                   /protein_id="ACP47583.1"
FT                   /translation="MPREIGRPVRRIIEDPSLITGKGRFVYDIDFKGTLYAVFIRSQYA
FT                   HAKIKSIRCPEGALCYTAKDLPDLIGLAKEEALYQGQPLAVVLAEDEYKARDLAEQVEV
FT                   EYEPLLAVIDVEEALKNVNKAKSDLSSNIVLEDNVEIGDVDSAFKNAYKVVEAEVINQR
FT                   VIPSAMEPRGAVAYFDGRRLTVWSSTQNVFGLKDTLIQLLSKYGVNDVRVVQPFVGGAF
FT                   GSKIYIYPEEALISYLAVLTGKPIKWFNTRTEEFMSTNHGRDMRLKFKAAFDKEGKLLG
FT                   IEGTLIMDLGAPIREIYEDSFGMATTAARLLVGRYKVNALKVKVLGVATNKTFIGPYRG
FT                   AGRPEATYFVERILNLGARALGVDQFEIREVNIIDEVSHYNTPTGMYYDSGKYRETLKI
FT                   AKPFYHELLRKRDELRAKGKLAGVGVAIVSEIASFGTGTARVQLTPNGRIQVVSGFTPH
FT                   GQGDATAFAQIAAEIFDVDVSQIDVLWGDTDLISHGSLTGGSTTLTVGGSAVYEASIRL
FT                   KEKLLRVVGEKLGVRPEEIEYRNGKFYHKKGEMSLADTAREALRMGVYPEEEYSYTIRP
FT                   YTSPYGIHIALVEVDRETGFVKVLEYKAIDDVGVVVNPLLAEGQVHGGALQGISQALYE
FT                   ETVYSTEGSLITSNFSDYVIPTAMEAVKVEWKSLALAKSDTPLGSKGIGELPAIAATPT
FT                   ILHAVEDAIGKNIYIMPTKPELILKLLNS"
FT   gene            379583..380716
FT                   /locus_tag="YN1551_0417"
FT   CDS_pept        379583..380716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0417"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47584"
FT                   /db_xref="GOA:C3NL70"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL70"
FT                   /protein_id="ACP47584.1"
FT                   /translation="MKPLRLYSLLNNLAISLVNPFVSFFTASYGITGALLAIVSSANTA
FT                   FPGIIQYVLANLYIKAKKLIAIGSLFGGLLWILIGVYAIYNEYFVLVYSIISACLGAAN
FT                   FGWLLILDKISTTHRGRTLAYYNFYASIGGLIATLITGFIVGNNLDLMRYFFIISGLIY
FT                   AFNAYVIYNSDVDAEFARGNGIKLFSSNLEVRKFILTNFIFTFVWSMAWPIFPLAQVYK
FT                   FHMNEFQVAVINVTGGTSTLALQRLVGRLVDRHRKFVMFFGRFALATFPLAYAFSTTPY
FT                   EIYIANLVSGFTNSASISYTAFLFDHSDYYEKRINIALYNMFNGIAALLGSTISSLMFN
FT                   LISEWFSLAVGINIMLIGIGIMRMLMSLLYLKIKEVF"
FT   sig_peptide     379583..379717
FT                   /locus_tag="YN1551_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.784) with cleavage site probability 0.252 at
FT                   residue 45"
FT   gene            381002..382096
FT                   /locus_tag="YN1551_0418"
FT   CDS_pept        381002..382096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0418"
FT                   /product="oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47585"
FT                   /db_xref="GOA:C3NL71"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL71"
FT                   /protein_id="ACP47585.1"
FT                   /translation="MLDMKLGIVGLGGWVTTGHLPALTDLGIKVDYCADIDEKRVKDFS
FT                   QKTGCKGYLDYKEMLRNENPDLVLVAVPHSLHATIALDAINSDANVYVEKPMATSFQEA
FT                   LTLVEASRKRNKVLVVGHENRFNPAMLIAKKLIRSGEVGKIYHMRGFYIRQRGIPTSPT
FT                   FIKKDLAKGGAVFDIGTHIVDLLLFLSDFPMPKSVTGKTYSAFSNDKTKFSVYPSPNLP
FT                   NFKVEVEDFGSAFLNLGDEISAYMEVSWASYIKENKMEVVVLGNKGGIHIDNGMLNFMR
FT                   NIADELFLSTPSTQQQRGSVYREVWRTVMDSISKGIPEYPLCSAEQGAIGVAILESIYK
FT                   SALEGREVKIDIPQWLLKQSQPVS"
FT   gene            complement(382071..384662)
FT                   /locus_tag="YN1551_0419"
FT   CDS_pept        complement(382071..384662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0419"
FT                   /product="Domain of unknown function DUF1854"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47586"
FT                   /db_xref="GOA:C3NL72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR015005"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL72"
FT                   /protein_id="ACP47586.1"
FT                   /translation="MKRASIVTSKFKAEVKTDLDRELNLREELVKIDGNRVSVFDGDKE
FT                   VFSVDNVIKLSLETGISVDKLIGFTSDGKEIEIAYFTKRKEELFKKVIDAFNKGEQIEV
FT                   KDEKSEEGVRVGVGTLRWLWNIASRYRKTMIFGATLSLITTGLNLVPPYLLKILIDSVL
FT                   LSPSHPSTLFINIIVYLIASYSALALLSSIQNRTLNNLGSRIINDLREILYKHAINHDY
FT                   SFIERISPSRILSRLTTDAGNTNWLLVWGLPTLVTNLFTIIGIGVILFTLNPTLAAFIL
FT                   IPVPAIIYLIISYRRKSHRLYHRNWRRSADITSRINDTIPNFLVVRSFSKEEYESKRLR
FT                   EMLNKLYESSIAINKMNSVYWPLMGFVVNLSTVLIWWVGGHEVISGIIEIGVITAFIAY
FT                   VSQFYGPINNLSNVLPFIQQSLTSAERIREVLEVKPQITNPENPKRPNMPAEIRFEHVY
FT                   FGYDPHFPVVKDINIEIKPGEKVAIVGKSGSGKSTIAKLLLRFYDVNEGRILIDGIDIR
FT                   EIDLNYLRRKVAYVPQDVVLFDTTVGYNVVYGTDNLSEVDVIRACKIAKIHDEIVKLPF
FT                   AYDTILGERGTYLSGGQRQRLSIARAIIKNPDVLIFDEATSNLDVTSEREVYETMMDVS
FT                   KGKTVIMITHNVHEVMNSDKVIVLSNGKVVEEGKPIELLNKKGEFYKMFKEQINEENVF
FT                   ARMKQNSKEEKIIVNLIDIHNVKIDQSVRRSTVDVIYQGKVYRVLVPKMLFPITKPTFI
FT                   GLYDESGKEIFLIDDYTKLDEKSRKVLENALAYNNLIFQVRKINEINIKGDQLEWDVET
FT                   NKGPIKVYTIGRRNVVVLDSKVVLIDKNDNLYEIDLDKIDRKSFKILVETV"
FT   gene            384758..385717
FT                   /locus_tag="YN1551_0420"
FT   CDS_pept        384758..385717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0420"
FT                   /product="oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47587"
FT                   /db_xref="GOA:C3NL73"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL73"
FT                   /protein_id="ACP47587.1"
FT                   /translation="MKIAVVGCDGFGKVHLRAMKNISGIDYYVFSRNDEKARECAKEFN
FT                   AKSYFTNYEDVIKSDVDIVDLLVSHDQHYPMGAMAMKAGKHLMLEKPIARTIEEAMGLI
FT                   NTAKETKRKFMVLEQFYFESSVRKARELLSRLGNLSLIIVRSTHLYQPKGWRREKEKMG
FT                   GGALIDGGVHFIDTLLNLGGEYESVKGICGRYFSGIEGEDLTLATFKFRKGHLGLLLYS
FT                   WATPNPPKVPAFEVYGEKGSLIEDPNTRVMGKPYGDLILNVDGKEERIEVEKVNPIEEE
FT                   IRGFVNAVKNNTEVPMPPEIALRDLRAALDVYKSCGFS"
FT   gene            complement(385700..386725)
FT                   /locus_tag="YN1551_0421"
FT   CDS_pept        complement(385700..386725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0421"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47588"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL74"
FT                   /protein_id="ACP47588.1"
FT                   /translation="MKYIKLGDSGVKVSQVAIGTWFLPILQEKDELGIHKVDKETTLKI
FT                   LKRAYDEGVNFIDTANRYHGAMAPVDLAHVGNAERIVGEFLKTVNRESVVISTKVRGKM
FT                   GEFANGEGLSRKHIQWQIKESLKRLGTSYIDLYFIHWPDPDTPKLETLRTLNSLVNNGL
FT                   VYYLGVSNHSAIDVMEFLHLSKRYNLEKFVVMQEKYNMLERDIEKDKVDIARRYGLAVM
FT                   AYSPLAQGFLTGKYTDRNGWKVEELSRATISEDLKKRYFTDANLKILLGLKDIASELGI
FT                   TLSQLAIAWLLKRGEQLGVTVIPLIGASKVEHLEDNLSALNVNLRDEHMKRIEEILGKS
FT                   T"
FT   gene            complement(386751..386927)
FT                   /locus_tag="YN1551_0422"
FT   CDS_pept        complement(386751..386927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47589"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL75"
FT                   /protein_id="ACP47589.1"
FT                   /translation="MALLQLRKKEEQPKKEDEKEREEIISIDKLPEEYLRLEYPNDWKY
FT                   LQKVKGYRCFLKL"
FT   gene            387221..388217
FT                   /pseudo
FT                   /locus_tag="YN1551_0423"
FT   gene            388273..389340
FT                   /locus_tag="YN1551_0424"
FT   CDS_pept        388273..389340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0424"
FT                   /product="oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47590"
FT                   /db_xref="GOA:C3NL76"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL76"
FT                   /protein_id="ACP47590.1"
FT                   /translation="MKIRYGVIGVGGHGRNRHLIPLTKLNDKVETIAIADVNKERCEEV
FT                   SLQYKIKCYLDYMEMIEKESLDAVSIVTPTGLHSKIAIDVLNRGVNVLVDKPLGANLDE
FT                   VKEVVNAARKKGLKLMVGYWSRFSPALQYGEEIVAKDLLGEPYVAYGYLVRRRGIPGIP
FT                   TFIDKTFSGGRGVLLDIGCYLIDNLLTLLKFRKPKSVVGKVYTKFGNKKEEVKFNWGSW
FT                   DPENFSLDDYAVGLVKLEGDVSLIIEVGWAANVSHMEEKSYIRVLGDRGGIEATGHEAI
FT                   TDISFHSRTENFLTDTKPALRKVDIYFEMVKAFVDSVLQDKEPPVAGEESVILHSIIDG
FT                   IYRSSIEDKEVKISL"
FT   gene            complement(389335..390177)
FT                   /locus_tag="YN1551_0425"
FT   CDS_pept        complement(389335..390177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0425"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47591"
FT                   /db_xref="GOA:C3NL77"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL77"
FT                   /protein_id="ACP47591.1"
FT                   /translation="MGYVDAHTHVWFKEALPKDFFFNDSGYEYTPPSVQDITNEMDSAN
FT                   IDYIVIIAYPSREIWRTKEDFPINMIRVVKEYANRFSIVGGIEPNKLNLNEAKEWLEKQ
FT                   YEAGVSGFKLHPVHSHVKPNAYREEEGGLKQLELLYEFAQDHNLPVIIHTGTSVFLKAR
FT                   NKYADPIFVDDIAVDFPRLKIVLAHMGRPNYVPTAFQLVRIRKNIYGEISSIPPKKLLE
FT                   YLPRLEEIRYKTIYGSDYGGPGIKSISYNLKEFLSINISEKAKFDMASNNPKALYKPL"
FT   gene            390402..391535
FT                   /locus_tag="YN1551_0426"
FT   CDS_pept        390402..391535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0426"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47592"
FT                   /db_xref="GOA:C3NL78"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL78"
FT                   /protein_id="ACP47592.1"
FT                   /translation="MKYLKIFAILSNLANNLVNPFISFVSAYFGMNSEELALITSATNA
FT                   VPNISQYFLNFIKSKAKLLIFIGTLVNGLLWVISAFIPFNLTFLIVYFIITISIGIANF
FT                   GWNLIMDKISKNSRGSTLSLYLVYGTIGALAATLITGLITGSNTELIREFFLISGLMLV
FT                   GSAYLSRKIETDTTLEERGVKSTSLLKRFLATVFLFNLVLSLAWPIFPLAQVYKFHMND
FT                   ENIAILSVETGVTTILFQRIVAKLTDTKRRLTLFLGSALFTIYPLSYALSNSIYIIYIT
FT                   NLASGFTNAVGSVTYIAYIFDNSDDFTIRKNLAVYNLTVGCGVMTGSILGGVAYSYVSQ
FT                   FYNPMYSINLMLIISSILRFSVSPLFLTIKDTRSKLK"
FT   gene            391556..393025
FT                   /locus_tag="YN1551_0427"
FT   CDS_pept        391556..393025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0427"
FT                   /product="glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47593"
FT                   /db_xref="GOA:C3NL79"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL79"
FT                   /protein_id="ACP47593.1"
FT                   /translation="MYSFPKNFRFGWSQAGFQSEMGTPGSEDPNTDWYKWVHDPENIAA
FT                   GLVSGDLPENGPGYWGNYKTFHDNAQKMGLKMARLNVEWSRIFPNPLPKPQNFDESKQD
FT                   VTEVEINQNELRRLDEHANKDALNHYREIFKDLKSRGIYFILNMYHWPLPSWLHDPIRV
FT                   RRGDLSGPTGWLSTRTVYEFARFSAYIAWKFDDLVDEYSTMNEPNVVGGLGYVGVKSGF
FT                   PPGYLSFELSRKAMYNIIQAHVRAYDGIKSVSKKPIGIIYANSSFQPLTEKDMEAVEMA
FT                   EYDNRWAFFDAIIRGEIMKGREKVVRDDLRGRLDWIGVNYYTRTVVKKTEKGYVSLGGY
FT                   GHGCERNSVSLAGLPTSDFGWEFFPEGLYDVLTKYWNRYHLHMYVTENGIADDADYQRP
FT                   YYLVSHVYQVHRAINSSADVRGYLHWSLADNYEWASGFSMRFGLLKVDYGTKRLYWRPS
FT                   ALVYREIATNGGITDEIEHLNSVPPIRPLRH"
FT   gene            complement(393022..394800)
FT                   /locus_tag="YN1551_0428"
FT   CDS_pept        complement(393022..394800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0428"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47594"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL80"
FT                   /protein_id="ACP47594.1"
FT                   /translation="MKEFKLAVYVTAPTLKSLNEERTNHLIEKLKELGVSKVYLENYRD
FT                   GLTLDANTMVKFKEVFGKQFEVAGGIAIGTWGEGWGEMENFGFKVACLADERNRELVKR
FT                   VVEEHASVFDEIIIDDFWANWCHSEIDVKLFNSMYGLNFTRDTLVKMLRDPVISRLWCD
FT                   YSSSLVYNVSRDYVVEPAKRINGKIKITLKVAEWREDFYHKGLKLDKLSEIFDNIYVGT
FT                   EAREYTARYGSLYIVDYVRGIVGDKLKGVWFDTFIGGEGGDYGSLKTYLQQFILSAFGL
FT                   TEELTLFEAGDILDLERWHLFEGIKENKEKVQKWRVDIKEYGNMGLKRLPVQHFVPQRV
FT                   DKYVEDHLGIIGIPLEVSNVVNSNDIVLITESDIYHIDIVDLLNRGVNLLFTASAAKKL
FT                   IEVLGDTALKILGVSNVIFDSVNANALTKDGKTFYWAYYKRQGNFPIGPIFSLNGAAPI
FT                   LYAYDNSELYPVVFQNTYSNAKVYVISLTSYLPYLISEFYPSIARQIIRDIVGEHISIK
FT                   AISASPLLFSLIVKRDGVVTVLNLNDFPIRLTLSVDSKKYKIKSVEDMKLLQSNENEVR
FT                   VRLKENSFGVLRLENV"
FT   gene            complement(394833..397025)
FT                   /locus_tag="YN1551_0429"
FT   CDS_pept        complement(394833..397025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0429"
FT                   /product="Alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47595"
FT                   /db_xref="GOA:C3NL81"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL81"
FT                   /protein_id="ACP47595.1"
FT                   /translation="MRIGNFNVEIEFIADNILRVLYYYGREAVIDNSLVVLPNLEKLSI
FT                   KGESTSPSIISLSSKSLSVDINTSNGELIIKDNKGGIVVKEKRRDLKFNEELSTYNVEQ
FT                   EFGLSEGERLYGLGQHAGGNGLGQSSAYKLDYNGLSITLSQRNTDIGIPFMISSKGYGI
FT                   LWDNYSLGSISLKGNELRVWFEAGKKIDYYVIFDDFIDDVIKGYRKLTGDTPLLPKWAY
FT                   GYWQSKERYKSQDELVSVVKEFKERKIPLDVIVLDWRYWGKYGWNAFKFDEIDFPRPKD
FT                   MVEEIHKMGAKLAISIWPTFGKETEVFKNMESKGCIIPGTTAVNPFKEGCRELFWSYVK
FT                   RFYDIGIDAYWLDASEPETGLGLVFFSPIHDVDLGIGKGYEHLNAYPLMETKAVYEGQR
FT                   RISDKRVAILTRSAFAGQQRYSAISWSGDVLGDWATLRSQIPAGLNFSISGIPYWTTDT
FT                   GGFFSGNPETKAYAEIFVRWFQWSTFCPILRVHGTIFPKEPWRFPKEYQDVILKYIRLR
FT                   YELLPYIYSLAWMTYSNGYTIMRPLVMDFRNDKNVYDLDEQYMFGPYIMVSPVTLPSIR
FT                   EKDVYLPSDEYWYDFWTDEKLEGGRTTDVKVSLGTIPLFVRGGAVLPLLGKDVSNAMED
FT                   WDVLHLRIYPGKDGYFEIYDDDGVTYDYERGKYFIVPIRWDDNKQELTIGKKRGDLEMR
FT                   KRIMITWVEKGKGIEYSKPDVEVEYDGKESITVKRH"
FT   gene            397176..397802
FT                   /pseudo
FT                   /locus_tag="YN1551_0430"
FT   gene            397915..398112
FT                   /locus_tag="YN1551_0431"
FT   CDS_pept        397915..398112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47596"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL82"
FT                   /protein_id="ACP47596.1"
FT                   /translation="MLIEPKEDTTLELYYLTKDHSSLIDEVKLRGNKLNVIPISVKGTI
FT                   MKPIIRRCKDVNIAKAKILF"
FT   gene            complement(398182..400833)
FT                   /locus_tag="YN1551_0432"
FT   CDS_pept        complement(398182..400833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0432"
FT                   /product="alpha-L-rhamnosidase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47597"
FT                   /db_xref="GOA:C3NL83"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL83"
FT                   /protein_id="ACP47597.1"
FT                   /translation="MSKIIDLRVEFTINPLGLDEPKPRFSWIFMTAIRGNSQKAYRIVV
FT                   GSLNNITKDSGDVWDSGIVESDDNIVEYKGLPLKSYTRYYWKVKVWDKEGKEYSSDIAW
FT                   FEAGVIEPKDWTWIGGGQLMRKEFVIDKEVEEARVYISGLGYYELRINGNRVGDKALDP
FT                   PWSEYTKTVYYSVYDVTKLIRKGVNATGVILGRGRFGQRFGSVKYYGEPRATVMLRVKL
FT                   IDGSLVEINTDENWKCLQSGPIISDDIYLGFRYDARLELKGWDLPGFDDSSWMSCSKLP
FT                   PIGKLRSSATIPATKVMAILKPRDHLNPATGIHVFDFGQNITGWVRVKVKGGIEGSEIR
FT                   VRYAELLNPDGTLNTLDLRGAESTDVFILRGEEVEILEPRFTFHGFRYVEITGYPGTPS
FT                   MDDVEAEVIHADLEPIGSFVSSNNLLNSIHRITLWSLKGNLMNGVETDCPQRDERMGWL
FT                   GDAWLSSDSAVLNFNMIRYYEKFIKDIIESQKGDGSISDVAPPYWEIYPADPAWGTALI
FT                   YIPWALYVYYNDKRILENSYDAMKKWWNYLNSMTKDGILYFNKYGDWVPPGRVRSVEHC
FT                   PPEIISTWILYRDTKLLSRIAKILKKDTEAELFEEKAKQILEAFNRNFLSEVSMSHYST
FT                   MGYYSTYTSPDGSKVKFGGSQACNALPLVEDMVPKEALEQVVKSLVKSVEVDWDKHLNV
FT                   GIIGAKYVPEALARYGYVDLAYDTLTQESYPSYGYMIKEGATTLWERWEKLTRSGMNSH
FT                   NHHMFGSVDNWLYKYVAGLEVLEPSFKKVLIKPWLYKRLSHASASVRSIRGLVSVEWEL
FT                   RNSVFKLKATIPSFAEIHLPKISEKVEVLESGSIISEKTPGILSIKEGSDWIIVEASSG
FT                   NYDFEVRSVKGR"
FT   gene            401143..401685
FT                   /locus_tag="YN1551_3256"
FT   CDS_pept        401143..401685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_3256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_3256"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47598"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL84"
FT                   /protein_id="ACP47598.1"
FT                   /translation="MVKIRIKDVKVKSIAVPIRGKLLRVAGEHPGRNVFTLVEIITDKG
FT                   VTGYSETGGGGFSLAPLIEKLKDQLIGEDAFNIRKLKWKTASPITATYYNQLLTVCPYT
FT                   FISIILYSFMIECRDLALNHLPNLTVDGSWDSFDPNGTGLTSPTLFIRLYSETTSLCHL
FT                   SFSFSQTPTLGALPPSG"
FT   gene            401179..401430
FT                   /pseudo
FT                   /locus_tag="YN1551_0433"
FT   gene            complement(401448..402666)
FT                   /pseudo
FT                   /locus_tag="YN1551_0434"
FT   gene            complement(402650..403285)
FT                   /locus_tag="YN1551_0435"
FT   CDS_pept        complement(402650..403285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0435"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47599"
FT                   /db_xref="GOA:C3NL85"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL85"
FT                   /protein_id="ACP47599.1"
FT                   /translation="MERLLRPKEACQLLGISYSTLLRWIREGKIRVVTTEGGKYRIPYS
FT                   EIKKYLKRREETRAVIYARVSSADQKEDLERQINYLTNYATAKGYKVVEVLKDIASGLN
FT                   TQRKGLLNLFKLVEERSIDVVLITYKDRLTRFGFEYIEEFFSTMGVKIEVIFGEEPKDA
FT                   TQELVEDLIFIITSFAGNGMRSHKKTLLVQGVKKLIGELSGEDDEVKG"
FT   gene            complement(403434..403926)
FT                   /pseudo
FT                   /locus_tag="YN1551_0436"
FT   gene            404275..404505
FT                   /locus_tag="YN1551_0437"
FT   CDS_pept        404275..404505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47600"
FT                   /db_xref="InterPro:IPR039709"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL86"
FT                   /protein_id="ACP47600.1"
FT                   /translation="MGKTVVISVRIPEELERELKKYGINEVEVIRKALINEVKKAKAKE
FT                   LEERINEVADILKKIPFENVVKSIREDRESR"
FT   gene            404502..404891
FT                   /locus_tag="YN1551_0438"
FT   CDS_pept        404502..404891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47601"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL87"
FT                   /protein_id="ACP47601.1"
FT                   /translation="MSYVFDSSSIYKAFSFNKLSILGGNYTAILSKFELGNVIWKEVTI
FT                   FKRITEDEGEKLYQFLLKVLETMNLEDLKYNEVEKIGIKNRISFYDASYVWLARNLSLP
FT                   LITEDEKLRKKVSGFVNVMSLEEIK"
FT   gene            405074..405832
FT                   /pseudo
FT                   /locus_tag="YN1551_0439"
FT   gene            405816..406727
FT                   /locus_tag="YN1551_0440"
FT   CDS_pept        405816..406727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47602"
FT                   /db_xref="GOA:C3NL88"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL88"
FT                   /protein_id="ACP47602.1"
FT                   /translation="MTGRYKVLIVLIILLVGVIALLYYRVGNQQETCEQQKVYFNFNLE
FT                   EALNFYESLNTSLWLLREYPGSHTIWLADDQALDYNALMLIYNITHNVTAKMLAEQILI
FT                   AIKPYGGLYKYYNSVFEIFGIYPSTTTPQSGVDIIVGNIDNYTLKATLFNHTISNYYDY
FT                   ADLLAYRVLLWLQLGNYSGAEENFISLVKMWNGIGFNDSAYYNDTYQSYKLALFLIVWR
FT                   ALELNPHTCLLATKYVNMTREVSNIMSLLQSSQGGVWTNYKYVNGKIEYGYNISSMNGE
FT                   TTSLFVIAYALMSTNISIPITS"
FT   gene            407223..407474
FT                   /locus_tag="YN1551_0441"
FT   CDS_pept        407223..407474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47603"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL89"
FT                   /protein_id="ACP47603.1"
FT                   /translation="MPVISIRIDEKLKRKMDELSYINWSEVIRRKIEEVIEEKERKRKK
FT                   ERKDYRRISVASVKSFEFFLNYGGKNSEEVIREWREKN"
FT   gene            407710..407880
FT                   /locus_tag="YN1551_0442"
FT   CDS_pept        407710..407880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47604"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL90"
FT                   /protein_id="ACP47604.1"
FT                   /translation="MLSEIISLSSKYGITIYDAAYIVLGKVLGDKVYTADEKLLRKVKE
FT                   LHFVIHIKDFK"
FT   gene            complement(407845..408009)
FT                   /locus_tag="YN1551_0443"
FT   CDS_pept        complement(407845..408009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47605"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL91"
FT                   /protein_id="ACP47605.1"
FT                   /translation="MPILAQSTSVQPEGSMVIVAANGPWQDNFNPWNDPNGQAELPLLF
FT                   KILYVNYKM"
FT   gene            408433..409242
FT                   /locus_tag="YN1551_0444"
FT   CDS_pept        408433..409242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0444"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47606"
FT                   /db_xref="GOA:C3NL92"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL92"
FT                   /protein_id="ACP47606.1"
FT                   /translation="MYWKVGIISDEISLDFEHAVKVIKELGAIHVEVRNLWNKNITQVS
FT                   DSEFSEIRNIVEKYGLTISNLDSPTFKIYINDEKGYKEHLQILRKVIELSKKIDINYTR
FT                   IFTFWYEGELKYYIDKLAERFNSAIDIAESEGVTLVIENEYSCLVGIGKELRTFLDKIK
FT                   SKWVRVLWDPGNAFFARETPYPDGYELIKDDIMHLHIKDAMVKDGHFIWMPVGKGMIDY
FT                   KGQLRVLKGKPYVISLETHYRNAANDPEASTKESFNGLMKILREITS"
FT   gene            complement(409268..409504)
FT                   /locus_tag="YN1551_0445"
FT   CDS_pept        complement(409268..409504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0445"
FT                   /product="dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47607"
FT                   /db_xref="GOA:C3NL93"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL93"
FT                   /protein_id="ACP47607.1"
FT                   /translation="MKVNLMHITDEINVPILIAHSKGNEVLDFRFSMEFYNQIKFTDKQ
FT                   ILLFDKGGHIFYDYEVRQRLYKEVTEWLIKRLK"
FT   gene            complement(409784..412048)
FT                   /locus_tag="YN1551_0446"
FT   CDS_pept        complement(409784..412048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0446"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47608"
FT                   /db_xref="GOA:C3NL94"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL94"
FT                   /protein_id="ACP47608.1"
FT                   /translation="MNSIRSLLNQMNLEEKIAQLQAIPIDALIEEKEFSEEKAKKYLKL
FT                   GIGQITRVAGSRLGLKPKEVAKLVNKIQKFLVENTKMKIPAIIHEECLSGLMGYSSTAF
FT                   PQAIGLASTWNPELVMDIASVIRSQGRLVGVNQCLSPVLDVCKDPRWGRCEETYGEDPY
FT                   LVASMGLAYITGLQGDNQLVATAKHFAAHGFPEGGRNIAQVHVGNRELRETFLFPFEVA
FT                   VKIGKVMSIMPAYHEIDGIPCHGNPQLLTNILRQEWGFDGIVVSDYDGIRQLETIHRVA
FT                   SNKMEAAILALESGVDIEFPTIDCYGEPLVNALKEGLVPESLIDRAVERVLRIKDRLGL
FT                   LDNPFVNENSVPEKLDDHKSRELALKTARESIVLLKNENNILPLSKNVNKIAVIGPNAN
FT                   DPRNMLGDYTYTGHLNIDSGIEIVTVLQGIVKKVGESKVLYAKGCDIASESKEGFAEAI
FT                   EIARQADVIIAIMGEKSGLPLSWMDIPSEEEFKKYQAVTGEGNDRSSLRLPGVQEELLK
FT                   ELYKTGKPIILVLINGRPLVLSSIINYVKAVIEAWFPGEEGGNAIADVIFGDYNPGGRL
FT                   PITFPMDTGQIPLYYNRKPSSFRPYVMLRSSPLFTFGYGLSYTQFEYSNLEVTPKEIGP
FT                   NSNIAISIDVKNVGKMEGDDVVQLYVSKTFSSVARPVKELKGFAKIHLKPGEKRRVKFI
FT                   LPTEALAFYDSFMRLVVEKGEYQLLIGNSSENIILRDIFRIKETKPIVERRIFLSNVQI
FT                   E"
FT   gene            complement(412404..412817)
FT                   /pseudo
FT                   /locus_tag="YN1551_0447"
FT   gene            412959..413867
FT                   /locus_tag="YN1551_0448"
FT   CDS_pept        412959..413867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0448"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47609"
FT                   /db_xref="GOA:C3NL95"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL95"
FT                   /protein_id="ACP47609.1"
FT                   /translation="MNGVFLTNVTPFTKTFELDLEGLKRIVEFAESVGYKYIVPLGTAG
FT                   EFSSLTFEEKVRVIDQVRKALSKGEIIAGASSTSFLETAELCKKYKEIGVDKIMILPPY
FT                   YLKGNEKGITDYFIKVSELCDLTIILYNNPSSAGIDLSPQLIKRLSDIIPSFKVLKEAR
FT                   YNVVEFKEVLRLVGDKIDIIDGLEERALLGLVLGAKGFTTSMGSFSSLPFMIYESYEKK
FT                   RDIDTTIRLYDLLLEYRTFIKFPLTMSHLAKLGAWLRGLISSYVTRPPLPNLDDVISED
FT                   VKRKIIEKINQILNFEKNGIK"
FT   gene            413953..414048
FT                   /locus_tag="YN1551_0449"
FT   CDS_pept        413953..414048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47610"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL96"
FT                   /protein_id="ACP47610.1"
FT                   /translation="MNLDHPTQDNDDVNVKLSLSKRIVRYHGKEF"
FT   gene            complement(414191..415900)
FT                   /locus_tag="YN1551_0450"
FT   CDS_pept        complement(414191..415900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0450"
FT                   /product="Beta-glucuronidase"
FT                   /EC_number="3.2.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47611"
FT                   /db_xref="GOA:C3NL97"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL97"
FT                   /protein_id="ACP47611.1"
FT                   /translation="MRSFYRPKIDLQGFWKFKIDSENVGEKNEWGKGLESEDIIYVPAS
FT                   WNEQNPQWDQFSSIAWYQKDLFVSSYESKKAWIVFEGAGYITKLWINGEYVGTHEGSFT
FT                   QFKFPIKLNTNEFNKIVVKIDNTPSPYNLPPAKDLNIAAFDFFNYGGIQRPVYIEFVDE
FT                   CHVEDITVYTKSNGHLKVEILPECNQKHSLRFKLVDKEGKALLDEESSNEIYEKDVGNV
FT                   TPWSPDNPYLYTLIVEIYVDENLKDSIYERIGFRDVEVKNGRIYLNGKPIFLKGFGRHE
FT                   DFPILGKFMYGAVLVRDFYLMRKIGANSFRTSHYPYSNEHLDLADEMGFLVILEPPLCY
FT                   SNISRVMSQEEIAKMFSDIKYFEKVKHTIKEMIRQHKNRPSVIMYSVMNEPPSDMYEVA
FT                   EFIKKEVKFLKTLDSSRPVTFASHRSVRDLALEYVDIISLNYYHGWYTEWGDIDSGVRT
FT                   VAMELEEIHKKFPEKPIIITEFGADAIYGLHSDPPQMWSEEYQSEMIRKYIEALRKNNY
FT                   IVGFHIWNFADFRTPQNPGRTILNRKGIFTRDRQPKSAAKVVEELFKNKLSS"
FT   gene            416018..417482
FT                   /pseudo
FT                   /locus_tag="YN1551_0451"
FT   gene            416235..417134
FT                   /locus_tag="YN1551_0452"
FT   CDS_pept        416235..417134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0452"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47612"
FT                   /db_xref="GOA:C3NII2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C3NII2"
FT                   /protein_id="ACP47612.1"
FT                   /translation="MGKSKYKRDWSKYDENVITRYELMFPFYVFQHWWELLAEENRNAK
FT                   KTYKAPKEFNDFLAFLHLFLPYRAIEGVLRALERLKIIPTSLDYSTIWERVRNMNIKFP
FT                   EANDQLEVIADATGISTNKGGQYIIAKWGKTKDSKFLKIEIVMDKDQFNVINAEVTSNE
FT                   VQTAVKTVKDLQDKGKKVKKFYGDKAYDANEVYKTGVEVVVPPRENASTRRGHPARRKA
FT                   VREFKRLGYNRWREERGYGVRWRIESLFSAVKRTFGESVRATSFLGQVVEAKLKFWAYA
FT                   WMVHLANSLVGRAPGIRV"
FT   gene            417555..418546
FT                   /pseudo
FT                   /locus_tag="YN1551_0453"
FT   gene            complement(418555..421005)
FT                   /locus_tag="YN1551_0454"
FT   CDS_pept        complement(418555..421005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0454"
FT                   /product="protein of unknown function DUF608"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47613"
FT                   /db_xref="GOA:C3NL99"
FT                   /db_xref="InterPro:IPR006775"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024462"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL99"
FT                   /protein_id="ACP47613.1"
FT                   /translation="MKALFTRQNKRKCMKYKYSYALDSGIPLGGIGTGSVEIRADGRLY
FT                   SWTIFNNGGIAEKNEDRYKYFLTEFDSFFAYEDGKTIRILQAFDYYFGANPYTRPWIRP
FT                   IREIEFIGEMPIAYLNYDNKIKLKAFSPFIPLDVKNSSLPVLIFKFNSEKNTRFFFGIN
FT                   NSFEKGQIEVKDDMIIFKGETSPDDPRYQGSLCVKVIGDEPFSVAYNQIFDFWDDYRSN
FT                   TLAKKKGDNLAIISGKGSNVTFIITWFFPNFVLKDGKRVGHYYENFFNNCVEVMDYVMR
FT                   NLNYLEEKTMQFHDLFYNAEGIESWITDLIGAQIATLVKSTWLTKDGFFGIWEGYFDAS
FT                   DHRKVGKYPYTDGPENTALNTIDVLLYALPGVMLLFPDLAKNIVKDLSNRALKEDTPEY
FT                   VIFSLAFPENLMKYKEEIMKDPTISTDLKKLYGTIKRIVNETGKDPKGRMPHYIRYSLT
FT                   VDTYERIDINPEFVLLYYLIAKYTGDRELLKSVYEVARNAIESIMRTQTMDGLPYLTLP
FT                   SGIEWIRYVNSMLRANDAHKILGYHSLALSMQTLDDWSWLGFSPYVSFLWISALEALNE
FT                   ASKLLSNPQNYEVKELIEKVNKYLWNGEYYMDWYDPISNLRDDSSNASQITGDWYVQML
FT                   DLPEFLDYERRKSVFSSIMKYNYSGEEGVRNGSSNDDITPLGVKLSIQSKAPWSGVEYY
FT                   LALHMFYSGFDEYAKKILRNVYERYEIAGNFWNHIEWGARYMRPLVALSMIYAIEGMKV
FT                   NMLNNEVIIGKSKNLKWILLLPTAWGLLIVNNGKIRIKISHGEFKGKINGVVTTLKENE
FT                   EIEI"
FT   gene            421214..423979
FT                   /pseudo
FT                   /locus_tag="YN1551_0455"
FT   gene            complement(421712..422929)
FT                   /locus_tag="YN1551_0456"
FT   CDS_pept        complement(421712..422929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0456"
FT                   /product="transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47614"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLA0"
FT                   /protein_id="ACP47614.1"
FT                   /translation="MKLRVKVDYKTYSALKEVEKEYREVLEEAINYGLSNKTTSFTRIK
FT                   AGVYKTEREKHKDLPSHYIYTACEDASERLDSFEKLKKRGKSYTEKPSVRRVTIHLDDH
FT                   LWKFNLDRISISTKRSRVFISPTFPKIFWRYYNKGWLIASEARFRLMKGNVVEFYVIFK
FT                   KDVKPYEPKGFIPVDLNENSVSVLVDGKPMLLETNTKRITLGYEYRRKAITTGKSTKDR
FT                   EVRRKLKRLRERDKKVDIRRKLAKLIVKEAFESRSVIVLEDLPRRTPEHMIKDVKDKQL
FT                   RLRIYRSAFSSMKNAIIEKAREFGVPVVLINPSYTSTVCPIHGAKIVYQLDGGDALRVG
FT                   VCEKEKERWHRDVVSLYNLMKRAGDVSPVPLGSKESHDPPTVSGWLRAKSLHSIMNEHK
FT                   MIEMKV"
FT   gene            complement(422913..423554)
FT                   /locus_tag="YN1551_0457"
FT   CDS_pept        complement(422913..423554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0457"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47615"
FT                   /db_xref="GOA:C3NLA1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLA1"
FT                   /protein_id="ACP47615.1"
FT                   /translation="MERLLRPKEACQLLSISYSTLLRWIREGKIRVVTTEGGKYRIPYS
FT                   EIKKYLERREETRAVIYARVSSTDQREDLERQINYLTNYATAKGYKVVEVLKDIASGLN
FT                   TQRKGLLKLFKLVEGRSVDIVLITYKDRLTRFCFEYIEEFFSTMGVKIEVVFGEEPKDD
FT                   AQELVEDLISIITSFAGKIYGMRSHKKTLLVQGVKKLIGELSGEDSEVKG"
FT   gene            424030..425136
FT                   /locus_tag="YN1551_0458"
FT   CDS_pept        424030..425136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0458"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47616"
FT                   /db_xref="GOA:C3NLA2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR026583"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLA2"
FT                   /protein_id="ACP47616.1"
FT                   /translation="MRAIVVKPPKPGVEINDVKIDEDKLSTIGLVKIKVLENGICGTDR
FT                   EIVSGKRTSVKPPAGKDELILGHEAIGIVEVGGYGLKEGELVMPINKRGCGKCLNCLVG
FT                   RPDFCETGEGLVAGTKGLDGFMREYLYDDPKYLVKIPLAIKDIAILAQPLADIEKSVEA
FT                   ILTTQKRVPIWTCDDGTFNCKKALVVGTGPTGILFSLILRTYGFQVWIANRRELLDNEK
FT                   EILEEPGIIFYNSENGYDNLVKSEGKLDLIIDTSGASASIMQHLVPLLQINGVLGLFGF
FT                   PRYDNFSLDYKTVQDFVINNRIIIGLDNGQKTHFQQAVIHLASWKSLWPNTTSKMITKV
FT                   ISISNEREVISSLREKLPGEIKVIIRWE"
FT   gene            complement(425175..427337)
FT                   /locus_tag="YN1551_0459"
FT   CDS_pept        complement(425175..427337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0459"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47617"
FT                   /db_xref="GOA:C3NLA3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLA3"
FT                   /protein_id="ACP47617.1"
FT                   /translation="MKRYKIISTIITVLMLISIGIFAMPILSQPTSVQPEGSMVVMPSP
FT                   GIVWQDNFNPWNAPALPGGLIWLIYEPLAQVNSLSGQTIPWLATNWTFTTGYVYLPNGT
FT                   KVQTLALILYLRHDVYFTDGTPFNATAVWYTLALEQAYPQLAYSANQIANMTIINPYEL
FT                   EMVFKPGVTPMVLYTILEQWPVDPAQWGKIFPVEQLPNGTYVGLNKTGNPFTYPNTNPI
FT                   GTGPYMLYSFSPQEIVLVANPHYWMPGEPRIKYLLYPSYPSNVQADTALNNGQITWAGL
FT                   FEPNIQQQFVAKDPLHYHYYFAPGFPTMLTLNNLKWPLSDPVLRQAISLAINRTAIYYL
FT                   GEYGYEPPATTPLPLPPQQIQYLNSSVLQLAEQFAPSQGNVTAALQLLESHGYKLVNGQ
FT                   LIAPNGTAVPTMAIITVAGWTDWDADLTIIAQDLKQIGITVEVQTPPFTTWYNYMETGN
FT                   YWMGLMWDLISGPTPIQPLSGYLYGYWNSPGNITPIGNSTYFNIERFNLSIIHPTFEQL
FT                   VNWANGNFSINDNAYYSIVNKLAALWIKYMPSIALVYGAEWYEYVNNTVTGWPTQQNYY
FT                   WPAPPWTSLPSTPLPVVLALHLVNQSVPEPWWYYTSQVPSSWYTSNDPFVYQTTTTTTT
FT                   PSTTTSTSTTTTTTTSTTTSTTTTTSTTTTTSVSTTTSVSTSVSTTTATVTTTVSSSSN
FT                   TALYVIIAVVIIVIIIAVVVLGLRRR"
FT   sig_peptide     complement(427251..427337)
FT                   /locus_tag="YN1551_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.838 at
FT                   residue 29"
FT   gene            complement(427493..428296)
FT                   /locus_tag="YN1551_0460"
FT   CDS_pept        complement(427493..428296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0460"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47618"
FT                   /db_xref="GOA:C3NLA4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLA4"
FT                   /protein_id="ACP47618.1"
FT                   /translation="MSDRLIELIHVYKDFIVRKGVFGKEHRPGIWDVNMNIRKNEIVGM
FT                   VGGSGGGKTVIAWMIVGLLKPTKGSIIYTPMGLDVTKADKKQLKQYRADVQLVFQDPYS
FT                   SLDPAHTVKWHIERPLKIYKYKGDIEERIKELLREVALTPPEDFLNKYPFQLSGGQRQR
FT                   VYLARVLALNPKVLIADEPVSNVDASIRASLLDLFKRLRDEKGISIMYITHDIATIGYV
FT                   ADRVYVVKNGRIVEEGDVETIISHPKHDYTRLLAEAVPDPYKRIE"
FT   gene            complement(428289..429284)
FT                   /locus_tag="YN1551_0461"
FT   CDS_pept        complement(428289..429284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0461"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47619"
FT                   /db_xref="GOA:C3NLA5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLA5"
FT                   /protein_id="ACP47619.1"
FT                   /translation="MSEISISVKNLNVGYLSDYGIIKVLRDVSIDIPESKITGIAGESG
FT                   SGKSTLATTTMGFINPPLYVQRGSVIVDGKYDILSMSRDELNKIRGSVISYVPQAAQNS
FT                   LNPIRKVKETFTDILKAKGMDYYANINVVYNALEEVGFTDRQVLDMYAFQLSGGMKQRV
FT                   VIAISLLLNPKILIMDEPTTGLDVVVQYEILKLLKKIQKEKDLTLVIISHDIAMLFQIS
FT                   DYIAVMYGGQIVEYGKYNTLLEEAYHPYTYLLLSSVPTVRSRGKKLPRIPGDFEGFIRY
FT                   PKGCVFSSRCPFATITCKEAPPQTVAYDKFGFYKCIRYPEWRNEVKKAYE"
FT   gene            complement(429281..430252)
FT                   /locus_tag="YN1551_0462"
FT   CDS_pept        complement(429281..430252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0462"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47620"
FT                   /db_xref="GOA:C3NLA6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLA6"
FT                   /protein_id="ACP47620.1"
FT                   /translation="MASRKLYTFNLKIDKYGPVYNLIRGVWEQRVSRVGFYILLGIIVF
FT                   SLIGIFYTPYNPSATNFPRDLPPSPQHLLGTDDYGHDIFSQLLVGGFPVIGVGFAVGLI
FT                   GTLIAILIGVTAGLYAETMIDRVLSAITQIFLIIPGILIIELIGAYLGAVQFKLGYITI
FT                   LFVLSLTGWAWGARVLRSLVLSLRRREYILSSDLIGESKLSIIFNQIIPNNLPFIASNF
FT                   FFTAIYGIAGFTFIYYFGLGSLTQVNWGTMLYWSLGGEAYLRGLWWWYIPPGLMIGLVA
FT                   FSFALINIGIDRVANPRLRIWDVKKYMKKIEKAKEKEEVLTR"
FT   gene            complement(430254..431366)
FT                   /locus_tag="YN1551_0463"
FT   CDS_pept        complement(430254..431366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0463"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47621"
FT                   /db_xref="GOA:C3NLA7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLA7"
FT                   /protein_id="ACP47621.1"
FT                   /translation="MIYTKLTKLLFIVIFIYLYFKDSNSGSLMRRDFLIKRGIYYIIVW
FT                   FIGITIDFILPRLIPGSALASIIYSRIGGAGSNYGQNVQQEIQILVQQLGLAQYQQPLY
FT                   IQYFNYLKEIVTLNFGVSLTEFPVSVSTIITEAAPWTFGIVIPAIVASFFIGNLLGRVA
FT                   ALSRGKISDYAILGLMMFLYTFPVFVTGEILIEVLAIDLHIFPTGGQYNTFQFLKPTMS
FT                   LPFVWSVIYHAILPTLTLIIFSLAGWIMGMRNNMIPILQEDYMNYYRLMGVSEKMVASK
FT                   AYRLALLPNFTSFSISLGYSVLGAVAIEYLFNYAGLGYFFNQAITGLDYPLLSGIFFML
FT                   VTAMVLSNFVADIIYTIIDPRASQEETEGL"
FT   gene            431825..432940
FT                   /locus_tag="YN1551_0464"
FT   CDS_pept        431825..432940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0464"
FT                   /product="oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47622"
FT                   /db_xref="GOA:C3NLA8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLA8"
FT                   /protein_id="ACP47622.1"
FT                   /translation="MKTILFFILIFNSQYMSKRIGVAVVGLGSIGKTHVKALKDLEKET
FT                   EFVKLVAVVDQIKAIAEKIGSEYGTPYYTTIDEVLRNSEVDVISIATPSYLHAPQAILA
FT                   IEYGKHVIVEKPMATTLAGAREMVSRAERNEVKLGVIFQERYAPDIRRLKNDILKELGR
FT                   IYLIESELKWYRDMKGYYKRDEIARSWRGMWNTEGGGVMTNQGIHTIDLMIWLNGEVEE
FT                   VSGFVDNLTHDGIEVEDTAVAIMRYKNGALGTISQTVSMKPTTYQYRKIRVNGSNGFVE
FT                   ITDGSLSTVAIEGKIEESKSSVEYKKETIAQPGNLHKELLRDFLRALSEDNDFPINGKE
FT                   GMKSLEVIKAVYLSSVNRQVVKLPLDVRIVV"
FT   gene            433122..433820
FT                   /locus_tag="YN1551_0465"
FT   CDS_pept        433122..433820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0465"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47623"
FT                   /db_xref="GOA:C3NLA9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLA9"
FT                   /protein_id="ACP47623.1"
FT                   /translation="MKLGIQSYSLRKLTYENALKVMSELGISYVEAFPRHLPPSSNSVK
FT                   DIINLHKENGVKVIAHGVNHLKSDKKELRSIFDFANKVEIEVITADPDEDCLNLMSDLV
FT                   KEYDIKVAIHNHGPYHRWGSYKKIYEFTKNLDYRVGMCLDLAHLFRYGENPIEAVNTLR
FT                   DRIHDIHVKDVNNKGEDVIVGSGILDVKGVIDKVKELNLDIPLMIEYEPEPENPLPGIV
FT                   KSLEYVKKLL"
FT   gene            complement(433812..435893)
FT                   /locus_tag="YN1551_0466"
FT   CDS_pept        complement(433812..435893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0466"
FT                   /product="Alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47624"
FT                   /db_xref="GOA:C3NLB0"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLB0"
FT                   /protein_id="ACP47624.1"
FT                   /translation="MQTIKIYENKGVYKVVIGEPFPPIEFPLEQKISSNKSLSELGLTI
FT                   VQQGNKVIVEKSLDLKEHIIGLGEKAFELDRKRKRYVMYNVDAGAYKKYQDPLYVSIPL
FT                   FISVKDGVATGYFFNSASKVIFDVGLEEYDKVIVTIPEDSVEFYVIEGPRIEDVLEKYT
FT                   ELTGKPFLPPMWAFGYMISRYSYYPQGKVVELVDIMQKEGFRVAGVFLDIHYMDSYKLF
FT                   TWHPYRFPEPKKLIDELHKRNVKLITIVDHGIRVDQNYSPFLSGMGKFCEIESGELFVG
FT                   KMWPGTTVYPDFFREDTREWWAGLISEWLSQGVDGIWLDMNEPTDFSRAIEIRDVLSSL
FT                   PVQFRDDRLVTTFPDNVVHYLRGKRVKHEKVRNAYPLYEAMATFKGFRTSHRNEIFILS
FT                   RAGYAGIQRYAFIWTGDNTPSWDDLKLQLQLVLGLSISGVPFVGCDIGGFQGRNFAEID
FT                   NSMDLLVKYYALALFFPFYRSHKATDGIDTEPVFLPDYYKEKVKEIVELRYKFLPYIYS
FT                   LALEASEKGHPVIRPLFYEFQDDDDMYRIEDEYMVGKYLLYAPIVSKEESRLVTLPRGK
FT                   WYNYWNGEIINGKSVVKSTHELPIYLREGSIIPLEGDELIVYGETSFKRYDNAEITSSS
FT                   NEIKFSREIYVSKLTITSEKPVSKIIVDDSKEIQVEKTMQNTYVAKINQKIRGKINLE"
FT   gene            436341..436946
FT                   /locus_tag="YN1551_0467"
FT   CDS_pept        436341..436946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0467"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47625"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLB1"
FT                   /protein_id="ACP47625.1"
FT                   /translation="MFAGDSITDREKSNNAPLGYGYVNLFYNLMLAKHPETKITVINSG
FT                   ISGNTVIDLIDRWDDDVLSYKPNWISILIGINDLHKFLGGLTTFNPENYYENLRRLLKY
FT                   TRKVLNNVNFILMTPFYISRNKLEGGFRAKVLELLPQYIEKVRLLSNEFSATYIDLHDT
FT                   FKKLVNIREPNVYAPEPVHPNFTGHMVIALKLLEALEI"
FT   gene            complement(437144..439255)
FT                   /pseudo
FT                   /locus_tag="YN1551_0468"
FT   gene            437763..438497
FT                   /locus_tag="YN1551_0469"
FT   CDS_pept        437763..438497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0469"
FT                   /product="Insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47626"
FT                   /db_xref="GOA:C3NLB2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLB2"
FT                   /protein_id="ACP47626.1"
FT                   /translation="MGRKPVFRQDVSCPSCGSHHVVKCGRPLGRQKFLCRDCGKYFLGD
FT                   ASYHHHSRKLREEALRMYANGMSMRAISRVLNVPLGTVFTWIKRYGRKKHEKLVELWGR
FT                   AKELVKGKVVAKVVDEMWTYLYKNARAFYKWVFTCYVYTKLGVYLIYSVGDRDESTFLE
FT                   VKKYLPDEGRWVSDDYNLYFWLKDHTVVSPVNPNESFHSSLRDRLIRFKRATKAINRSI
FT                   RTMMYSIALVLWERRLIPEFVA"
FT   gene            439233..439478
FT                   /pseudo
FT                   /locus_tag="YN1551_0470"
FT   gene            complement(440079..441566)
FT                   /locus_tag="YN1551_0471"
FT   CDS_pept        complement(440079..441566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0471"
FT                   /product="Alpha-L-fucosidase"
FT                   /EC_number="3.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47627"
FT                   /db_xref="GOA:C3NLB3"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLB3"
FT                   /protein_id="ACP47627.1"
FT                   /translation="MSQNSYKILKSLPVPSNGPFKPTWSSLKKYIVPSWFTTSKFGIFI
FT                   HWGVYSVPAFGNEWYPRYMYMPDRPEHQYHLKKFGPVTDFGYKDFIPMFTGENWDPYEW
FT                   AKVFKKSGAKFVVLVAEHHDGFALWESNYTRWCATKIGPKRDIVRELKEAVEGQGLIFG
FT                   ISYHRAEHWWFFDQGMKIESDVKDPRYPDLYGPAQSASLNPRDPPSLDNVQPNDEFLMD
FT                   WLLRIVEAVEKYRPWLVYFDWWIANPSFQPYLKAFASYYYNRSYKWGIEPVIIYKQGAF
FT                   GEGTAIPDLAERGTIKNVYPSTWLADTSIDYKSWGYIKDAEYKLPSVILSHLGDVVSKN
FT                   GVFLLNIGPKADGTIPEEAKRILLDVGDWLNVNGEAIFGSKPWRVYGEGPSGINEGGFF
FT                   TERKITLGYQDVRYTVKDYYPRQRHIYAILFGKPKEITLRSFMKNLKLIEEAVIVDVSR
FT                   LDGKGKLEWSLSDEGLKIKIEEIIRAPLVIRVILDYR"
FT   gene            441670..442407
FT                   /pseudo
FT                   /locus_tag="YN1551_0472"
FT   gene            complement(442409..443332)
FT                   /pseudo
FT                   /locus_tag="YN1551_0473"
FT   gene            complement(443388..443526)
FT                   /pseudo
FT                   /locus_tag="YN1551_0474"
FT   gene            443729..444277
FT                   /locus_tag="YN1551_0475"
FT   CDS_pept        443729..444277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0475"
FT                   /product="ORF1 in transposon ISC1225"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47628"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLB4"
FT                   /protein_id="ACP47628.1"
FT                   /translation="MVTPGLPHQNNIQQIGYKLLSMLNFKGKKGEEVARTLISACLWND
FT                   SVESKSRAYDVSPQTVRNYVEKQGMEVIEKLLESARKISLKVLKGVKEIDLSIDWTTKT
FT                   WYGKPVKGLGSSEEGNSWNYATATTKFNGKVLLLAFVTQVKGMTKEEIVKALVEQVVAM
FT                   GFKIRLITLDAGGLLGIVV"
FT   gene            complement(444298..445536)
FT                   /locus_tag="YN1551_0476"
FT   CDS_pept        complement(444298..445536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0476"
FT                   /product="transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47629"
FT                   /db_xref="GOA:C3NLB5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLB5"
FT                   /protein_id="ACP47629.1"
FT                   /translation="MTKSKNNPGRGNTIRESNTMKVMEEIREKIRKAIKEGVSLREIEE
FT                   IILQEAMMEEREAYLEVEDDHKNGTYFRYLGTGDGVLRLRVPRTRKGGFRPKILPEKYE
FT                   RTSPDYEDFLQQLVLSGMTPSQVKAVLAAKGIPYSEIVMNRVAERISNKLKEYKSRELP
FT                   HDLLALYIDVKIVKVRISESIMERAIYIAIGVDLEGNKFVLDYEVRDREDLDGWKSFLS
FT                   GLVSRGVSRVDVIVSDDFSGLDRVVSTLFPSSQHQLCITHMVRNLMRVLPDKEELMIRV
FT                   RDLKSSRNVEEGRKAILSLSQLVQPFSPARAKRLLDAADKYCSFLNFPREIRHYLYTNN
FT                   TSESFNSILARFEEELGGYFPSLRSLEVYLYVSIHESNSRWKFRPMSVIRHYSYHLKQL
FT                   HASRFQVSLDEDF"
FT   gene            445580..445771
FT                   /pseudo
FT                   /locus_tag="YN1551_0477"
FT   gene            445964..447505
FT                   /locus_tag="YN1551_0478"
FT   CDS_pept        445964..447505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0478"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47630"
FT                   /db_xref="GOA:C3NLB6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLB6"
FT                   /protein_id="ACP47630.1"
FT                   /translation="MKIKGKEEFWEPKTQIDTINESVKLFKDRIALDYFGNKITFEELR
FT                   RMANSIASQLSEYVKKGNVVIISTQNIPQFIIAEYAIWKLGGVVLPVNPSYTEYELKYL
FT                   IQDANPKIAIASCESNVRKLSHIIKIITTNPNTFHELPYEYKEKWRVEDYCEEELNLKS
FT                   NKFRMDNVKVNVDDLALLVYTSGTTGKPKGVPITHSNIYASSWIYKNWFKYTENDKILG
FT                   IAPFFHITGQIFHITTSILAGSSIYTSFRFDPELSLRIIEENKTTLTMAVATVYRAMLN
FT                   VLDKQDLTSMRLWSSGGMPMPRVIEEEWRKRVGDWVYMAWGLTETTSPATLWPYPYNGN
FT                   LPVEPEYGIVSSGIPVYNTEIMIGEDGEIFVRGPQVVKGYWGMGEFKDGWLPTGDIGKI
FT                   INNWVYIIDRKKDIINASGFKVMPREVEEVIYQHYAVDEAVVVGVPDEYRGENIVAYVK
FT                   LKKGYSLSDDLAADIINYCRMHLAPYKVPRQVRFVNDIPKTPSGKIMRRVFRDEA"
FT   gene            447762..449657
FT                   /locus_tag="YN1551_0479"
FT   CDS_pept        447762..449657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0479"
FT                   /product="arabinose ABC transporter, arabinose binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47631"
FT                   /db_xref="GOA:C3NLB7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLB7"
FT                   /protein_id="ACP47631.1"
FT                   /translation="MSRRRLYKAISRTAIIIIVVVIIIAAIAGGLAAYYSSSKPPATST
FT                   SLTSTSSSLSVTTSSTTSTLSSITTTTSTASSYVVDFINPWGAEDPVGLKWIGGNFSIY
FT                   YPGYSVQFTSLPGASGVEERYVVINDIEAGKLQGIFWAHGGPEVLSYVELLPSPHDLYN
FT                   MTPLLAQEGLFQKGVTEALMAISYNGTIFGSPTNVHRAEELYFNPQILKKYNLPIPTNL
FT                   SLLIYDTQQLEAHGINPWAMSGAEGGYEQLHLWFAIFLSVAAQYYGAAGAAKLSNELMY
FT                   GVLNLNNVTVQKIINETDNVFLQFVGQSSVIPSWQSQSIWSALALVIKGQTVFEAGGNW
FT                   LAEYAAIWYNTTTYPATQPYLNWSNITLMAMPFPGTQGIYVIDMDSVAIPTVNNPQEQA
FT                   AINFAKFWASYEGQKIWTYYKGVSIWANSTDYYSTPMQWYDYQSLLNTPAQNFTWAFAD
FT                   GTLFDDVFYFLIAQELNLQEQGSSYIPTFNAALFKAENMTFHEWQIAAKDGFGFVGQRG
FT                   NPFGNYLPPWVNPSTYTYNSSYTPSFLLTPPHYLLPYLKKLGQQQYANKVNSVNYYAIN
FT                   GVNLLPFPLLIVLMIYLDQTRYKYVIKTFLNKINFFSNIFLSKFLTFNFTLYLGV"
FT   sig_peptide     447762..447848
FT                   /locus_tag="YN1551_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.357 at
FT                   residue 29"
FT   gene            449661..450518
FT                   /locus_tag="YN1551_0480"
FT   CDS_pept        449661..450518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0480"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47632"
FT                   /db_xref="GOA:C3NLB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLB8"
FT                   /protein_id="ACP47632.1"
FT                   /translation="MRKGAILMSIPGFIFAAFLIYLLALNVYFSLLNWSLFNLQPSFAG
FT                   LGTYQTLFSEYFFSLAVTHTIVYTIAAVAIGNILGILGAGILYFLKSNTRRAIYLSVFL
FT                   YPLAVSSSTYAITWQWLFNPQTGINLVLRIFHFPNIIWLTTQPTIYAGMIIIETWAYTG
FT                   LAVLFFLAFFMSVDKSIIEAAKIDGANNFYLLFRIILPNSMNGLIVSTALLFLFSFRIF
FT                   TVPFTIGGPTNPNMMSLVEYIYILFSTEYFSLSSALSSLVTLIAAVVIIPYAILGLKRW
FT                   VFRR"
FT   sig_peptide     449661..449735
FT                   /locus_tag="YN1551_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.688) with cleavage site probability 0.359 at
FT                   residue 25"
FT   gene            450525..451412
FT                   /locus_tag="YN1551_0481"
FT   CDS_pept        450525..451412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0481"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47633"
FT                   /db_xref="GOA:C3NLB9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLB9"
FT                   /protein_id="ACP47633.1"
FT                   /translation="MERSVSKGSYITSSIKYALLEIIAAILVIMWLVPLYAMILGGLKS
FT                   NLEAASTPILLPPSKPSLDAYAFAWFGYATIPGLEPTLLRYLLVAIPSVLLSVVIGTMT
FT                   AYFFFVLSEKHGIISNGLFSIMALATFLPIETVTFPLIELETSLNVYNTYIGLIFAMLI
FT                   FYVPTSALLMSIFLPVVPKYLIESARMDGAGDWTILWRVVFPLIFPGFLSTLIFVFLQI
FT                   WNEFFIPLILTNTPNMLMLPVAARFYTAAYALIYNRSFAAGVISSLIPLIIFIFLGRYF
FT                   IRGLAALGGGAKGV"
FT   gene            451418..452533
FT                   /locus_tag="YN1551_0482"
FT   CDS_pept        451418..452533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0482"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47634"
FT                   /db_xref="GOA:C3NLC0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040856"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLC0"
FT                   /protein_id="ACP47634.1"
FT                   /translation="MTTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHG
FT                   KTTFLRLIAGLEEPTSGYIYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDN
FT                   IAFPLKLAKVPKDKIENKVKEVSEELGLSDALNRYPKELSGGQMQRTAIARALVKDPKV
FT                   LLLDEPFSNLDAQIRESARALVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFA
FT                   QIGTPTEIYEYPATDLIARLTGEINLIQAKIIENNAIIANLKVPLNNMELKGQSNIVIG
FT                   LRPDDLTLSDTLLDKYIDMGIVKVKLVSYGAGIFKIVVSPITDENIDIIVDAEEPLETG
FT                   IETHLLAKPNKVKIFDLNGSNLITSKTQIIK"
FT   gene            452653..453384
FT                   /locus_tag="YN1551_0483"
FT   CDS_pept        452653..453384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0483"
FT                   /product="cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47635"
FT                   /db_xref="GOA:C3NLC1"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLC1"
FT                   /protein_id="ACP47635.1"
FT                   /translation="MIEELFDQMSKGNLLLIDMTYDMFNGMQTYIGDPPFKHEYFRKGN
FT                   KYGEVTLSTVYMGLHSGTHIDLPLHFVPNGESVEKFNIIQFIGYGNVLDLSYKKLGEPI
FT                   SSNDLKKFDDKIKENYVVMLYTGFSATRGKEDFLYNWPYLDSNGADYLVSKKIRAVGIE
FT                   SMSIAGWAGKEYPPRTNWDEVVYVHHKLLSNDIIILESVNNMKKVLEECKNGEALFFYA
FT                   PLKIVGAEGGPTRLFAICEKR"
FT   gene            complement(453358..454266)
FT                   /locus_tag="YN1551_0484"
FT   CDS_pept        complement(453358..454266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0484"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47636"
FT                   /db_xref="GOA:C3NLC2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLC2"
FT                   /protein_id="ACP47636.1"
FT                   /translation="MRLEGVVVPLITPFLEDYSIDKEGLKWLVSYLSENGVNGIFVNSS
FT                   VGEFASLTLDEMKLVTKIALDSRKSYSTLIFAGASTNFTEETIKLAKDFKDMGVDAIVV
FT                   MAPYFFKVREKELLDHFSMIAEKVDLPIIIYNIPLFTGIDIPISVYKMLVSQHSNIIGT
FT                   KVTLDSLIFFKKLISEIREIRKDFSILTGFDEYLLPLLYMGGNGGVMGLANAIPKLHLK
FT                   VYESWKNGNLSDANKYWRNVLNLTDIYDYCNSYTASIKLLLKVLNMPIKNVVRPPLSIC
FT                   EEESKIRGMIKDLSSFLTNSK"
FT   gene            complement(454304..455065)
FT                   /locus_tag="YN1551_0485"
FT   CDS_pept        complement(454304..455065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47637"
FT                   /db_xref="GOA:C3NLC3"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLC3"
FT                   /protein_id="ACP47637.1"
FT                   /translation="MNYFQILLGLIAGGTVAIGAIIISKGKFNKTTIGYLGAFTGGILS
FT                   YLALDTGSEAEEIVTNFLAVKDYPDFTVALILTSIGLIGTWLLLSLLEKNPSGEGLPVV
FT                   VASALGFHNIGEGFAIAAALLSGSVAAAWAFTIGFAVHNATEGFAISSPTVMSKRVMGL
FT                   KVLIPLSLLAGLPTTLGASIYYLGISNEIFLAFLNVVASASLVFVMIRININAASLLSG
FT                   FKARFWTWLFIGIATTYGLEVLLDILGGGTF"
FT   gene            complement(455213..455395)
FT                   /locus_tag="YN1551_0486"
FT   CDS_pept        complement(455213..455395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47638"
FT                   /db_xref="GOA:C3NLC4"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLC4"
FT                   /protein_id="ACP47638.1"
FT                   /translation="MDFTHRTNALGNPLTYIIDICRRLMITGNTDGVVCDVLAILIFNV
FT                   VMYFLASIRFKKIIE"
FT   gene            complement(455433..455827)
FT                   /pseudo
FT                   /locus_tag="YN1551_0487"
FT   gene            456155..457009
FT                   /locus_tag="YN1551_0488"
FT   CDS_pept        456155..457009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0488"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47639"
FT                   /db_xref="GOA:C3NLC5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLC5"
FT                   /protein_id="ACP47639.1"
FT                   /translation="MFSKNSLPIISRYSILKYLTDYFHNMRDKIILFLGGVAFGTAAIF
FT                   VKFCTITPPFITFLRFLIAGILLLPFVSKRRRKIILKRFILPSLFLSLHMLFFVSSVFL
FT                   TTIASSTILVSTSPIFAMLFKKKIDPFIIMAILGIFIMNFNTSFGYIFGNVLAILSAIS
FT                   FAIYTYFLSRLDYDSLSIIPIIYLISSIFMIPVLPFYGLGDINPISILAVLGLVLVPTL
FT                   IGHGSVIYTANKLPISLVTSAELIEPVMATILAIPIFHQIPDTQELIGGTITLISIYFA
FT                   FRR"
FT   gene            457442..457865
FT                   /pseudo
FT                   /locus_tag="YN1551_0489"
FT   gene            457912..458142
FT                   /pseudo
FT                   /locus_tag="YN1551_0490"
FT   gene            458253..459524
FT                   /locus_tag="YN1551_0491"
FT   CDS_pept        458253..459524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0491"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47640"
FT                   /db_xref="GOA:C3NLC6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLC6"
FT                   /protein_id="ACP47640.1"
FT                   /translation="MRYRSLVETSRSKRYVRLLPMLFFLYIVNFLDRVNISYAIDAGMF
FT                   QYLGVSAKEVGIIASLASSLFFVGYFIPQIFSNLGINRYGVRKIFLIAFLVWGIITIAT
FT                   GFVTSVSQVYVLRFLLGIAEGPFFAGVMFYLSLWFLKPERATANSFFTAAIPISGIFGS
FT                   LIAGAIFATYGNYPGWRYLFWYEGMLAIFGGLLAYFILTDFPSDAKWLSNDERSALEQA
FT                   FKEEEVEKVKVSWTKALADLNVILLAIVYFLGVTSLYGYSIWLPSIISFIGKVNATIAS
FT                   FLSIVPYVIASISLILIARYADRRQNHRFVTFAVFLVAGIGLALSAATQSIFILSFMLF
FT                   AIAAIGIYSFIATFWAVPQGYLSGDAAAAAIGLINAIGNLGGIAGPIVVGFLKSYTGSF
FT                   VDGIYVMALFSILAGVVTLLIRRS"
FT   gene            459643..460308
FT                   /locus_tag="YN1551_0492"
FT   CDS_pept        459643..460308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0492"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47641"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLC7"
FT                   /protein_id="ACP47641.1"
FT                   /translation="MIRSYNVVLSHEDWTLLTDKYDEEDLRVLMKIRTPSFEKMEENII
FT                   AEAYVRDPLILNELINIIKSNNRVTRVKIIENVRTKNELRALILLSAKLRGGISELLMN
FT                   KGAYYISERISNGLEKWSLVIDDKIFREIILPTLKEYTYSLKIIEKDDGNLVSVKNLLT
FT                   SKEFEIIYKAYKMGYFDWPKKVDLKELSEELGISKAATLQALRRAMGKLIRNYVDNLV"
FT   gene            complement(460305..460691)
FT                   /locus_tag="YN1551_0493"
FT   CDS_pept        complement(460305..460691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47642"
FT                   /db_xref="GOA:C3NLC8"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLC8"
FT                   /protein_id="ACP47642.1"
FT                   /translation="MMRVGIYLISLGIFILVLGEITFPLNTTLNVNNSSMYIIPPWYEK
FT                   AKVSVNSGSFLIVYHNYTYILLVKGSITIKPASILYGVGNASILLEGYKIFYNQSYIAV
FT                   GIFLIIVGVGLEIIRFKRRKDHQF"
FT   gene            complement(460688..461305)
FT                   /locus_tag="YN1551_0494"
FT   CDS_pept        complement(460688..461305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47643"
FT                   /db_xref="GOA:C3NLC9"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLC9"
FT                   /protein_id="ACP47643.1"
FT                   /translation="MGVVSFLIKHRYGEYGLLSYIDLELALSVSIVASFNFFHPQTRNA
FT                   SVDQLLFNIITFTIGIILSTLVIRNICLGMGQDLYDGTIISFLQMRNRRAIFLLSYFID
FT                   VLLIGGLFLLIAELVFLLSSFTPPITWISIFISEYLLLCNSSYLIAILIKRPFRSFFIS
FT                   ISLIFLVLGIEITGNMIIFNYLLPLDLILGHLAYYAFRKVQI"
FT   gene            complement(461296..462171)
FT                   /locus_tag="YN1551_0495"
FT   CDS_pept        complement(461296..462171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0495"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47644"
FT                   /db_xref="GOA:C3NLD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLD0"
FT                   /protein_id="ACP47644.1"
FT                   /translation="MSVIDAINLTKRYGDIEVLHGLTFSIEEKSITLVIGPNGAGKSTL
FT                   LKIIGGLINRTSGYISVLGEDPWNSNKIPRKVGIILDRPFLPPYLTVIDIVKEVSSEFS
FT                   YPLSDAKRLLEDFNLVHFMKNKVRELSAGTKQKLQIVFSLIKNPEIIIADEPTANLDIT
FT                   SRYEVYNTFAVLREKMGLTVLISSHIPAEILAFSTHVLAINNGIMKFFGKVDKLLRNNF
FT                   LEEFYIVVDNIGKALEALKDRRIEVIGNQIRISGNLAEISKILSNAGVRIFYVRNSIID
FT                   KSIKGETGWE"
FT   gene            complement(462206..462568)
FT                   /locus_tag="YN1551_0496"
FT   CDS_pept        complement(462206..462568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47645"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLD1"
FT                   /protein_id="ACP47645.1"
FT                   /translation="MSDLYAIMVISGEDEKLYMAYITAIGYASSGNKVYMFFTMDGLRG
FT                   VTKEIEKIQLPNVKPLSYYYENLIELGGDDIELTACEFGMKVKNVNHERLLDKVKISGV
FT                   SEFALKSSEAKATLIF"
FT   gene            complement(462565..462843)
FT                   /locus_tag="YN1551_0497"
FT   CDS_pept        complement(462565..462843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47646"
FT                   /db_xref="GOA:C3NLD2"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLD2"
FT                   /protein_id="ACP47646.1"
FT                   /translation="MISLPIIRRLLAPLVVSLFALGWYGFSVQYIVSNNNVALENGVFS
FT                   AYISPSQLQGYIEATRYICYVVVYLGLIFFWYNLVKTVRELEEANKQ"
FT   sig_peptide     complement(462760..462843)
FT                   /locus_tag="YN1551_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.666) with cleavage site probability 0.383 at
FT                   residue 28"
FT   gene            complement(462843..464072)
FT                   /locus_tag="YN1551_0498"
FT   CDS_pept        complement(462843..464072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0498"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47647"
FT                   /db_xref="GOA:C3NLD3"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLD3"
FT                   /protein_id="ACP47647.1"
FT                   /translation="MPSMVLQPVLQESWALIYGLFALSGFILGWAAQRGNYCFVNAMTS
FT                   IFTAKSYERFGALLILFGLSALGSGLLVAFGVIPAFDQYYYNYFAGWYILVGSIIFGFG
FT                   AALAGGCNLSMLYRAASGYVQNWIELFGMMIGTYVFAIGIWPFQLYTMANGILSTTNGG
FT                   YVEYLPYIIFHSISNMSVYITTLVVSLPLIFIGIYLQQYTKRKWAISSSLRINLPAARA
FT                   YYNQNISTSGEEKVSLTKEIKDLILLRKPYGTNLTTIILALDLLLVFIVGAGYTFNYLV
FT                   ITSSDGGRFFEYLLMLGNVKLFLNTPWFNDSLPIVDPSTLMVIMLCIGAFSASYLSGDF
FT                   KIRIPRNKSRLLIGFGGGMLVGIGVRMALGCNVGLMWTNFAQLGYDGIIFLFGMLLGVY
FT                   LAIKVQERWL"
FT   gene            complement(464076..464324)
FT                   /locus_tag="YN1551_0499"
FT   CDS_pept        complement(464076..464324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0499"
FT                   /product="SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47648"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLD4"
FT                   /protein_id="ACP47648.1"
FT                   /translation="MEDLTLRQPDEVLDVRGEECPVPEMSASKKLKKMKVGQMLEVLTD
FT                   HEPAVHVTLPSLCKSLGYPFVVIRDNGLYKVRILKVK"
FT   gene            complement(464406..464741)
FT                   /locus_tag="YN1551_0500"
FT   CDS_pept        complement(464406..464741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47649"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLD5"
FT                   /protein_id="ACP47649.1"
FT                   /translation="MVKKIAYIVESNLGSYILGQMVVPQLEENRHNAEVIGMFFIHDNV
FT                   YILMKDNPLAERLGKLSRERGIYLQACDQCVYMRNLADKLIEEAKIGCFPDFYAKVLDT
FT                   VDMIITI"
FT   gene            complement(464734..465096)
FT                   /locus_tag="YN1551_0501"
FT   CDS_pept        complement(464734..465096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47650"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLD6"
FT                   /protein_id="ACP47650.1"
FT                   /translation="MELKDECGCIVNRKYASDFLMKRLFSYKKKINAKKLGYFRIDNSR
FT                   WFTLYRAQDGKIYYESSECPLLIITLEALCERYIENEGKINRDNSMEKLRQIKGFTTNQ
FT                   IVNEVVEKFINGVSNG"
FT   gene            complement(465140..466114)
FT                   /locus_tag="YN1551_0502"
FT   CDS_pept        complement(465140..466114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47651"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLD7"
FT                   /protein_id="ACP47651.1"
FT                   /translation="MIEETTLIYAEDFKSLLDLENSYKLYKLSNIKKLDFGYICYLTIF
FT                   RLKVECICKPRKDGLDIIEKNGRFIINITFQKESEERINVKISYRGILEKLLSSIANSI
FT                   RKNLEEYSKYLIGKQKVENNLRISTLKPDKVVDLRGEECPVPEITLKRELMKANRGEII
FT                   EALTDNPAAVAHTIPEIIKLFNCRYEVLKYEDYVSFRILVLSNTINTDEYVKVIKEFNE
FT                   ARIRELIRDKKFMSFLYTYFVKFHKVEKVNDFKNYRFNCEKDICLVSSAPLGRGWLFTG
FT                   LIKSNKMVCARIDTENETLLDYQALECLKKLAGETNVMYLSLD"
FT   gene            466414..467634
FT                   /locus_tag="YN1551_0503"
FT   CDS_pept        466414..467634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47652"
FT                   /db_xref="GOA:C3NLD8"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLD8"
FT                   /protein_id="ACP47652.1"
FT                   /translation="MNKKQLIKALSSYQLWLIVGLIVIILIGVGAAYIMLKQSQSSSIP
FT                   SSTQTTSSSVSTTTSPQYSFLVFTQKGIAEIINPSSTTPFQGYTHSINISTNVPQQVYW
FT                   WVEYPFENAAQSRYYLIPVNNGTVYAIDANSLKIVKEFNFGNSIGFIGVAYSPSQQLVA
FT                   VADGPSGILALINVSSLNVLWEQHFVSPVNGRTYYPCDVRWSPDGNYLIVPMRFNNSVD
FT                   LIALNGSLIKVLPTAAGSQPYMVSPNMQGTMVAVEYVGNNSVGFYSLPSLKLLGILQMP
FT                   NGTIPQRGVFTPNGDYYLEAPSNTNQVFVISTSTFQIVKTIDLPSFSVKGLADIELMPG
FT                   GQYAYVVIHGNVQSGGIIALISVSSLTVSSYVPLSTAPAVIIPVQNQVATYLVDNVLLP
FT                   PVTGLHC"
FT   gene            467645..468556
FT                   /locus_tag="YN1551_0504"
FT   CDS_pept        467645..468556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47653"
FT                   /db_xref="GOA:C3NLD9"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLD9"
FT                   /protein_id="ACP47653.1"
FT                   /translation="MKVLHPYFYTFLFFNFTVFLPILINGIRIVSLWYSPLSDTGQQTF
FT                   ILPFLIFTVIYLACSSIFGYFLYRHKENKFILVKGDFTVLNIMKSLLNDKAFRKILIFY
FT                   SVSYLVSFLIVSGVILVPNINISPYFLKLTTITYDAYGIQIYFNFFVLNIPMIIFALLN
FT                   TLILSFAFMLSYYTISLIYVSYNLMEWKVPKTFRITATNIAGGFLTASVPSIGTIAGIC
FT                   CLTPTAINSLLYLASSSFPLISKNLVWKYTIYMGMPLLSTISQLILLSSPVFAGVVILS
FT                   LSLYSLIQISKKLREGLLWQRQ"
FT   gene            468541..469077
FT                   /locus_tag="YN1551_0505"
FT   CDS_pept        468541..469077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0505"
FT                   /product="TQO small subunit DoxD"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47654"
FT                   /db_xref="GOA:C3NLE0"
FT                   /db_xref="InterPro:IPR007301"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLE0"
FT                   /protein_id="ACP47654.1"
FT                   /translation="MAKTMISDNFTLILRISTASIWLYAGILGKLLNSGFLNPSSEQYV
FT                   GFTIQYLAQGSIIRQFLYIVAMPHPVLVGTLVMIGEICFGILILIGLMSRLCGVVAFYT
FT                   NLIYFLSASWTGAEEYGLNLLMMIINAYIIAYGSGNFSIDSLVLRKFNVVNNKILWIIV
FT                   GSVIYIAVIVYLILI"
FT   gene            complement(469074..470078)
FT                   /locus_tag="YN1551_0506"
FT   CDS_pept        complement(469074..470078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47655"
FT                   /db_xref="GOA:C3NLE1"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLE1"
FT                   /protein_id="ACP47655.1"
FT                   /translation="MRFSYIFMQEFKRSIVFVFLILIALSLSLIAAQILSESISVIGIV
FT                   EGSSYGIKVSGYVFDFQGKGVSSEIKLSYYNFTESVKTNNGSFYLYLPVAYIQNNTRIN
FT                   VIINSFQKNVNLTLTIPNSSTTFAFSSLFLKYYSSQNLSIISVKGKTFIAVDPKQENSN
FT                   YTIFEINSDNVNLPLDVNFTYNNFSNTLKIPLIILLLFFFSFIDLMDYYLLSSFPRGEL
FT                   RQIMRLVGTIKVYVGKLIAEIPLTIMLSSLSFYLFEFILIGNDIALILPYMIASISFSL
FT                   GVYGLAPFGSKNMIYYSVILGFYIVNLVIYDRYLYSLLATLLLIVGYIKLRIS"
FT   sig_peptide     complement(469983..470078)
FT                   /locus_tag="YN1551_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.966 at
FT                   residue 32"
FT   gene            complement(470044..470757)
FT                   /locus_tag="YN1551_0507"
FT   CDS_pept        complement(470044..470757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0507"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47656"
FT                   /db_xref="GOA:C3NLE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLE2"
FT                   /protein_id="ACP47656.1"
FT                   /translation="MIRAINVSKIFHGSSAVVEVNLDIYENEKVGVIGVHNSGKTVLLQ
FT                   MLAGDVKPTKGKVYLEDKRKIAYIPQVPKFIPTISVKDVMTYVNKEYHYLDFVGLDGNK
FT                   KVKDLSLDEKKRLSLALSLPFSPNHLIVDDMSQISSLTKDLIRRFKGGVIIAHHNLKDI
FT                   WDLIDRVIIMSKGRVVFDGPKSGLLYKVIRFKNSEIWERENENSIEIDLDKRGVKYEVI
FT                   RVTPDEVFLYFYAGI"
FT   gene            471050..472657
FT                   /locus_tag="YN1551_0508"
FT   CDS_pept        471050..472657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47657"
FT                   /db_xref="GOA:C3NLQ9"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLQ9"
FT                   /protein_id="ACP47657.1"
FT                   /translation="MSEKRASRVLTIILIVLILSEFCNGILVKTSTMKNIFISLIVLEG
FT                   KPIMVIQTSKADFLNITLEDVNRNRITLPTISLNESNVLTYTYDGYLVIEMRAQGSLTV
FT                   YVIDSSLTLISNIKLNYNYSVQYPLLTGDYIVLISKKLVGVISRNMTTNGSLLEENIPI
FT                   YNISISATNFLNKYEKNISISDVIGYPLNLTLIKDHIITGSFFPLNEVLPIFTYKNWIY
FT                   IVYPIYSNSTIGEYEIEAVNLNTGSISSTEIKFRGYMSGYIPSNLEGLRFLVFYNESNI
FT                   SVYSINGSYMESLEINNYTKQLEKPYAIYTPLFPSVLLSSSLTLVNPIVVPLSIEVGPI
FT                   INVVNYSVNVLPSVANRISDYYLLANFNPYLYLVLFNTTYGLNIHNVSNFYIYNKSVLL
FT                   ILFYNSTISYYQIGKRGLNRLPSGTMISTGLVVENNSVQYYHNPIFFYQNFPLIQGSPI
FT                   IMKYNNGTYELAISLPNSTIYIPKGKLYLSLGDKLHEINFSIPRDNDSFTNYIIVYVII
FT                   LLVSIAIYIIIREKDRIS"
FT   gene            472708..473370
FT                   /locus_tag="YN1551_0509"
FT   CDS_pept        472708..473370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0509"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47658"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLR0"
FT                   /protein_id="ACP47658.1"
FT                   /translation="MIKSYTIVLSHDDWSRYTERFNEEELYVKVVRRIPSLDGLTENVM
FT                   GIIYAKDKEFYRQIIRMLSRNETTIDFRIIDEYKNKSNIRAIYASIESLKGRIAERLLK
FT                   DCRIFSMSETIYEGMERWNVIADSENFIKIIPEVKELTYEFKIIEESSNPLLSVKEELT
FT                   PKELSILKLAFDKGYFETPKRIGLEELANELGISKPAIMQVLRKAIAKLTEKSIKDF"
FT   gene            complement(473367..474041)
FT                   /locus_tag="YN1551_0510"
FT   CDS_pept        complement(473367..474041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47659"
FT                   /db_xref="GOA:C3NLR1"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLR1"
FT                   /protein_id="ACP47659.1"
FT                   /translation="MPDILEPIAHKILLVLGIYWPLAIFIIGIVHGLKPDEHTWPITVS
FT                   YGIMQRNMKGAIVSTSVFAVALTLVWASLSALTGQLLSFFQNYNLDPIVDVIVGLTMIG
FT                   VALIFIIKGKDKVVDKDNNPDYKLIWIHGLAAAFGGDFIVILLLTIALSTLISGNITFL
FT                   IGLLFGIGSWIAQSIVVLLIYKGLVKGVKANFQILAKAGRLSLLFLGIFMIGLGILSSL
FT                   TG"
FT   gene            complement(474309..475553)
FT                   /locus_tag="YN1551_0511"
FT   CDS_pept        complement(474309..475553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0511"
FT                   /product="transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47660"
FT                   /db_xref="GOA:C3NL66"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C3NL66"
FT                   /protein_id="ACP47660.1"
FT                   /translation="MTKSKNNPGRGNTIRESNTMKVMEEIREKIRKAIKEGVSLREIEE
FT                   IILQEAMMEEREAYLEVEDDHKNGTYFRYLGTGDGVLRLRVPRTRKGGFRPKILPEKYE
FT                   RTSPDYEDFLQQLVLSGMTPSQVKAVLAAKGIPYSEIVMNRVAERISNKLKEYKSRELP
FT                   HDLLALYIDVKIVKVRISESIMERAIYIAIGVDLEGNKFVLDYEVRDREDLDGWKSFLS
FT                   GLVSRGVSRVDVIVSDDFSGLDRVVSTLFPSSQHQLCITHMVRNLMRVLPDKEKEELMI
FT                   RVRDLKSSRNVEEGRKAILSLSQLVQPFSPARAKRLLDAADKYCSFLNFPREIRHYLYT
FT                   NNTSESFNSTLARFEEELGGYFPSLRSLEVYLYVSIHESNSRWKFRPMSVIRHYSYHLK
FT                   QLHASRFQVSLDEDF"
FT   gene            complement(475595..477004)
FT                   /locus_tag="YN1551_0512"
FT   CDS_pept        complement(475595..477004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47661"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLR3"
FT                   /protein_id="ACP47661.1"
FT                   /translation="MKWLVLLLPLLTVFATILISASSSPTIHVYYQRYDSVYRASGING
FT                   PLSASTVTYTVSSATYNTTLSDGKTFKVTYNRTVYTLLFASSPEKFEGYVNVSAYTNNT
FT                   ITIKTDLPDLIRIVIMSANETELIWAGFNATDINAYAYINGTSEVMLQFANGSTIANAT
FT                   LAINKENVSISNKISLYLFPVTSVEAKVSVSGELTATAQIPRRYSPLLVSINYNGTESN
FT                   ATVNGYKVTTAYFNGTLTPALFWKGEGLVPVMSGKGNIRADFETIEFYGVNGTILGYIH
FT                   ISSIVGNLEMIPVKIGLNYNIAFTELKIVTVSGVKQVHANFMGYTYINGVPVMIVGNDE
FT                   GNITSTAIVNISHLVIVNNHKGVLAEITLNSTSKFVVLTEANTTHNVSVTLPLLVNVTN
FT                   VHLNGNVHVAQKVVVNVSSQYILFNVTTLNNGSIIGVYKVENDTLVKLNSSNYFIINGK
FT                   LEIFDDPSSTY"
FT   sig_peptide     complement(476933..477004)
FT                   /locus_tag="YN1551_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.423 at
FT                   residue 24"
FT   gene            complement(477053..477778)
FT                   /locus_tag="YN1551_0513"
FT   CDS_pept        complement(477053..477778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47662"
FT                   /db_xref="GOA:C3NLR4"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLR4"
FT                   /protein_id="ACP47662.1"
FT                   /translation="MRHSKVYCFTVSWNQGLYGIFNQLQIVDRQTLLVGLVIITLIVNV
FT                   ILGVELYYTLHNRPTQPVGGIPINVSTVQIISPSSSTTTNTTSGATSTITTTQSSTTNS
FT                   GSSTTTKQPQTYSFSFKAEFKIHVKEHGIYIVGIKPNITFSQLYVILYFEDGQVVTLNL
FT                   NQTYVNVTIKEDDVKVTAYIYGKSYENLTPQQILNDIGLYFKFIGNSTNSNSNENSDEF
FT                   ILVRDINLVKKLFEIQPVS"
FT   gene            478386..479171
FT                   /locus_tag="YN1551_0514"
FT   CDS_pept        478386..479171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0514"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47663"
FT                   /db_xref="GOA:C3NLR5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLR5"
FT                   /protein_id="ACP47663.1"
FT                   /translation="MKILLLLLLPLITVPVIISHSSILNIYYNGTVEAELTGNVNQFVL
FT                   IGHNITNLKIIGAKYNLSGNTLYLTPSNTTVFIYYNAILPRGVIQINEPYNATINIYLP
FT                   LNSSINYISPQPYSFNVMSDYYNVTFANVNSVILLYTLSSHVTTAQNELEIPMIIGGLI
FT                   SSDAVLVSLIIFLLRRGNVRVLKEEETVDFVPEVLDERDTIVLEAIKMGTNTLADIVRQ
FT                   TGLPKSTAYRRVKKLVKLGYIEEIREEGKIRYVVRSDKK"
FT   sig_peptide     478386..478451
FT                   /locus_tag="YN1551_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.825) with cleavage site probability 0.611 at
FT                   residue 22"
FT   gene            479239..479772
FT                   /locus_tag="YN1551_0515"
FT   CDS_pept        479239..479772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47664"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLR6"
FT                   /protein_id="ACP47664.1"
FT                   /translation="MNKLLLLGVLLSTILVGGVVIGEEISGSLGTISYNVTSPTIQTTL
FT                   ASFNLGNLTAGQKGTLTENATLTVSANGTYTIKLKEDVLGNVFSEFNVTIHIANYTFTL
FT                   SLHGTEHYTLYLSKGTYTVNIKISYVVSQNPEAKSVSNIPFLMVKYGGEQQAQQTQTAE
FT                   HGKKHHDDDNEQDD"
FT   sig_peptide     479239..479307
FT                   /locus_tag="YN1551_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.980 at
FT                   residue 23"
FT   gene            complement(479865..481268)
FT                   /locus_tag="YN1551_0516"
FT   CDS_pept        complement(479865..481268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0516"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47665"
FT                   /db_xref="GOA:C3NLR7"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLR7"
FT                   /protein_id="ACP47665.1"
FT                   /translation="MYEDIWAIEHAISLLDWDIQTYMPQSGIKARGEALARLSNLRRKL
FT                   SLGIRGEIEKLEPKSDIEKGLKRVLDREYKYYDAVPEELDMKLHRITSEATVVWRNAKA
FT                   KGDFNAFKPYLEQILEIKREIAHKLGYKDHPYSALLDRYEEGFTVTDAERVFNELLPGL
FT                   SKILNKIDDKFTRKYHFEDEKYDVFQMSKTIEAIAYEVLKMPKDRFRIDVSPHPFTVSM
FT                   SRNDVRITVRYEGYDFKRVLYSLVHESGHAIYELQIDPSLEYSPLANAPSMGLHESQSR
FT                   FWENVVGRSYGFIKTIYPLLNVKDSIDDVYYYVNGVKRQPIRVDADEVTYNFHIAIRYE
FT                   IEKRAIEGSLEASEFPSLFNDLMDKYLNIRPKNDGEGVLQDVHWSQGSFGYFPTYTLGN
FT                   VIAGMVYYHMKSERGFDISNIEGIKNWLRERIHKYGSIYSPKELQMRSFGEAYNPSRLL
FT                   DYMREKYNA"
FT   gene            complement(481299..482975)
FT                   /locus_tag="YN1551_0517"
FT   CDS_pept        complement(481299..482975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0517"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47666"
FT                   /db_xref="GOA:C3NLR8"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NLR8"
FT                   /protein_id="ACP47666.1"
FT                   /translation="MPAKLNSPSRYHGIYNAPHRAFLRSVGLTDEEIGKPLVAIATAWS
FT                   EAGPCNFHTLALARVAKEGTKEAGLSPLAFPTMVVNDNIGMGSEGMRYSLVSRDLIADM
FT                   VEAQFNAHAFDGLVGIGGCDKTTPGILMAMARLNVPSIYIYGGSAEPGYFMGKRLTIED
FT                   VHEAIGAYLAKRITENELYEIEKRAHPTLGTCSGLFTANTMGSMSEALGMALPGSASPT
FT                   ATSSRRVMYVKETGKALGSLIENGIKSREILTFEAFENAITTLMAMGGSTNAVLHLLAI
FT                   AYEAGVKLTLDDFNRISKRTPYIASMKPGGDYVMADLDEVGGVPVVLKKLLDAGLLHGD
FT                   VLTVTGKTMKQNLEQYKYPNVPHSHIVRDVKNPIKPRGGIVILKGSLAPEGAVIKVAAT
FT                   NVVKFEGKAKVYNSEDDAFKGVQSGEVSEGEVVIIRYEGPKGAPGMPEMLRVTAAIMGA
FT                   GLNNVALVTDGRFSGATRGPMVGHVAPEAMVGGPIAIVEDGDTIVIDVESERLDLKLSE
FT                   EEIKNRLKRWSPPSPRYKSGLLAKYASLVSQASMGAVTRPA"
FT   gene            483196..483471
FT                   /locus_tag="YN1551_0518"
FT   CDS_pept        483196..483471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0518"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47667"
FT                   /db_xref="GOA:C3NLR9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLR9"
FT                   /protein_id="ACP47667.1"
FT                   /translation="MIDNPTDIIIILVVIAVLFFGSSKMPELFRALGRSMGEFKKGQLE
FT                   AEMEMQQMMSSNVVEKGERSESVEELEKKIVELQKQLEALKQSKKA"
FT   gene            483482..484351
FT                   /pseudo
FT                   /locus_tag="YN1551_3257"
FT   gene            484402..485019
FT                   /locus_tag="YN1551_0520"
FT   CDS_pept        484402..485019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47668"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLS0"
FT                   /protein_id="ACP47668.1"
FT                   /translation="MENSESILNALKEIFNVDLSKYWNEAEEINNGIKRVLGNSFRYAL
FT                   SETKRYVLYSIIKYYNPDIVIETGVGPGVSSTIILSALERGTLHSIDVRETLENGKQVG
FT                   FLVPEQLKSKWKLYIGRSRDILLDLLKKLGKVDIFLHDSEHTFENVTFELNIAWDYLRN
FT                   GGILLIDNLDFTEAPYYFTKQKGVKLYELTNETGGLGIIIKS"
FT   gene            485063..485587
FT                   /locus_tag="YN1551_0521"
FT   CDS_pept        485063..485587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0521"
FT                   /product="Protein of unknown function DUF998"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47669"
FT                   /db_xref="GOA:C3NLS1"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLS1"
FT                   /protein_id="ACP47669.1"
FT                   /translation="MMLNRTKVSGYLILVGVSQFLLFFIISEILYPNYSVKYNYISDLG
FT                   VGKTAIIFNTSIVIMGILVIIASILLRANYSPLVFLVGLGAALVGIFPENTGLPHLIAS
FT                   LITFLFGGIGALVTSIKRNYFWGILGIATLVSLILFILKDYGSLGPGGLERMIVYPEII
FT                   WGISFATYLTR"
FT   gene            485691..485960
FT                   /locus_tag="YN1551_0522"
FT   CDS_pept        485691..485960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47670"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLS2"
FT                   /protein_id="ACP47670.1"
FT                   /translation="MSFKFEDIKNILQNPSIKRFKVSVRKAVNFSESNTFQSISKTTVK
FT                   EGTNFEGMWIKCIKERLECDVVTEKGDLYIINFKDKIIIKLEYI"
FT   gene            complement(485961..486311)
FT                   /locus_tag="YN1551_0523"
FT   CDS_pept        complement(485961..486311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0523"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47671"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLS3"
FT                   /protein_id="ACP47671.1"
FT                   /translation="MRLEEIYSTYDKIVQSGYLPYIRCRKCMNTFFYVRNLCPKCGSRD
FT                   LEVLRSSGIGKVFSWTKIFRKNDTSIYGIVELEEGFKIYCNFASDVEIGDKVKVKINSL
FT                   EDGKYKVLAYKL"
FT   gene            complement(486308..487465)
FT                   /locus_tag="YN1551_0524"
FT   CDS_pept        complement(486308..487465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0524"
FT                   /product="acetyl-CoA C-acetyltransferase
FT                   (acetoacetyl-CoAthiolase) (AcaB-10)"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47672"
FT                   /db_xref="GOA:C3NLS4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLS4"
FT                   /protein_id="ACP47672.1"
FT                   /translation="MITGFASSLYKKYEGSTFELLADTVFSALEMAGLDKNYVDGIYLT
FT                   YLPGTFDGYANSHFFTNQVAQYLGIRPKFTQIFDYGGASALSMIHRAYKAIKAGEGETI
FT                   LCIVGGKATELRNKGVTVDAIDKAYPNVSLTPFDRLFRGLNDLNPVSDYALVANRHKYL
FT                   FKSTDEQRALIAVRQRFNAMQNSKAMFKDPLTIEQVLKSPLVSYPLHLLEIVYPIDGFH
FT                   VFVVSKRGSKSALTNIDILGYGEAHWPFMPTELDEIVYTPAVESSKGLLNGRIDAFELY
FT                   DSFTITVMLQVEDIGLAEKGKGGSFFENHDTTFKGDVPINTGGGSLNTGQPAYMSGGVI
FT                   LEEALLQLNDMADGHQVKGTDVVFLNGIGGWNRSHSVSLVLGEKK"
FT   gene            complement(487462..488517)
FT                   /pseudo
FT                   /locus_tag="YN1551_0525"
FT   gene            488178..488366
FT                   /locus_tag="YN1551_0526"
FT   CDS_pept        488178..488366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47673"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLS5"
FT                   /protein_id="ACP47673.1"
FT                   /translation="MKVYKFCSYILKCRREPYSELDEQCEGEDGFDEAPHVLEGSGLTT
FT                   APVDGMGSRTRGMRTRG"
FT   gene            complement(488939..489613)
FT                   /pseudo
FT                   /locus_tag="YN1551_0527"
FT   gene            complement(489729..490640)
FT                   /locus_tag="YN1551_0528"
FT   CDS_pept        complement(489729..490640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0528"
FT                   /product="proline-specific peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47674"
FT                   /db_xref="GOA:C3NLS6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005945"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLS6"
FT                   /protein_id="ACP47674.1"
FT                   /translation="MKGYSINVEEGYKRIFGINIYYKMYRVKGSNGNLVTLHGGPGGSH
FT                   DYLIPLADLSNYGINVLFYDQFGCGRSDDPKDTSDYTIDHGLEELEELRKQVFGNDKIV
FT                   LLGHSYGGALAIAYALKYQQFLRGLIVSSGLSSVPYTVKEMRRLIEELPDKYKTIIKRY
FT                   ESLGDFKNPEYLDAVNFFYSQHLLRLKEMPEPVKRTFQYIEKRRTYEIMNGPNEFTIIG
FT                   TIKDWDVTEQLYKITVPTLITVGKYDEVTVNVAQLIHKNIKGSRLVIFENSSHMAMWEE
FT                   KDKYLEVIKEFIDQVYSLNMVK"
FT   gene            complement(490722..492158)
FT                   /locus_tag="YN1551_0529"
FT   CDS_pept        complement(490722..492158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0529"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47675"
FT                   /db_xref="GOA:C3NLS7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLS7"
FT                   /protein_id="ACP47675.1"
FT                   /translation="MKSYQGLADKWIKGSGEEYLDINPADKDHVLAKIRLYTKDDVKEA
FT                   INKAVAKFDEWSRTPAPKRGSILLKAGELMEQEAQEFALLMTLEEGKTLKDSMFEVTRS
FT                   YNLLKFYGALAFKISGKTLPSADPNTRIFTVKEPLGVVALITPWNFPLSIPVWKLAPAL
FT                   AAGNTAIIKPATKTPLMVAKLVEVLSKAGLPEGVVNLVVGKGSEVGDTIVSDDNIAAVS
FT                   FTGSTEVGKRIYKLVGNKNRMTRIQLELGGKNALYVDKSADLTLAAELAVRGGFGLTGQ
FT                   SCTATSRLIINKDVYTQFKQRLLERVKKWRVGPGTEDVDMGPVVDEGQFKKDLEYIEYG
FT                   KNVGAKLIYGGNIIPGKGYFLEPTIFEGVTSDMRLFKEEIFGPVLSVTEAKDLDEAIRL
FT                   VNAVDYGHTAGIVASDIKAINEFVSRVEAGVIKVNKPTVGLELQAPFGGFKNSGATTWK
FT                   EMGEDALEFYLKEKTVYEGW"
FT   gene            492194..493129
FT                   /locus_tag="YN1551_0530"
FT   CDS_pept        492194..493129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0530"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47676"
FT                   /db_xref="GOA:C3NLS8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLS8"
FT                   /protein_id="ACP47676.1"
FT                   /translation="MLTCLLPTLLYAKCIFIMMKLFRVVKRGYYISYAILDNSTIIRLD
FT                   EDPIKALMRYSENKEVLGDRVTGIDYQSLLKSFQINDIRITKPIDPPEVWGSGISYEMA
FT                   RERYSEENVAKILGKTIYEKVYDAVRPEIFFKATPNRCVGHGEAIAVRSDSEWTLPEPE
FT                   LAVVLDSNGKILGYTIMDDVSARDLEAENPLYLPQSKIYAGCCAFGPVIVTSDEIKNPY
FT                   SLDITLKIVREGRVFFEGSVNTNKMRRKIEEQIQYLIRDNPIPDGTILTTGTAIVPGRD
FT                   KGLKDEDIVEITISNIGTLITPVKKRRKIT"
FT   gene            complement(493164..494603)
FT                   /locus_tag="YN1551_0531"
FT   CDS_pept        complement(493164..494603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0531"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47677"
FT                   /db_xref="GOA:C3NLS9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLS9"
FT                   /protein_id="ACP47677.1"
FT                   /translation="MYDYSDGESMSQYSKEEIDRGIKKIYDTVLNTKNITSRYIVILAL
FT                   ASLWLDAYDFASMTFGTASLKSTFSSVPSVLISLAIGAVQLGAIIGAVVGGWLNDRIGR
FT                   RNMFILNMILFTGMAILGGLSTNILELSIFRGLLGFALGADTATGFAYIFEYLEKKQRL
FT                   FWSNLWQIQWYIMYEVTIALMVVPFFFTVHSLTSPLLWRIIMIVGGVLALVILLLRGRI
FT                   PESVLWLAYQGRLATAKKILKQTYGIDLPEVPDVDLQLRAPARGVRSAFSIFRASKWRE
FT                   LVYSFNGNFEQGFIFYTFGFYVPYILVALKLAGPLASIVASAFLYAGGVIGGYLTAWLT
FT                   PKIGTKSQYVIGAIGEGISVGLIALTYIYHLPLIYFVVFSFLFYFFHVIGPASQGMTSI
FT                   NAFFGAKERGTAAGWGYFWVKLAAFIGLLIGIVGITYNPVSLTLGLAIYGVLTGIVGLI
FT                   IGYDTRTYKLADVEELEENPQ"
FT   gene            495041..496342
FT                   /locus_tag="YN1551_0532"
FT   CDS_pept        495041..496342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0532"
FT                   /product="General substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47678"
FT                   /db_xref="GOA:C3NLT0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLT0"
FT                   /protein_id="ACP47678.1"
FT                   /translation="MGGREISTGQVIKVAVGTSLGTTIEWYDFFLYGYAASLIFPKLFF
FT                   PPSYNPLTALLVSLSTYAVGFVARPVGAMIFGHLGDKLGRRTGLLWDLILMGIGTGIIG
FT                   FLPGYSQIGFLALTIATISRILQGIGVGGEWGGATTWLTEYAAKSRWRAFWGSWVQQGV
FT                   PIGLLWASAILGLFATFPSSSPLALLNYGWRIAFWIGAIAAVIGIVIRLALLESPLFER
FT                   VIEKGEVSKIPSIEVWRKYWSKILLLAASWAAQNAGFYLYSVYSVTFLAGIGFPKSLGL
FT                   LSVTVSALIGIFITVLFGILSDKIGRRLGMMIAFGFGLAFSFPYVLLLFSKSFSIILLA
FT                   QTLMVVAVLGSYAIIPAFFAENFPTKYRYSGTGLSYHMAAPFAGGLAPIIVADLVGEKY
FT                   LVNWWAFGAVFAAYFIISLIALAVLKETKGKEMD"
FT   gene            complement(496339..497673)
FT                   /locus_tag="YN1551_0533"
FT   CDS_pept        complement(496339..497673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47679"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLT1"
FT                   /protein_id="ACP47679.1"
FT                   /translation="MERIGDLLSNLPTDYAKALIQILTADNWNRLDRDVNFYQLGLGIG
FT                   KVVSRIDKETLKALVKSCDYYQSLCRGIAKGMDGIELDRDLILYLGNLSPVMAMELLAN
FT                   LELYKYPDIMKILAVNVAQIKHIPNVGSNIARQFDKLPFEIRRQILDIFKDNSMFLYEF
FT                   LQSVNLNKVDNIENFLNKIKEIDEIIGYRLYEVNDKMKEKLLNFSSISVGIGKGFQNLS
FT                   YHWKRKVIEKVKKDKEFAKGFLSSIDLSLLEDEFFDIIIKIGESDLELSKVLGRNFGNS
FT                   LAYLTEDLKSLAFNIAQGNPDFARGFGEGISESLGSFIGFIRGKAYELKKEDQDRVLDL
FT                   ALSNDNFANGLLTTFNAIFFFDNKEKVLELMIKREQYLKLFIEQIGRRINDFDLFKLLS
FT                   LNNKLTSELGKILCRNFIYLSKKNREIVLEWLSKNNELKEGFLQC"
FT   gene            complement(497709..498830)
FT                   /locus_tag="YN1551_0534"
FT   CDS_pept        complement(497709..498830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0534"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47680"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLT2"
FT                   /protein_id="ACP47680.1"
FT                   /translation="MIKDIRTYKLCYEGINDERDALAIKGLAEHPMEIVVTEIETSDGY
FT                   VGYGESLAYGCSDAVQVTIEKILKPLLLKEDEELIEYLWDKMYKATLRFGRRGIAIAGI
FT                   SGVDTALWDIMGKKAKKPIYKLLGGSKRKVRAYITGGYYSEKKDLEKLRDEEAYYVKMG
FT                   FKGIKVKIGAKSMEEDIERLKAIREVVGEDVKIAVDANNVYTFEEALEMGRRLEKLGIW
FT                   FFEEPIQTDYLDLSARLAEELEVPIAGYETAYTRWEFYEIMRKRAVDIVQTDVMWTGGI
FT                   SEMMKIGNMAKVMGYPLIPHYSAGGISLIGNLHVAAALNSPWIEMHLRKNDLRDKIFKE
FT                   SIEIDNGHLVVPDRPGLGYTIRDGVFEEYKCKS"
FT   gene            498924..500147
FT                   /locus_tag="YN1551_0535"
FT   CDS_pept        498924..500147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0535"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47681"
FT                   /db_xref="GOA:C3NLT3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLT3"
FT                   /protein_id="ACP47681.1"
FT                   /translation="MKIIRDPIHGYIEVEDFILQIVSTEIFQRLRHITQTGLAYLVYPG
FT                   MRHTRFEHSLGVMHLAKELTRYIKINSEQYTELDFINEEYLKLVGLSGLLHDIGHLPFS
FT                   HTFENALSLAKEVYGINVEYYGKKTHVIFGNRVIDYYLGNFLDKLSKNYDVVNFVQRVI
FT                   SSTPRTKEESLASLIISSPLDADRGDYLLRDSYFAGVGYGNFDIERIKRSLIYVNGKLA
FT                   VLKKAIPVVEQFLLARMYMYETIYFHSVVGLYNAVLSHAVAKLMQKKLIPDITPENYLK
FT                   LNDVLIMSKLDEAGKEFFNSIIYRKGFKRYKKDITGNCYETLEKKRKEINEIMRENNGL
FT                   ILYHDFYDVPYSEDEIFVYDDDEIRPLSNESKIVSSLSIIKKGIIGYHESVEDKIKKIH
FT                   EILRECSL"
FT   gene            complement(500221..502164)
FT                   /locus_tag="YN1551_0536"
FT   CDS_pept        complement(500221..502164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0536"
FT                   /product="raffinose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47682"
FT                   /db_xref="GOA:C3NLT4"
FT                   /db_xref="InterPro:IPR008811"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLT4"
FT                   /protein_id="ACP47682.1"
FT                   /translation="MMIWIEDENGNKYRCDSNGNCENLAIVKVHTKEYNKEGKIYSIEV
FT                   KSFVKLSKFPITLKLDLKTDQILSFTTQQIYSEVYGKAFAYYNQLAIDMEPVTEPPKEV
FT                   KYEIRSLDHEKYIRTYPCWLYPVFNTIPDYSVFALVKSGNSYQSLFTLSNNCVTAYLFN
FT                   DSVKIYSGINAEEIRKSYFLSIGTSDNPYKAIENAISIASKETHTFKLRKEKDLPHKVM
FT                   SGLGWCSWNAFLTKDLNEENLIKVVKGIMESVRLSWVIIDDGWQDQNNDRAIRSLKPDN
FT                   KKFPSGFRNTVSSLKSIGVKYVGLWHTINTHWGGMTQEFMKSLDVKGHFTNFLNSYVPP
FT                   PNLEDAIDFYKDFDGNILRDFDLVKVDNQWVIHALYDGFPIGLASRNVQLALQYAVGKD
FT                   VINCMSMNPENYCNYFYSNVMRNSIDYVPFWKDGAKLHVMFNAYNSLVISHIVYPDYDM
FT                   FMSYDPYAKVHLVARVFSGGPLYITDRHPEKMNVELLKMVVLPNGEVVRVDEPGLITED
FT                   LLFKDPLREKVLLKMRSKVKGYNAIAFFNLNDEDVEEEYNNEDYYYYKVFSGEFGVGNF
FT                   NVKLKELDVEIAITFPKSNKVIGLREYILPPFTVIASNNVVIPRADGTLLYVKDSKLNE
FT                   VKVREGIPASIE"
FT   gene            502228..503745
FT                   /locus_tag="YN1551_0537"
FT   CDS_pept        502228..503745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0537"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47683"
FT                   /db_xref="GOA:C3NLT5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLT5"
FT                   /protein_id="ACP47683.1"
FT                   /translation="MLRVYEIKLIKPPKRYILMADSYDLKYAYKALFVLAPIAIAVMYT
FT                   EAMLIPSLPTIANDFNVNSATVSWILTAYLVSGVISNPIVGKLGDIYGKKRILVYVMII
FT                   YTIAVTLNGFAPNFTLFIIFRTIQGIGLGMFPLAFSLIREEFPPHLVPRAQGIVSAMFG
FT                   IGSAISLPIAATVAQDLGWQYNYHFIIPFVILLTYLTSREIRESKYTNPNTKIDYVGAL
FT                   VLGLSLALMTIAISEAPTWGWLSLDFLTTVFLGIFLFFGFILYEMRTPFPLISINLLRE
FT                   KNVLAANIAAFVAGFGIFMAYQAITYLLELPNPVGFNLDILTTGLLMWPVSLMQMIGAL
FT                   LSSRLILRTGTKFIVVISSIILSFFYFILGLTAIGGSSNNLATIITLSSLATLGAAMLN
FT                   VVLINILTFSVERRVLGIATGMNTVFRLIGGAFGPSIAGSLLSTYYQYLVYPVTLNGQE
FT                   TFLSVQLPSDYAFQLTFYIASIAGLLMVIIGSMTRDIKIRGTMVSQE"
FT   gene            complement(503771..504922)
FT                   /locus_tag="YN1551_0538"
FT   CDS_pept        complement(503771..504922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0538"
FT                   /product="protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47684"
FT                   /db_xref="GOA:C3NLT6"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLT6"
FT                   /protein_id="ACP47684.1"
FT                   /translation="MSDWDIAIKRGVEHNVPRVFKVLREHPYLEDLARKVREGKLEVLS
FT                   NLDHYIDMTMKSVERIGGKAYFVENAEQAKEIVGKIVGSGKRVVMGKSMVAYETGIRKY
FT                   LQSIGNEVWETDLGELLIQFADEPPSHIIAPAVHMTRERIRELIKEKLGIDPGDKHEDI
FT                   VRVAREFLRQKFLTADIGITGANAVAADAGSIVLVENEGNIRMSSVVPPVHISITGVEK
FT                   ILPNLEYAMYEVLVQAAYAGLYPPTYINVTSGPSSTGDVEQKRVSPAHGPKEFHLILVD
FT                   NGRRKANEDPVLREALLCIRCGRCHFHCPVYRALDGKWGDPPYSGPMGAMWSGVVYNDY
FT                   KPALLCSHAGNCREVCPMKINIPKVLEYLKSKFFMMKAGTREG"
FT   gene            complement(504915..505814)
FT                   /locus_tag="YN1551_0539"
FT   CDS_pept        complement(504915..505814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0539"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47685"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLT7"
FT                   /protein_id="ACP47685.1"
FT                   /translation="MIDKDQINFIRRNLLKYLMEDYLPFPVNKSVCYEWANGLNLKKGG
FT                   ETIIYTGCSYQLAELGKRFDEILPTLSKFKGIERFSSILKVFYKPRDSRSYKILRNITS
FT                   VLKSSVDFGYLYEDEPYSGTILLEMGMIEEFREYAKKLIELFNSHGVKRIVTVDPHTHY
FT                   TLFRIKEMFSSSWNVEIVNYFEVIKNIKIKGEGTFVFHDSCLYSRFLGMRDSIREVIKS
FT                   SGIVLKEDEMITGKETSMCCGGPLAPINKEASDKIARNRAEALKSVHNKVLLACPFCYA
FT                   NLSPYVEAYDFAEVISGE"
FT   gene            505878..506507
FT                   /locus_tag="YN1551_0540"
FT   CDS_pept        505878..506507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0540"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47686"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLT8"
FT                   /protein_id="ACP47686.1"
FT                   /translation="MIVKNFITGPLATNSYLIIAEKEGVVIDAGGDMSELIQAVRKEKI
FT                   NIRYIIATHGHFDHIMGVNQLKREFPSSLFLVNEKDLGLLKRASGMAQSFLNLSISDVV
FT                   KPDGFVKEGDEIELGREKLRIIETPGHTMGSICVLANGYIFTGDTLFYGTVGRTDLGGS
FT                   EKLLRESLEKLKKLPDEIIVYPGHGPFTVLGYEKVKNPFLTMDILP"
FT   gene            complement(506509..506727)
FT                   /locus_tag="YN1551_0541"
FT   CDS_pept        complement(506509..506727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47687"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLT9"
FT                   /protein_id="ACP47687.1"
FT                   /translation="MESEVRKLLDKAEKLVDECVNCSSEDCDECEDAEELLNEIRDKIQ
FT                   SIQDKKVARRLGVFLDDLENKLESKLG"
FT   gene            complement(506802..507086)
FT                   /pseudo
FT                   /locus_tag="YN1551_0542"
FT   gene            complement(507116..507550)
FT                   /locus_tag="YN1551_0543"
FT   CDS_pept        complement(507116..507550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47688"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLU0"
FT                   /protein_id="ACP47688.1"
FT                   /translation="MEKRLAGLSELIVDTSFLLPLVGIKVKGIKDELLEGRAIYYPNLM
FT                   LTELLAVIFKEAKKLKLDKVPEEAMKGLIYVLSNVKLIPIEELEIETIYEILNKGWKDI
FT                   FDAILYTAYKSTKIPLITMDKSFYNFLKEKGIDAKGVILL"
FT   gene            complement(507510..507737)
FT                   /locus_tag="YN1551_0544"
FT   CDS_pept        complement(507510..507737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0544"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47689"
FT                   /db_xref="GOA:C3NLU1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLU1"
FT                   /protein_id="ACP47689.1"
FT                   /translation="MDRIIRIGKRNAIYIPKEIANSLNLKEGDRLVIVVEDGKIELIPV
FT                   RKPSKYWAEISPEEVEEVGEEISGSLGINS"
FT   gene            508071..508664
FT                   /locus_tag="YN1551_0545"
FT   CDS_pept        508071..508664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0545"
FT                   /product="transposase ISC1229"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47690"
FT                   /db_xref="GOA:C3NLU2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLU2"
FT                   /protein_id="ACP47690.1"
FT                   /translation="MVERETEAKSSGSGVTNPYHRTEHCDKIHAYRCDKEVGVIGIDVS
FT                   KDHLITSRGRVRRYENKKEGYEEILKMKPCTIVLEPTGVYAIKPSQYFKERGVRVLQVS
FT                   PNVLSREKEFRGKKTDFYDAEKLENMVDKAKEYDYNPLKELVTLYLFLKDIETKYKNRL
FT                   KRALFLVSDNDKVSKDRLEKTCERRFHTGRTIPT"
FT   gene            508666..509496
FT                   /pseudo
FT                   /locus_tag="YN1551_0546"
FT   gene            509850..510335
FT                   /locus_tag="YN1551_0547"
FT   CDS_pept        509850..510335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0547"
FT                   /product="MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47691"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLU3"
FT                   /protein_id="ACP47691.1"
FT                   /translation="MSENSEGPYFEDFKIGQKFKSKVGRTITDVDNIWFTLLTNNSNQI
FT                   HFNKDYTEKYFPGEPFKGRLVVNGFLTLAIVAGLLVEQTSQNGFMLGIENVKFLHPVFS
FT                   GDTIYADAEVIEVRESKSRPSFGIVKIRSYGYNQKGEKLIEFDRVFMVRKRGAKWFS"
FT   gene            complement(510328..510831)
FT                   /locus_tag="YN1551_0548"
FT   CDS_pept        complement(510328..510831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47692"
FT                   /db_xref="GOA:C3NLU4"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLU4"
FT                   /protein_id="ACP47692.1"
FT                   /translation="MRKAQSEYIGFIIAIIIIVLILVPLFYILNNYSVPSAKQLDYVQV
FT                   LKNQINGGGILIFFNSTYPKSSSSSVWANSTLIVLKGNGNYTLTGVYYMKGSVIYNVTS
FT                   RVIPFIIASGQAQPLNGKHLPQPLIYNFSLPAYVWNSSVVLQINGYNVTVFAQVYPNET
FT                   AFTS"
FT   gene            complement(510841..512262)
FT                   /locus_tag="YN1551_0549"
FT   CDS_pept        complement(510841..512262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47693"
FT                   /db_xref="GOA:C3NLU5"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLU5"
FT                   /protein_id="ACP47693.1"
FT                   /translation="MVGTMVKNRALSNVISIIILIFVILLVFIPFLYYLNNISQNNTVK
FT                   TSIVNNYVYLKNLQISQVTTGHPSLYYNGSSIYAVYSNGTFVPPSNLTIVSILYLNTNG
FT                   IWLNLTSIKYPLVISKGQVISLPSYIQGRPIIIVTSLGNIFFLQSGSSIGPFATASRGG
FT                   VEILTQIYTSSGPSSVSTNVTTNIYGTYKNFTTPIAFSNQTGTFVTRLPQYVFYQNSKG
FT                   QIITGVFHNWIVLGLATVNSTSSQGIQVTLRGQPVVLIGNYTQITSTVGLTLQVKGDSN
FT                   IYVSIFVNGNSYTIQNEQTITVPAGYVNITVITLQANDTTQQSQGVISHYSYSNAGYNG
FT                   KTYVAKSFLIFVPPGATNPTVYLNYLNDYNYYLVKIIGNYNEKQYGQVCLILNGTVYNY
FT                   NNPNPYWIIGGNYSFDPTGIFTGSSTYGAQTVIFQYSNRTSFTYTFPNIPSYVIINQPM
FT                   NITVNYAVTEYWQQL"
FT   gene            complement(512243..513910)
FT                   /locus_tag="YN1551_0550"
FT   CDS_pept        complement(512243..513910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47694"
FT                   /db_xref="GOA:C3NLU6"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLU6"
FT                   /protein_id="ACP47694.1"
FT                   /translation="MRKALSSAIFLIIMLIVLLSVLIPALLIFNSTPIYSSQGQIAGTG
FT                   YQQLQKNEENQVFRGNPNIYYNSSLMPYIEFLYNSIPYPLNITQIYYFNGSTWVPALKN
FT                   SILLAGNQNIYLPRAAFNQPILIVSSQANFYFLNPNTSVTTVTISGPAGKVPVYVTAFV
FT                   INGSKVIPVSIQVILGANPSLLTPQVYYLNPGTYSISDKNGSTIFLQGYGLTATFQNWT
FT                   IVGYGNLNSPSKLSTTFTVTGPLVLTAIYKAQLQKFTVVINTSNLPLGSTINPSNNNQV
FT                   TLTSLNNTIPVLIDNKQYYINSTGLQLQLTYGYHIIQFPSYYNITFDYTSTNYQGAYNV
FT                   MPIKNGIFMQNGKVTIQGGQINCYQFTGLSTNTSEINIINSYTVFVNGSGKIIGNYQLD
FT                   QTYYLVIAENYFYFPQGIWASYNSTPVNISISGQELQVQVLGTNQVITLGNINNYVPEK
FT                   IYFKSGTELEITLDYLQELSGNFTIVKVGNNTGTNYTGLLSCPQNVTIYNVTYTNGYAY
FT                   YPKGQSGDYGIMYINSPLIIINYEEWKYGAIPNGGNNG"
FT   sig_peptide     complement(513800..513910)
FT                   /locus_tag="YN1551_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.474 at
FT                   residue 37"
FT   gene            complement(513907..514470)
FT                   /locus_tag="YN1551_0551"
FT   CDS_pept        complement(513907..514470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47695"
FT                   /db_xref="GOA:C3NLU7"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLU7"
FT                   /protein_id="ACP47695.1"
FT                   /translation="MPSEVTEEFIIVIAVVLIGLVLFGFTTSYFIPHEIFSLAQQQASS
FT                   ISSSTTISVGPLIIGSSSASTVIEVYNPAIAGNVTLIVFPEPSYLQQDVGLVTPQSPPQ
FT                   FSVYLSNGKLAKNTIISVPIYDISGKITYGSQITAYSVPFNTPVTVMVNGVSGSNYILV
FT                   VWVLYNSNGYWFRIAYTFTGVPST"
FT   gene            514526..515887
FT                   /locus_tag="YN1551_0552"
FT   CDS_pept        514526..515887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47696"
FT                   /db_xref="GOA:C3NLU8"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLU8"
FT                   /protein_id="ACP47696.1"
FT                   /translation="MPSAITNLLIIIVTVIIALSAFAIYSAFFSVQGLAFLQEENVIGI
FT                   SKIVQVAVSQVSFKGLPPSYNYFNVSYLIWINSPTKYVTVIPFVASPRLNPFYILPSNS
FT                   QNASIFFSMTNGYIPLNTKFAFNGNVYLPQQTQLIGKINGVYAYNLTSNRSYILSAKVS
FT                   NGQIIMLWILYYYQGKWYRLDYTYLNPSNAGIGVYVLSGSGNYVGNSKNTNFKPPHQVT
FT                   SQTGLGFGLWFKLISNATTKTYLLNVAITPTNNKDFSILVWVIGNKLYVGTYDLSSNEY
FT                   IAQTYLITLYQNNWYFINFSLGSQLQSSQEVSFTIYNLSSQKWLNTTTLGTTTQSNGYI
FT                   STVKFGSSLKTVAISQAYFVTLKNNQGLPNFYNVSSTMFKNGPLYNNTYNYNWTIAKSN
FT                   NLYAIGYWYFVNPSYPPPPTILGILWYWPNGNGKTNYPQIYYIPEQGYNTYVLI"
FT   sig_peptide     514526..514597
FT                   /locus_tag="YN1551_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.440 at
FT                   residue 24"
FT   gene            complement(515914..518775)
FT                   /pseudo
FT                   /locus_tag="YN1551_0553"
FT   gene            516663..516827
FT                   /locus_tag="YN1551_0554"
FT   CDS_pept        516663..516827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47697"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLU9"
FT                   /protein_id="ACP47697.1"
FT                   /translation="MEQIVFRSTVSSYGTDKYGNKRYGITIPSKLRDKGEKLYGKEVIV
FT                   IVILPDDEE"
FT   gene            516817..517905
FT                   /locus_tag="YN1551_0555"
FT   CDS_pept        516817..517905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0555"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47698"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLV0"
FT                   /protein_id="ACP47698.1"
FT                   /translation="MRNKLIGSREALDNFQFVTINGRVLFNEKERVVRIARAYSQVVKS
FT                   AIKPLFDGKSIDELTKEFYNVLPNYIYLETALKQAKTIVDGLLEREEEKDKILHAKIRK
FT                   FWFASRGNKSDKGNRNVKFHVFQDHVEVKVKDPWGKWVYGKAYFGKEYLSLLHELEELA
FT                   SNKEEGYGAVISFEEKPMIHLQIPLWLYLKHFSSPKPVGYGLIAGFDLNSDRLNVVVVN
FT                   EEGKVVTKKTWWYSDVTRPGFPKGKAMALRLNALSQALNFLSRIGVDYVVFEDLFLVKK
FT                   RKFTRSKSGNRKITRFAKKQLLIHGVIKALRLGFNVILVNPKGTTNSEDHEKVMREKGF
FT                   DRHTASAYLIALKGLGMLNDIK"
FT   gene            518877..520001
FT                   /locus_tag="YN1551_0556"
FT   CDS_pept        518877..520001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0556"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47699"
FT                   /db_xref="GOA:C3NLV1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLV1"
FT                   /protein_id="ACP47699.1"
FT                   /translation="MEKIRVIELGSNISAPLVGEILADLGMEVIKVEPPPHGDDRRRVK
FT                   PEINGISIYFASTNRGKKSVVINLKSDEGYEIFQRLVKTANVIVTNYRPSALKRLKVDY
FT                   ESVKKINPKIIYCSITGFGNFTEEADRSAYDTIILALSGLMDMTGEENPVKFATSISDI
FT                   TTGLLASIMILWALNRGSPSFIDVPMIYTQFYLTLEDAYMYLNTGKVPKRMGSAHRYLV
FT                   PYQAFKTVDGYIYVAVFNDEQYLRLCKAINREDLAKFDTLQKRVENRNYIINELSRIFE
FT                   KNTRDYWVNLLSKADVPIAPILNLEEAFKKYGNRLVYENEGVKYINFPINVTSNKSKAP
FT                   KLGENTKEVLLELGYSEEDIKKLAEKGILNTNMI"
FT   gene            complement(519988..521157)
FT                   /locus_tag="YN1551_0557"
FT   CDS_pept        complement(519988..521157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0557"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47700"
FT                   /db_xref="GOA:C3NLV2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLV2"
FT                   /protein_id="ACP47700.1"
FT                   /translation="MLLQTKDEEEKLILSTVDQLMKKYDEKYWLDKDQKREFPIDFLND
FT                   FIKLGLGSILMPEEYGGIGKGVKLACLILYTLNLRGGNSYFVHGHYYNTALLSKHAGKR
FT                   VRDKYFKDITNGAKVLSLALTEPEVGSDTTKIKTVADKVGNNFVIKGHKIFISRVKHTD
FT                   FMILVARTTPYDKVEKKTDGITLFLVDLREAREGIEMREIKTMSNTNAYEMFIDGLKVP
FT                   ENNVIGEVGRGFYYLLDLLNAERFMIAAEMIGNAEWFINKAVEYANNRVVFDKQIGSFQ
FT                   GVQFPIAKVYAQLVSLSSYFSEGLRALEEGKDTKTIGNYANVSKYLAAEIAWEAGNVAM
FT                   DVYGGYGYAVETGIERKLRETRLYKVAPISQNLVLAYISHHILGLPKSY"
FT   gene            complement(521198..521986)
FT                   /locus_tag="YN1551_0558"
FT   CDS_pept        complement(521198..521986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47701"
FT                   /db_xref="GOA:C3NLV3"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLV3"
FT                   /protein_id="ACP47701.1"
FT                   /translation="MYSSFEILYLAIVIDSLSYTIGTLLYGSPIPVRGLKEMGHKMIVN
FT                   SIYVAVLANIFGLLLSILSQLQKILGVNWSIFYLDIGLLQIQTSVAINMGKFLYGIIVL
FT                   IFYYFKVPSQFYSLVTPLLQYISFLTDILILLNFYMDLGLFIHSSYMVLIAIGILLMAL
FT                   PFQMGKGIGAMLIAFTIVFYVGLPLLPILISNSSPLQNQNFVLQDIALQTEEFYAQIPA
FT                   LFYSFILIPLTYMGVLVGFSFILQSFIGGYIGKLPIPVEI"
FT   gene            522051..523304
FT                   /locus_tag="YN1551_0559"
FT   CDS_pept        522051..523304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0559"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47702"
FT                   /db_xref="GOA:C3NLV4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLV4"
FT                   /protein_id="ACP47702.1"
FT                   /translation="MLNEMSSLSSREIKLIFLNFMSYTFLVYNYSILLVFNSPYISQTL
FT                   FKGSYVPSLLGVYGLLLVDVIMRVPGAYVLGPISDRYGRKVVTRMSSLGSALPLVVVAL
FT                   IPDPSPSLLVLLYMIQGFFTGGLSTGITVVGVEDLPERHRGWFGGSGFAVGGSAYLLAS
FT                   IVFFMIITVIGSSNYTEIGWRIMFLTSLLILPFGLLMPESLRFRRNKERVKSPAKVLIS
FT                   SYKRQFILASTLTAFWASMNALVNVMLPNFLYAVDHLSKVEIGYMSLIYSVIAIISAFI
FT                   GGELSERIGRKKISMIGGILGILLSPVFILMSISSRSLIPIFVSILAFVSVFGGGGIMS
FT                   YVNENFPTKIRSTGVSLSWNIGFLVGNFIPLLLTAILYFTSITLFPLVEMITVLILGAL
FT                   ISSVSTISHETKGNIEKE"
FT   gene            complement(523449..524471)
FT                   /locus_tag="YN1551_0560"
FT   CDS_pept        complement(523449..524471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0560"
FT                   /product="FAD-dependent pyridine nucleotide-disulphideoxido
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47703"
FT                   /db_xref="GOA:C3NLV5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLV5"
FT                   /protein_id="ACP47703.1"
FT                   /translation="MQTERVVILGGGFAGIAAKLVYPNAILVDEKDFMVVTPRLVEVIE
FT                   KSLPLSHALIPRKVDVKAKVLKIDFKEKKVITSDGEIRFDKLIIALGYEQDLSKIKGAE
FT                   KYGIGFTLENVEKIKSFREGSIVTILGGGALGVELAGALRKRGYTVNLVEAENRLVPYL
FT                   IPDFSNEVQKVLEKQGVNVILRAKVEEVKENEVITTQGRIRSDYIIFSAGFSGPKIINE
FT                   IGLSNRNNRMLVYRFLRSVDYDFVYGAGDCANFKDGFIPQSAQVSLQAGEVAMNNAIKD
FT                   EKVEFKPVQKAIVFKIGEDYIGLLKHTVISGPIASLIKSFAISSLEGKVKKLNRFILAM
FT                   "
FT   gene            524616..525419
FT                   /locus_tag="YN1551_0561"
FT   CDS_pept        524616..525419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0561"
FT                   /product="permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47704"
FT                   /db_xref="GOA:C3NLV6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLV6"
FT                   /protein_id="ACP47704.1"
FT                   /translation="MKREDFLLVLASSVEGITWGADTVIMALYLKSLGLNPLTIGAILG
FT                   SDIIVNTLLSLLWSVLGDAYGRKKFVYISRGIGGLSFLLLLIAPYAYLFANQGFGLIAS
FT                   ILAEKSGDLDKAMAYRSSLNILFSVIGSLLPTALNFKGIIIVDGIVTFLSLLLVIPVRE
FT                   NYKGTSRVTLKISSFKILGKLSTEAIIGLGAGVLLPMLSLWFNLRFHATASSLSPIYAI
FT                   SEITLALSTLFSPILASTLGRIRAILTFSPPWNGRPKITSLKINL"
FT   gene            complement(525394..526431)
FT                   /locus_tag="YN1551_0562"
FT   CDS_pept        complement(525394..526431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0562"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47705"
FT                   /db_xref="GOA:C3NLV7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLV7"
FT                   /protein_id="ACP47705.1"
FT                   /translation="MVTPGLPHQNNIQQIGYKLLSMLDFQGEKVEKVAKTLISACLWND
FT                   SVENKSRAYDVSPQTVRNYVEKQGMEVIEKLLERARKISLEILKGVKEIDLSIDWTTKT
FT                   WYGKPVKGSSEKGNSWNYATTKYKGKVLLLAFIPQVNGMTKDEIVKVLVEQVMAMGFKI
FT                   RLITLDAGFYTVDVLNFISQFKYIVAVPVEDVKVFEEFDGDYKTNSKRHRRDEQVEFRL
FT                   LVYSKEKVRRKSVVYFARATNLDLSKREVLDLYNKVRGPIETSYRNIKAFLPFTGSTKF
FT                   VFRTLIFVLALVLYSLYIIFKGEVGREEFRLLLILLFPDLFNPENFTFNVIETLIYTID
FT                   LFLRR"
FT   gene            complement(526592..526818)
FT                   /pseudo
FT                   /locus_tag="YN1551_0563"
FT   gene            527429..527737
FT                   /locus_tag="YN1551_0564"
FT   CDS_pept        527429..527737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47706"
FT                   /db_xref="GOA:C3NLV8"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLV8"
FT                   /protein_id="ACP47706.1"
FT                   /translation="MIGRTLSGIGGIIVLIASLVSITTREPLIDHLIKILLITGDAVIG
FT                   LGIIGLIGSLTTLYGVYKNNWKYMVSGGILGLFAPCILSILSIIGGVLEIKGQKVSK"
FT   gene            527821..528414
FT                   /locus_tag="YN1551_0565"
FT   CDS_pept        527821..528414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0565"
FT                   /product="flavoprotein WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47707"
FT                   /db_xref="GOA:C3NLV9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLV9"
FT                   /protein_id="ACP47707.1"
FT                   /translation="MECPKILVLFYGYGSIVDLAKNVAEGAKEIAKEVKLARVKEYLPE
FT                   EMVKKFRIPIDTVKDIPEATLSDLEWSDGIVMGSPTRYGNMTGQLKLFLDQTAELWTKG
FT                   ALYGKPVGFFTEASTIHGGHESTILAMANYAYHHGMIIVPLGYGIKEVSSTTTGGSPYG
FT                   ASHLGNKKELDENEIKIAKFLGKRVAEVAKKLRC"
FT   gene            complement(528411..529364)
FT                   /locus_tag="YN1551_0566"
FT   CDS_pept        complement(528411..529364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0566"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47708"
FT                   /db_xref="GOA:C3NLW0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLW0"
FT                   /protein_id="ACP47708.1"
FT                   /translation="MPLYWDKIFNIAFSISTSAITSPILISLPSFMYNETISPPQSLLL
FT                   GHISSGIFNSACTNYKLIMENKNIVKLRVLLKEYPNDPYLNVAMDEALLLNSKDVPTLR
FT                   IWRNDKSVILGILSTVNDEVNLEMIKKYGVKLVRRISGGGSVFHDMGNINYTFITNGQG
FT                   GIDYLYGYLLKGTISAIESLINDRVEVYNETDIAFKGYKISGNAGYINEDRYLLHGTLL
FT                   VSSNLDILHKVLIIPPKNYIKKDNINMIKYKVSNLLNLINGNISYDEVVEVFIRGFSSL
FT                   LHCDDYFLDDISDRELKHAMRLANEKYSKKEFIYKR"
FT   gene            529192..529437
FT                   /locus_tag="YN1551_0567"
FT   CDS_pept        529192..529437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0567"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47709"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLW1"
FT                   /protein_id="ACP47709.1"
FT                   /translation="MQAELKIPEDIWPRRRDWGGEIVSLYIKEGSEIKIGDVIAEVEIE
FT                   KAILKILSQYNGKVIKVLVKEGDKILPGSVIALIEV"
FT   gene            529441..530307
FT                   /locus_tag="YN1551_0568"
FT   CDS_pept        529441..530307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0568"
FT                   /product="lipoic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47710"
FT                   /db_xref="GOA:C3NLW2"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLW2"
FT                   /protein_id="ACP47710.1"
FT                   /translation="MEKKVQITVYENENFKRVAEIVKTKSIATVCEEALCPNIMECWGS
FT                   GTATFMIMGSICTRGCRFCYVLKGKPSPLDDEEPKRVAEAVKEMKLDYVVITSVDRDDL
FT                   PDRGAQHFVNVVKTVKELNPSVIVEVLAPDFRGDINSVKKVINAGVDVFAHNVETVRRL
FT                   TPIVRDPRASYEQSLNVLKYAKNVIKKSSILLGFGETWDEIIETMRDLRSVGVNILVLS
FT                   QYMRPSRKQLEVKKRYTFEEFRKLEEIAYSMGFSAVLSLPLARTSYKAKEAYFKAIENA
FT                   KSNSRWS"
FT   gene            530279..531067
FT                   /locus_tag="YN1551_0569"
FT   CDS_pept        530279..531067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0569"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47711"
FT                   /db_xref="GOA:C3NLW3"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLW3"
FT                   /protein_id="ACP47711.1"
FT                   /translation="MLRVIVDGPRDPCYNMAIDEAIMLNRNTVNYDTLRLYMWSPSGVS
FT                   LGRGQNANASYLDKIKELGFRLVRRPTGGGALLHPEDNEITYSVVLSTNSTIAKSSVDE
FT                   SAIEIAKGILYTLQILGENVDIRGLGDMKKHDLCYLRSGSSDVVVAGRKISGSAQVRDD
FT                   KALLQHGTLLLKFEPEIWLKVIRAPEVTEEFLKSRIVGLFEFMEVGLDQIFDAMIKGFA
FT                   KALNEKDVFMGSLTPNEIKLANRLYKEKYSNERWNLLGIQ"
FT   gene            complement(531053..532087)
FT                   /locus_tag="YN1551_0570"
FT   CDS_pept        complement(531053..532087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0570"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47712"
FT                   /db_xref="GOA:C3NLW4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLW4"
FT                   /protein_id="ACP47712.1"
FT                   /translation="MISSLKLTEMCTHCGFCLETCPTYVVTRNEVHSPRGRIEAVRLGI
FT                   NSVGFETCMYCRLCETACPAGVKYGQIITPVRKSSTKKTLMEKMLENPKLLSKSLKLLD
FT                   KVSSYPEVERFMKFIKPNEISEPLETNDEGDIILFPGCIESVIFRRTVEKAYKFLSKNY
FT                   KIKIINGCCGLAHISNGNHEGARKLAMKLAEKVKGKKVITLQSNCAAFMKEYKEWFGIE
FT                   INSNDFAEFLIKEGIELPKVSDTFTIHYPCHAYRQKLTTHIRNAVEKMGVKISEMEDPH
FT                   FECGAGGDYWISHPKLSDMVINVKKEKIAKSKAKKVIVTNSVCALAIRSMGYDVYHIAD
FT                   LLDT"
FT   gene            complement(532084..533487)
FT                   /locus_tag="YN1551_0571"
FT   CDS_pept        complement(532084..533487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0571"
FT                   /product="FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47713"
FT                   /db_xref="GOA:C3NLW5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLW5"
FT                   /protein_id="ACP47713.1"
FT                   /translation="MIEKLAEIVGEEWVISSDEAKLYSYPAFIPLKIEPPLVVLPGSEE
FT                   EVISLVNFLNENNIKYLVRGSGTSLSGATTPTQGEVIISLTRLNRIYSLDNFEITVGPG
FT                   LANFLINKTLSNPNLFYAPDPSSYVVSSIGGNISHDSGGMHTPKYGTTFDSVIKLRVLL
FT                   SDGKVEEIGGNNFFDPTSIFVGAEGTLGVILRATLRLFPKPEVSKTLLAAFNSIDNAGK
FT                   AVVSVYKSGVTPAAMEFLDKNSIIAIESTQYKANYPMAEAILLIELDGYSANVEEEEAR
FT                   VVKVVRENNGEVFIPKDDEEKNRWWWGRKGAFPSFAYYSPAYLTLDANVPRSTLPTMLR
FT                   FTYEISKKYGLPVANSFHAGDGTLHPLIGFDPKNVDETINAIKAAEEITKLAIKLGGVP
FT                   SGEHGIGIEKIKFMKLYYSEDDLTLMRRLKTVFDSKRLLNPCKLVPPAKNEICNTVNRV
FT                   HTYLLEGDI"
FT   gene            complement(533560..534663)
FT                   /locus_tag="YN1551_0572"
FT   CDS_pept        complement(533560..534663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0572"
FT                   /product="FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47714"
FT                   /db_xref="GOA:C3NLW6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLW6"
FT                   /protein_id="ACP47714.1"
FT                   /translation="MIYPLYLLMEWIDELARIVKISDGKNDDSTRWKITVIPQTYEELR
FT                   DVIKFANERKLSIYPFSFNMHHIGPPINTDIGVKLSQFNNVIEISDEDLYVTSQVGVKV
FT                   SDLFEMIKANGLFLPAYYDGSLGGLLATNLPTPFSSFYGYPKNLILMAKIITGDGIIAK
FT                   GGGRTLKFSSGYKIHKILSGMLGWLGIYLEATLKVYPFPEVIATFQTDKVALISKYRPI
FT                   SIIYEVDEKGERTHVTFIGFRKAMNKIEEEIGVKGQDGFYDINYVENERIVSIHTVRGR
FT                   EVEEIKRAKSIMKVKRAIGIIGTGYCRLEIASFDNLEVLRREISGHVVVEKGDYKGDYW
FT                   GINDKGILRKLKEAFDPNNTLLPGLLL"
FT   gene            534693..535061
FT                   /locus_tag="YN1551_0573"
FT   CDS_pept        534693..535061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47715"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLW7"
FT                   /protein_id="ACP47715.1"
FT                   /translation="MSRYVYCVNKDKLIHCKGREFYYVFEYTRNNGLLLSRCQNGHCEQ
FT                   VDDIISELAKYRFAYEIDIFDEIMDKIDEIIPFLIKYNIEIYFIGDNSVLEAVYTPSLF
FT                   YYKYFGLKEAKDKVNFVK"
FT   gene            535113..535295
FT                   /locus_tag="YN1551_0574"
FT   CDS_pept        535113..535295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47716"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLW8"
FT                   /protein_id="ACP47716.1"
FT                   /translation="MEFKSHMDTIDGRYAMWLNTEDEYASFISREGDLVKFWISHNGCD
FT                   VFIKRKGKRICSRSE"
FT   gene            complement(535255..536274)
FT                   /locus_tag="YN1551_0575"
FT   CDS_pept        complement(535255..536274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47717"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLW9"
FT                   /protein_id="ACP47717.1"
FT                   /translation="MIRAEIPISLYKTFQEAIKDIVVSDMEDVVLISLDDSLIEIRSYI
FT                   GFGLSNTTFYYGQEKLCEIFDLNEVHDYVNQGLYKFNEYKESVKYCLFSISKFVKEKSI
FT                   GVSSKKFLYVNSEIFVSIINIIEKNYPIIGRNKIEDQFQYLIKANDKIIMLSLIVSSIE
FT                   SKKIYAFANIEDGDDSRQIAILFYDKIYYVDRLKFETINNIETGINKIIDYIINYDESK
FT                   EEETDNYLLLTINSIGTLFERFIFIRNIIDAISDIASDVNLRINFDYFEGGDFDLKLMK
FT                   GANIISVGKVKDNKILTINGYEIINDAYSAIRRLIEIGIEKMRKEAIHSYYKFSFLFS"
FT   gene            complement(536302..536781)
FT                   /locus_tag="YN1551_0576"
FT   CDS_pept        complement(536302..536781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0576"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47718"
FT                   /db_xref="GOA:C3NLX0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLX0"
FT                   /protein_id="ACP47718.1"
FT                   /translation="MNISKLLQLPLTDDSESDAAVVVLIAKGQYILLIKRVINPKDPWS
FT                   GQMALPGGHREDNETTLKAAIRECEEEIGIRPNIRSSLGVFSPNNARIKVRAYIALLDE
FT                   LIEPRPNPAEVDKVFWVHESEFARGDNAFYYKQYRIWGMTYRILSKLFEIAELKI"
FT   gene            536887..537090
FT                   /locus_tag="YN1551_0577"
FT   CDS_pept        536887..537090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47719"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLX1"
FT                   /protein_id="ACP47719.1"
FT                   /translation="MARRTCPKCGKVVEILVEHVNNKVVKKCPNCGYVFIEYEVKSNSS
FT                   LLSSFSPSAKSNREEKEQYRFE"
FT   gene            complement(537028..537771)
FT                   /locus_tag="YN1551_0578"
FT   CDS_pept        complement(537028..537771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47720"
FT                   /db_xref="GOA:C3NLX2"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLX2"
FT                   /protein_id="ACP47720.1"
FT                   /translation="MRVLRSSFLLAFTIFYGWSSIRRGFVYVLTYLSIPLAELFLIYII
FT                   TRGDFVKFAIVGGLISVMANNGFSLIGDLVFLRLESRLQDLLVATSIGPSDYIMGLMLA
FT                   NLLYSSPGVILYIMLAVIYHVLTLTNFIPLLIDVTLLLFSTSSIGFFLASLVPHTRYGW
FT                   GLAGLLSSILTIIPPVFYPYTFLPKSLYIPLLILPTTASAIFSQGITNLVNTSVEMLVV
FT                   SFLVLLLESILFFFLSVRFSRWRER"
FT   gene            complement(537752..538579)
FT                   /locus_tag="YN1551_0579"
FT   CDS_pept        complement(537752..538579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0579"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47721"
FT                   /db_xref="GOA:C3NLX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLX3"
FT                   /protein_id="ACP47721.1"
FT                   /translation="MLETINLTKIYRDGTIALDNLTFIANSRIVTLLGRNGAGKTTLTR
FT                   ILSTQLLPTSGIARIEGFDVVKDAKKVRKIIASIPQEAKSIGIASPMEHLVMYLTARGL
FT                   SFKEATEISRSALKEVGLWEVKDKPSDELSGGMKRKIFVAMALASNAELVLLDEPTTGL
FT                   DPYSRLEVWSVLKSIKSKILLTTHYMEEAEELSDEVILLHKGKLIAKGSIKELLAKFDN
FT                   KVRVEGIGEYKIGRLRISYVDRNEASDYVGKYVIKPITLEDLFIIYGGESLEE"
FT   gene            538592..538999
FT                   /locus_tag="YN1551_0580"
FT   CDS_pept        538592..538999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0580"
FT                   /product="protein of unknown function UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47722"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLX4"
FT                   /protein_id="ACP47722.1"
FT                   /translation="MEACFKYIGFIKRNDNSASRNATVEIHINEEYEERLKGLEEFSHI
FT                   IVLYHLHLANFDGRLLKEREGVMVGVFATRSQFRPNPIGISVAELIEIKDNIIIAKGIN
FT                   AFNNTPVLDIKPYDKWDRAEEVRVQTWHDVV"
FT   gene            539054..539449
FT                   /locus_tag="YN1551_0581"
FT   CDS_pept        539054..539449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0581"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47723"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLX5"
FT                   /protein_id="ACP47723.1"
FT                   /translation="MYVADLIVRNPVTAKAEISIRDAAKIMKKENLGSLIIVDETNRPI
FT                   GIVTERDILRAVADEILLDSPVSTIMTKGLITIAPNKDITEALIIMYQNNVRHLAVVGQ
FT                   NGELVGVISIRDAAKAVNLLALDLAIW"
FT   gene            539583..540986
FT                   /locus_tag="YN1551_0582"
FT   CDS_pept        539583..540986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47724"
FT                   /db_xref="GOA:C3NLX6"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLX6"
FT                   /protein_id="ACP47724.1"
FT                   /translation="MKNRFIMYFILFLFLISLGIIPLEHANIQKEQVIIQQYSTYLMQN
FT                   GNYLNYTVVSGVEDKILYSNVSQIVINYNKTTYLLKPLGLVYYNNSIINVTIIGEKLKI
FT                   YSGIPQLIKAILYTPGLQEVIWAGYLSKPAFISAYAYVNGTGTLELQYLNGSSTYSLNV
FT                   SIGTNLKLSVPLIGLNYTMLTFNSYRQITISTELPIPYRSFENISDFYISMSSFFNNTL
FT                   LPSMVWKSGNITAVEFFGIDGTIAGFLEVNGPRLLILKNLNAEYYTPKYVITTTINNMT
FT                   IILGIGNNSVESTDNIAFSYFVDVSKQIGLLFSTENTSSVFLAFNNGSVYDIQISYPKN
FT                   ISVSNITIQNTVFLAEKIIVSLNSSISLIPITPKYNYTFFILKELPNGSILFVNETDFF
FT                   MRNNTLYIVASRPSETYYIVYSNHPLLTTTQTNQALIPYGASNLVLIAGIVVILLAIAS
FT                   IVAIRKRRL"
FT   sig_peptide     539583..539663
FT                   /locus_tag="YN1551_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.790 at
FT                   residue 27"
FT   gene            541028..541396
FT                   /locus_tag="YN1551_0583"
FT   CDS_pept        541028..541396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0583"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47725"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLX7"
FT                   /protein_id="ACP47725.1"
FT                   /translation="MRVSKSNKPKEICPIVSAIAVIGSEPKLLTIRYLLEGPKRFNELQ
FT                   KLTLLSSKTLSKTLKELENYGIIERKIINSHPVIIVYELTDKGKELKRVFDELRKWGEK
FT                   FTLSQITITNSIRVNENF"
FT   gene            complement(541349..541570)
FT                   /locus_tag="YN1551_0584"
FT   CDS_pept        complement(541349..541570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47726"
FT                   /db_xref="GOA:C3NLX8"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLX8"
FT                   /protein_id="ACP47726.1"
FT                   /translation="MYIHPYSGFKPNFRSELEVKLTVELYAQGSQRSTPQSDLYYTDLT
FT                   NMFYIRKSVFLLVLKILVYANAICYSNL"
FT   gene            541572..541952
FT                   /pseudo
FT                   /locus_tag="YN1551_0585"
FT   gene            complement(542091..542627)
FT                   /pseudo
FT                   /locus_tag="YN1551_0586"
FT   gene            complement(542833..543249)
FT                   /pseudo
FT                   /locus_tag="YN1551_0587"
FT   gene            543896..544138
FT                   /pseudo
FT                   /locus_tag="YN1551_0588"
FT   gene            544195..545093
FT                   /pseudo
FT                   /locus_tag="YN1551_0589"
FT   gene            545169..545654
FT                   /locus_tag="YN1551_0590"
FT   CDS_pept        545169..545654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47727"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLX9"
FT                   /protein_id="ACP47727.1"
FT                   /translation="MKRSTKQLKGKRVYIDTNIFIYVALKNPEFYDECYKVLEMLISNE
FT                   FEGYGSDLVLFELFGSLAKINVNVAYEAVNSYLDLPIIILKLNRDTFGYAKEISELAEV
FT                   NYDSLHAALVAQNEVEVVVTEDVNDWSKILKVWPKIKDKFSAKELTVISPTKGKLPI"
FT   gene            complement(545895..546272)
FT                   /pseudo
FT                   /locus_tag="YN1551_0591"
FT   gene            complement(546272..546736)
FT                   /locus_tag="YN1551_0592"
FT   CDS_pept        complement(546272..546736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0592"
FT                   /product="ORF1 in transposon ISC1048"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47728"
FT                   /db_xref="GOA:C3NLY0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLY0"
FT                   /protein_id="ACP47728.1"
FT                   /translation="MVQAYEEEKDARIKERILAVKLHLVDGKSEKEVSKMLNKGYSTIK
FT                   LWVGEYKKEGLNGLRDKPRSGRPRKAEKEKQILEDQPQKYGMQQEYWTMRTLKIKQQGI
FT                   EYKKSRLYELVHELGYNLVKPRPTNVQAEKNMREDFKIGRRGAVLSRVGQ"
FT   gene            546776..546934
FT                   /pseudo
FT                   /locus_tag="YN1551_0593"
FT   gene            complement(546938..547207)
FT                   /locus_tag="YN1551_0594"
FT   CDS_pept        complement(546938..547207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47729"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLY1"
FT                   /protein_id="ACP47729.1"
FT                   /translation="MEVLIPDKLYHPYPLQQKSEEGKDPNPIEFEICQVLCNLIATKVA
FT                   SAIACDEVCEVDVCIILIEDPIIYAICSVSCDIICNEVLQIILT"
FT   gene            complement(547185..547520)
FT                   /locus_tag="YN1551_0595"
FT   CDS_pept        complement(547185..547520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0595"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47730"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLY2"
FT                   /protein_id="ACP47730.1"
FT                   /translation="MLQSLKPKSVKLLRYGEKKDNKQVFRQGVTLMEYEGQPSKIIQWS
FT                   QLIEGDPFGEHEITYRINYGSESVLRSFKVKYLGREGDKHRILIKEGVTGCGTKTRKIE
FT                   NGGIDTR"
FT   gene            complement(547872..548020)
FT                   /pseudo
FT                   /locus_tag="YN1551_0596"
FT   gene            complement(548065..548226)
FT                   /locus_tag="YN1551_0597"
FT   CDS_pept        complement(548065..548226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47731"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLY3"
FT                   /protein_id="ACP47731.1"
FT                   /translation="MSRNIELTHYYALKTHRNINIMFLSLNTKGNQYLSIQGILVDLIN
FT                   LLVFNILS"
FT   gene            548340..548564
FT                   /locus_tag="YN1551_0598"
FT   CDS_pept        548340..548564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0598"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47732"
FT                   /db_xref="GOA:C3NLY4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLY4"
FT                   /protein_id="ACP47732.1"
FT                   /translation="MEKVVIKRVDIQGRIVIPKEWRNKFNTDEFILVLKDDRIELYPRV
FT                   SNLTKLIDSINVEELPSDWHELKRKVYRL"
FT   gene            548533..548961
FT                   /locus_tag="YN1551_0599"
FT   CDS_pept        548533..548961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0599"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47733"
FT                   /db_xref="GOA:C3NLY5"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR039018"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLY5"
FT                   /protein_id="ACP47733.1"
FT                   /translation="MSLNVKFIDSNVFIYALLKPKRSVDEKIVKMKEKAKEILTRIDNG
FT                   EEKVLTTVVHISEIANVIESLSNLTTSIKVIENVINNENIIVKEVTVQDYTEAVKIANE
FT                   ENLSINDALAYVIMMKNGINEIYTFDEKHFRKLNVKIL"
FT   gene            549123..549260
FT                   /pseudo
FT                   /locus_tag="YN1551_0600"
FT   gene            549599..550525
FT                   /locus_tag="YN1551_0601"
FT   CDS_pept        549599..550525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47734"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLY6"
FT                   /protein_id="ACP47734.1"
FT                   /translation="MNLPNIRFRIYFASSSLRPKKSQLIHKANNARKPNFHKNFYMRII
FT                   TLYVMPIKGKRKYKVEFDDYTLTSVNGEISLIDQLGSKVDFSRLEIGDDIASKINSDRY
FT                   FYYKIIPLSKYSDIITYSLIDSIVKVGGFYGDLLEACYLKDRKSGNNDYNYLKYAFGKI
FT                   SINNVKIYDTIADEAVQKLIEEYGWDFINIYENLRSLFRVSVEKAYNKVIESLDSKREL
FT                   DAFMVYITYSYDKNKAKEILEKTVITPNLDYNYEYVIPRWGLVGIDDNIIKMFSEMGVK
FT                   VHIDSLKFNEVKFLLAKINNEKVELIS"
FT   gene            complement(550531..550611)
FT                   /locus_tag="YN1551_0602"
FT   CDS_pept        complement(550531..550611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47735"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLY7"
FT                   /protein_id="ACP47735.1"
FT                   /translation="MYYNVRKGERCLLLVLKDGRKVYVGT"
FT   gene            complement(550949..551236)
FT                   /pseudo
FT                   /locus_tag="YN1551_0603"
FT   gene            complement(551314..551589)
FT                   /pseudo
FT                   /locus_tag="YN1551_0604"
FT   gene            551632..552866
FT                   /pseudo
FT                   /locus_tag="YN1551_0605"
FT   gene            552980..553150
FT                   /locus_tag="YN1551_0606"
FT   CDS_pept        552980..553150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47736"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLY8"
FT                   /protein_id="ACP47736.1"
FT                   /translation="MTVGKIYMDGKDKVTARELTGIILGFLKKENEEWYKNWIIYDRAV
FT                   KKRETEKELQK"
FT   gene            complement(553171..553656)
FT                   /locus_tag="YN1551_0607"
FT   CDS_pept        complement(553171..553656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0607"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47737"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLY9"
FT                   /protein_id="ACP47737.1"
FT                   /translation="MKTALLALVIAGAFVAGLTTAGVAGYGPLAYISYHIMVSQQQGQA
FT                   QVIPAYINLGNLSAGEKGNTTATAVINISSNGTYTIDLLHADKLQKVFSNFTVELKINN
FT                   HTIILTPENDSEHVSLASGSYKVSILILFQVSQDPRGDLNVSNEPLLIIHPQGDDNS"
FT   sig_peptide     complement(553591..553656)
FT                   /locus_tag="YN1551_0607"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.742 at
FT                   residue 22"
FT   gene            complement(554351..555766)
FT                   /locus_tag="YN1551_0608"
FT   CDS_pept        complement(554351..555766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0608"
FT                   /product="General substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47738"
FT                   /db_xref="GOA:C3NLZ0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLZ0"
FT                   /protein_id="ACP47738.1"
FT                   /translation="MDKGISKTPFASIDSLKLTFNHIKVWYTSGMGFFTDAYDLFIISA
FT                   ILDVLIQLHDPNFPLNSFTEGLLASSAIWTAVIGELVFGFLGDKIGRKAIYGFEAMLMA
FT                   VGALLSAISPNIYWLIIFRSIMGLGIGGDYPISATIMSEYANVKDRGKLIALVFANQGL
FT                   GSLAAVAIGIGSVLAFPLNISWRIMAAIGAIPAATVIYLRRKTPETPRYSMLVKGSVQE
FT                   AKKAVEFLGARIEEKKFNSKPISLSQFLSKYWLTLIGTAVSWFIIDIALYGTGIYSGAI
FT                   TQLILGKPSSIANLILEQGLPYMAGFFGYFTAVALMDKLGRKIIQLQGFILLGIIYAVV
FT                   SSFLIVSGTKVIGLTIPAELGFLIYALSFFFIDFGPNTTTFVLPAETYPTRARTTGHGI
FT                   SAASGKLGAAIATYLFPTLLASIGIKNILLMLSVLSILGAIVTIIAVKETKGKSLEEVS
FT                   EEEVIVQEEKASA"
FT   gene            complement(555899..557056)
FT                   /locus_tag="YN1551_0609"
FT   CDS_pept        complement(555899..557056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0609"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47739"
FT                   /db_xref="GOA:C3NLZ1"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLZ1"
FT                   /protein_id="ACP47739.1"
FT                   /translation="MRVFPLIMLTLIFLLSSLISYGNVLVNYSSYQLRGSEILYSYSNS
FT                   SCIIDEKLIPINITSVSYVVRISYFPNWTLSISTNLPNIFSIFVGKFLLWSGFETSGFN
FT                   ATFLIPYMNPLNLTIWIMNYPNPIYLNRIIQMGEEIALPGEITNLYTFRTEILNTLKIN
FT                   DTLPPLPSPPSYYILTYNYTYAPVTVFNSSEDLINIVRGVNGISVLEVGLVHSNNLTFY
FT                   FYNISNKRVFPAVEIDKNLVITTNGVETPFPVKSSLASENLSFVIVNSATALIIVNKSE
FT                   IYLPIYNITSEEPSFIFMYGKILLGYSIFVSSPGIYHVSGHYSLVNAPYVTTKGSTYFI
FT                   SFNKGYYFALPQSLLLNIDTIQLLFAAIISSLLTILILLINKIFR"
FT   sig_peptide     complement(556988..557056)
FT                   /locus_tag="YN1551_0609"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.976 at
FT                   residue 23"
FT   gene            557112..559019
FT                   /locus_tag="YN1551_0610"
FT   CDS_pept        557112..559019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0610"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47740"
FT                   /db_xref="GOA:C3NLZ2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR036321"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLZ2"
FT                   /protein_id="ACP47740.1"
FT                   /translation="MRNNLLQYIAGFLGFIALFYGIFSLLSEYKFLEIKSLEVFILIFF
FT                   GFFAITYAFTGRIMIEKPFALTFSVILFYLALFSPLPLTSKILLITGGIVETQLTSRRG
FT                   IGGTLYIILGILTLLYFIYVHFVELSSTLSLIGIGLSSLIIVLGNRDRKVKAISYFAFP
FT                   IGIPLIVYGINGFFPLSLNPIFIIVGLATVLLNLIPSKGATSNDNDLKLDEKLCNDIQR
FT                   NECKDVIEVYNKYMVYIPQRCLDKVILCIIDQNDMQNFNLVVSNNLARSVAEKYIDKMS
FT                   PEMIYSLAFLSNRKKELLELACNKGYKKACEQTKPVLDLKNWDPKVWVGKEIYNYNIVD
FT                   IIGVGGTSYILKGEKDGNFYALKVPLINYLNNVMDLVGESSKLIELSTKSPYIVRLYAI
FT                   YADQLDVKEILGGNSEIYYNKPPMLVIELMKGGSINDVINVKELVRSEYWRKIVFIATA
FT                   RIAEALETIHSEGYVHCDIKPQNILFNEKLPPNARLAYDNLQNGKIIAKLADLGSAVRA
FT                   GAKPFSYTPAYVPFDLVKSTAFGGVSPMADIYALGATVYKLLTGVPLNTNAMIEAIDKF
FT                   DVSKDMRYLDNSLYNTRNLDLLRKYVDKNTYTFIAKMVDQDPNKRPTSKEVKEFFYSKI
FT                   "
FT   gene            complement(559036..559428)
FT                   /locus_tag="YN1551_0611"
FT   CDS_pept        complement(559036..559428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0611"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47741"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLZ3"
FT                   /protein_id="ACP47741.1"
FT                   /translation="MKVVVAYDGSDHAKNALFFALNLIKKEDEIHLVTIVKEAPRSPEQ
FT                   VIIQSEQRAKQMQDEVVSELSDYKIVQKILESNDVADSILQYCNNIGCGLIVTGSRGLT
FT                   GIKKAILGSVSNALVSKSNVPVLVVK"
FT   gene            complement(559527..560927)
FT                   /locus_tag="YN1551_0612"
FT   CDS_pept        complement(559527..560927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0612"
FT                   /product="amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47742"
FT                   /db_xref="GOA:C3NLZ4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLZ4"
FT                   /protein_id="ACP47742.1"
FT                   /translation="MELKKAVLSFKETYAQAMAVTAPLGSVVSTTTAAILYAGSSVIFT
FT                   TFLSLLTSALWIYTLSMYTKKLASAGGYYNFNYGAWRSKKLAFLEALTEMVAYTLLNVV
FT                   NVIAVYTILSVVSEILGIIIPSWVIYSIIGFSVAYPTLISFTHVKKLLGYVVTISATAE
FT                   AALLISLFFLSLSKGIHFDYFVPKFRNFGDLATAYVLTTVSISGAGAATYLGEETKNPH
FT                   ENVSKGMWLALIIGGISMFLGTYAMIVLWPGTINSLANSNQPLFVEMIKYGVIAFYIAL
FT                   MLSINSLLASNIGTTIGAARILFNLARENAAPKIFTKVNRSGEPLVATAMIGISTAMIV
FT                   VLSVSVLGITGAFTEVAAVEGVLWLLGRILDGFGAPVFYWRINSLGIANIVIPITATAV
FT                   NSWGDIQSVLQMDIVQLLMITVFAGIVVSWYILKARKGFPGTLVVDENNNVITIDEYLK
FT                   KIKALNVR"
FT   gene            complement(561127..561444)
FT                   /locus_tag="YN1551_0613"
FT   CDS_pept        complement(561127..561444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47743"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLZ5"
FT                   /protein_id="ACP47743.1"
FT                   /translation="MEDVKNVLWKVLNNEAPLVDDDIKMYHIKEGILTEDDLKKWREAI
FT                   RLIREAYHDAYKNENVAVEKARKSLEIINSISPKKPMPPEMKIRFEDLKRNLELIVKIN
FT                   K"
FT   gene            complement(561482..561973)
FT                   /locus_tag="YN1551_0614"
FT   CDS_pept        complement(561482..561973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47744"
FT                   /db_xref="InterPro:IPR018747"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLZ6"
FT                   /protein_id="ACP47744.1"
FT                   /translation="MFDKSMDKQIEDWLKELGLVASRPPQAKEFFHVVATPPQGGPTIS
FT                   VVRVNDSSKFYIIAMGIGIHPSHVSALMTLNREERIKFIIDLQLEALRYGVDFVALPPN
FT                   QEIPNVIQVSKPIFIDGLTANEFINTLLDVRNAGVSIMLKFTQRFGPYEPQQQTSLKYT
FT                   "
FT   gene            complement(561966..562868)
FT                   /locus_tag="YN1551_0615"
FT   CDS_pept        complement(561966..562868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0615"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47745"
FT                   /db_xref="GOA:C3NLZ7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLZ7"
FT                   /protein_id="ACP47745.1"
FT                   /translation="MKIISTEKVPEECENIINIKDENLTEEDYKNAEILLTWPGRVNSD
FT                   LIDKMPNLKVIQTFSAGVDDLNFSIVPPHVKVFSNAGAYSLSVAEHAWALILALAKGVG
FT                   TKKRTIVYDVSEKTLLVLGGGGIGSEVARIGKTAFRNYVIGISRSFRKPEWFDEKHEMI
FT                   MIREKIKEADIIVDTLPLNKQTRSLLNYDLLKDVKRNAIIVNVGRGETVDEEGIYRLLK
FT                   ERQDVRFGTDVFWRKNGKEDFYNTKLWELDNFTGTLHTAGAYGNESIMKRAMFMACLNV
FT                   KKYIDKGVADNEVRREDYV"
FT   gene            complement(562922..563020)
FT                   /locus_tag="YN1551_3258"
FT   CDS_pept        complement(562922..563020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_3258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_3258"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47746"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLZ8"
FT                   /protein_id="ACP47746.1"
FT                   /translation="MESHGLIRRVGDKYKITEEGKKLIENLKLSGF"
FT   gene            complement(562925..563038)
FT                   /pseudo
FT                   /locus_tag="YN1551_0616"
FT   gene            complement(563215..563337)
FT                   /locus_tag="YN1551_0617"
FT   CDS_pept        complement(563215..563337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47747"
FT                   /db_xref="UniProtKB/TrEMBL:C3NLZ9"
FT                   /protein_id="ACP47747.1"
FT                   /translation="MKLIREEFKVKNLIVPLIPLIVTINPINEGLEFGMSFSLC"
FT   gene            complement(563374..564921)
FT                   /locus_tag="YN1551_0618"
FT   CDS_pept        complement(563374..564921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0618"
FT                   /product="amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47748"
FT                   /db_xref="GOA:C3NM00"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM00"
FT                   /protein_id="ACP47748.1"
FT                   /translation="MSSKNKIFVRETSGLIKNVSLWDAVALNIGNMSAGIALFESISPY
FT                   IQQGGVLWLASLIGFIFAIPQLLIYVILTSKIPRTGGDYIWISRSLNGGLGSTMALAVM
FT                   IESTAYFALVAFFTSSAINTALTVIGEYQHSPALLSIANNIIVDPYAVTPTLQQSLIIY
FT                   GISALVFVVIILLNIFRAKWGYRVVSVLGIFSMATLVLAMIVLALNSGDFYSKISTLIT
FT                   ANNLNVTIPSSRGSFLPSSISWSATLFLLPFFALYTYPWMQAGPAVAAEFKGKKTIKWN
FT                   LPIALILTGILVTLAFLEMDLIGGYNFNLEAYPTFLYNFWTAAIAVASNPILQWIIALG
FT                   LIVWNIYILAYGVIVFARYVFALSFDRVLPTKFSEVNKHGSPVYAHVFDLSLTLLLLLV
FT                   PAFSIGAALSLYGATILGSLYFLVVSVAGIAFGIKERNYILSIAGLISAGYFAYLTYVA
FT                   ATNSDFGFMTSSGPNLITTVFVIGTLIVSALIYIISKIIHKRKGIDIDLAFKEIPPE"
FT   gene            565088..565396
FT                   /locus_tag="YN1551_0619"
FT   CDS_pept        565088..565396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47749"
FT                   /db_xref="GOA:C3NM01"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM01"
FT                   /protein_id="ACP47749.1"
FT                   /translation="MGTRDKYYALFVLSMATKRSILFTVTITLFHIGLLISKHHNYRFS
FT                   SCPFLAYIPLTSDFIVDTKCRYNLLKILDLIEEAEDGLTVEYISTNLNVSRKSVRIY"
FT   gene            complement(565408..566142)
FT                   /locus_tag="YN1551_0620"
FT   CDS_pept        complement(565408..566142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0620"
FT                   /product="Insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47750"
FT                   /db_xref="GOA:C3NFY4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C3NFY4"
FT                   /protein_id="ACP47750.1"
FT                   /translation="MGRKPVFRQDVSCPSCGSHHVVKCGRPLGRQKFLCRDCGKYFLGD
FT                   ASYHHHSRKLREEALRMYANGMSMRAISRVLNVPLGTVFTWIKRYGRKKHEKLVELWGR
FT                   AKELVKGKVVAKVVDEMWTYLYKNARAFYKWVFTCYVYTKLGVYLIYSVGDRDESTFLE
FT                   VKKYLPDEGRWVSDDYNLYFWLKDHTVVSPVNPNESFHSSLRDRLIRFKRATKAVNRSI
FT                   RTMMYSIALVLWERRLIPEFVA"
FT   gene            566179..566427
FT                   /pseudo
FT                   /locus_tag="YN1551_0621"
FT   gene            566209..566478
FT                   /locus_tag="YN1551_3259"
FT   CDS_pept        566209..566478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_3259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_3259"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47751"
FT                   /db_xref="GOA:C3NM03"
FT                   /db_xref="InterPro:IPR009844"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM03"
FT                   /protein_id="ACP47751.1"
FT                   /translation="MVGSYIPLMNTSVKLGLLVLWMTADSVVSIILTIEWPYYSNSIYS
FT                   ISPWPLDQEVLTAALMFLVMTTFFIIALSENTKIVNFQAFIVST"
FT   gene            complement(566454..568196)
FT                   /locus_tag="YN1551_0622"
FT   CDS_pept        complement(566454..568196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47752"
FT                   /db_xref="GOA:C3NM04"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM04"
FT                   /protein_id="ACP47752.1"
FT                   /translation="MVHACTRDCYDTCIFDDTHKPLDIFPFNGFTCSRGIADLKRNSLN
FT                   RIDNVYIEGKPNSIDKALDLIVKEIRKRKKEEILHVDYDGNQGLLTWYFPARLWNVIGA
FT                   ASTDYSICSSEGHEAIKLHYRNSIGALPEDFPKYDSFVIWGSELVFSFIHGWNLIKDKY
FT                   KVTIDVRISETAKRSNKYYIVKPGSDAYLAIGIMKKLFERNWADLSLLDDPEELREYVF
FT                   SFKDEEIEEATGLDSSKINELAEMYHYRRPLTIIGFALGRSINGGDAISLISLIPALIG
FT                   MKKGFFYANSQGLGIDFRYLRGLHRYSPSRIVGMAEVGKEVEEGRITFMFVWNSNPLHS
FT                   LPMSDRIYEAVKEGRLFLVVHDPYWSETTKIANVVLPAPTYLEKEDVVYSYWHNYLVYN
FT                   KPILPKRGFTEVELMRVLAVKLEIDDDVISEDEWLAIGKATGVNVTELKTKGFVKLLPK
FT                   YPEGKVRVKPLPDKLKKPNGNIIVFSSHPNYTNSQFKEIYGDKKGIVYNSEFEGIGYLS
FT                   TNYGKVKVMFKRDASIPRGVFFIHKSFLFDLEGKPINSIIGFAKGKYGNTPIINIDYVE
FT                   TIKA"
FT   gene            complement(568273..569211)
FT                   /locus_tag="YN1551_0623"
FT   CDS_pept        complement(568273..569211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0623"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47753"
FT                   /db_xref="GOA:C3NM05"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM05"
FT                   /protein_id="ACP47753.1"
FT                   /translation="MVWFLILQLIALLILVALSATLMAKGTRELERSFGKGIAGGLILG
FT                   FINALPETIIVIQAVLSGFYDIALGSALGGNILLLTLGIGLVSIFYYLKYKSNTITLDY
FT                   DINIEYSSFLIAVIILGIAVAYGKLNYYIGLFLLSPYIYYIYRRYKTYRNISKNGKNKG
FT                   NIIKGLIYVIIGGLPLIFTSKYLVSTISSIASMFNVSPLILAILITPIAAELEENLTAI
FT                   KLISDSPSSVTTALMNFIGSKLENMTLLLGIIGISQTVSLRPSLLYLLLILATSLLALG
FT                   IIKDRNIKVKEGLSLFGIYAILIAILLRFSA"
FT   sig_peptide     complement(569137..569211)
FT                   /locus_tag="YN1551_0623"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            complement(569260..570789)
FT                   /locus_tag="YN1551_0624"
FT   CDS_pept        complement(569260..570789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0624"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47754"
FT                   /db_xref="GOA:C3NM06"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM06"
FT                   /protein_id="ACP47754.1"
FT                   /translation="MEKTSLLIKSKELTGIYELKDGISYFKAYLAGQWISGDEWQDVIS
FT                   PIDLNVIAKIPKLSGNQVDNTLEHIYRKGRWTIRDTPGEKRLDIYKKMASLLDKFKEDF
FT                   VNVLMINNGKIRTAAEGEVKAAIERLLRADLDVKETRGDYVPGDWSSETLETEAVVRKE
FT                   PVGVVLSIVPFNYPLFDTVNKIVYTTVIGNAIIIKPPSSTPLPILMLAKVMELASFPKD
FT                   SFAIITLPGREMNKVVGDKRIQAISLTGSTETGEEVVRNAGIKQFIMELGGGDPAIVLS
FT                   DADLAWAAQRIATGIISYTGQRCDSVKLVLVEEEVYDTLKDLLVKELTKSVKVGDPRDP
FT                   STTVGPVIDVKTVDEWEKAIKDAVEKGGKILFGGKRLGPTYIEPVLIEAPKETLKDMYF
FT                   YNKEVFASAALLIKVKNIDEALEISNSRKYGLDAAIFGKDINKIRKLQRFLEVGAVYIN
FT                   DYPRHGIGYFPFGGRKDSGIGREGIGYTIQYVTAYKSIVYNYKGKGIWEYL"
FT   gene            complement(570828..571769)
FT                   /locus_tag="YN1551_0625"
FT   CDS_pept        complement(570828..571769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0625"
FT                   /product="PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47755"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM07"
FT                   /protein_id="ACP47755.1"
FT                   /translation="MVDVIALGEPLVQFNSFTSGPLRFVNYFEKHIAGSELNFCIAVIR
FT                   NHLSCGLIARVGNDEFGRNIIEYSRAQGIDTTYIKVDKESFTGIYFIQRGYPIPMKSEL
FT                   VYYRRGSAGSRLSPEDVDEKYIKSARLIHSTGITLAISDSAKEAVIKAFELAESRSLDT
FT                   NIRPKLWSSLEKARETILSILKKYDIEVLITDPDDTKILLDVTDPDDAYRKYKESGVKV
FT                   LLYKLGAKGAMAYKDSVKAFKEGYKVQVEDPTGAGDAMAGTFVSLYLQGKDVEYSLAHG
FT                   IAASTLVITVRGDNELTPTTEDAERFLNEFKT"
FT   gene            complement(571779..572663)
FT                   /locus_tag="YN1551_0626"
FT   CDS_pept        complement(571779..572663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0626"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47756"
FT                   /db_xref="GOA:C3NM08"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM08"
FT                   /protein_id="ACP47756.1"
FT                   /translation="MPEIVTPIITPFTKDNRIDKDKLTLHAENLIRKGIDKLFVNGTTG
FT                   LGPSLSPEEKLENLKVVYDVTNKIIFQVGGLNLDDAIRLAKLSKDFDIVGIASYAPYYY
FT                   PRMPERHLIKYFKMLCEVSPHPVYLYNYPTATGKDIDAKIAKEIGCFAGVKDTIENIIH
FT                   TLDYKRLNPNMLVYSGSDMLIATVASTGLDGNVAAGSNYLPEVTVSIKKLAMERKIDEA
FT                   LKLQFLHDEIIEASRIFGSLSSNYVLTKYFQGYDLGNPRPPIFPLDEEEERQLIKKVEG
FT                   IRAKLVELKILKE"
FT   gene            complement(572666..573853)
FT                   /locus_tag="YN1551_0627"
FT   CDS_pept        complement(572666..573853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0627"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47757"
FT                   /db_xref="GOA:C3NM09"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034599"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM09"
FT                   /protein_id="ACP47757.1"
FT                   /translation="MKIREIEPIVLTSKEKGSATWASTMIIVRIITENGAVGYGEAVPT
FT                   LRVISVYNAIKQVAKGYIGKEVEEVEKNYHEWYKQDFYLARSFESTTAVSAIDIASWDI
FT                   IGKELGAPIYKLLGGKVRNRVPVYANGWYQDSVTPEDFAEKAKEIVKTGYKALKFDPFG
FT                   PYYDWIDERGLREAEERVRAVREAVGNNVDILIEHHGRFNANSAIMIAKRLEKYNPGFM
FT                   EEPVHHEDIIGLRKYRANTHLRIALGERLLSEKEAAFYVEEGLVNILQPDLTNIGGVTV
FT                   GKSVIKIAEANDVEVAFHNAFGSIQNAVEIQLSAVTQNLYLLENFYDWFPQWKRDLVYN
FT                   ETPVEGGHVKVPDKPGIGVSINEKIIEQLRAEPIPLDVIEEPVWVVKGTWKNYGV"
FT   gene            573890..574276
FT                   /locus_tag="YN1551_0628"
FT   CDS_pept        573890..574276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47758"
FT                   /db_xref="GOA:C3NM10"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM10"
FT                   /protein_id="ACP47758.1"
FT                   /translation="MARLSDKDLIKFIGYIIRIILLFGIGVQMVITIYGIISSIFSLNL
FT                   LDLVNVTITGPLLILVLIELYIAVNSYLSGKERSIINVIDAGISFFVRELILELFSQNY
FT                   NITNILIIAGVVGILSFSRFIANR"
FT   gene            complement(574247..574630)
FT                   /pseudo
FT                   /locus_tag="YN1551_0629"
FT   gene            complement(574627..575226)
FT                   /locus_tag="YN1551_0630"
FT   CDS_pept        complement(574627..575226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0630"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47759"
FT                   /db_xref="GOA:C3NM11"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM11"
FT                   /protein_id="ACP47759.1"
FT                   /translation="MEEVQKPPNQKYIKNFIVYAEFGIPEVNLESYRLKVSGEVENSLS
FT                   FTYDELMKLPRREIIEDFHCVTGWSIKSVKWEGIPFKLLIETAKVKKDVNWVMFYSLDG
FT                   YTSIIPYEDVLKDNVIVALFMNGEKLPLKHGFPARPIIPHLYAWKSAKWLTEIEFIKDY
FT                   VDGYWEERGYHERGNVWEEERFKGQGGKHLRRRPVL"
FT   gene            complement(575276..577024)
FT                   /locus_tag="YN1551_0631"
FT   CDS_pept        complement(575276..577024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0631"
FT                   /product="Chloride channel core"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47760"
FT                   /db_xref="GOA:C3NM12"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM12"
FT                   /protein_id="ACP47760.1"
FT                   /translation="MNLSSLPYFEKWFILGIFLGVVAGLAATTFYLLLHLFEDIFLFHF
FT                   IGMSYPRPLGEGGTLNFIFHPGNYLLIPISTAIGGLISGIIVYTFAPEAEGHGTDAAIK
FT                   AYHYFQGKVRWVVIPVKIIASAITIGSGGSAGREGPTAQFSAGVGSVIADLLHLSPEDR
FT                   RRALAVGIGAGIGTIFKTPIGGAILAAEILYRRDLEPEVIYPALVASAIGYTIFGSIFG
FT                   FTPVFGYYTGTFDPLRLPMYAVLGLVSGLMAILYPKTFYGVNSLFKKLRIPNHVKPAIG
FT                   GLITGLIALLAPEILGTGYGWINLVEYEKFFTLYSPLIPTIILLVILPFLKILGTSFSI
FT                   GSGGSGGVFAPGLFIGAYIGTSVGLLFHYLFPNIVPTIAPFVIIGMMSFFAGAGKVPLS
FT                   VLIMVTEMTSSLQLLPGAMIAVAISYLVSGNNTIYISQLPTRRDSPAHKAEYETPLMET
FT                   VRVEKCELRDIKAYTDDKVGKAIQIMLENNFMSLPVVNYDNRFLGVVYLRDLERANPED
FT                   SLGKYITRGSPSVSLTSTLEHALEVMATNKARWVAVVDKGKLLGIVTYDGIIDAYKREL
FT                   NAIKNS"
FT   gene            577175..579133
FT                   /locus_tag="YN1551_0632"
FT   CDS_pept        577175..579133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0632"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47761"
FT                   /db_xref="GOA:C3NM13"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM13"
FT                   /protein_id="ACP47761.1"
FT                   /translation="MEQEITENIKEIEEKVDYNIRLYKEIYRESIENPSKFWSKLAEEL
FT                   IDWFEPWKETFTQEILTKWFVGGKLNASYNAIDRHLNSSKKFKAAIIWESEKGERKVLI
FT                   YQDLFYEVNRWANALKQLGVQKGDRVTIYMPLTPEGVISMLACARIGAIHSVVFAGFGS
FT                   QALADRIADAQSKVVITADGYYRKGRLVELKKTVDGALSKLQNNPVKNVIVFRRSGTET
FT                   PFKEGRDIYFDEIGKYRYVEPEPVDASHPLFILYTSGTTGKPKGIVHSTGGYLVGTAAM
FT                   LLWSYGLSQENDVLFNTSDIGWIVGHSYITYSPLVMGRSVIIYESVPDYPYPDKWAELI
FT                   EKYKATTFGTSATFLRYLMKYGEEYIKAHDLSSLRIMVTNGEPLNYAPWKYGLEVIGKG
FT                   KVFMSHQWWQTETGAPNLGYMPGYPIFLTMKSGPASGFPLPGNKIKVVDENGNLVKPRE
FT                   RGYLIMEPPFPPSMMIGMWNDEDNERIIKTYFSKFPNVYYTGDFAMIDEDGYVWVSGRA
FT                   DETLKIAGHRIGAGEVESAITSHPAVAEAAVIGIPDPVKGETAHAFVVLKQGYHPGNEL
FT                   AKSINEHVKKVMGPIVILEVHFVNALPKTRSGKVMRRVIKAVMMGSAVGDISTLEDEAS
FT                   MEEIKKAIEALRSQLNP"
FT   gene            complement(579122..580204)
FT                   /locus_tag="YN1551_0633"
FT   CDS_pept        complement(579122..580204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0633"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47762"
FT                   /db_xref="GOA:C3NM14"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR026583"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM14"
FT                   /protein_id="ACP47762.1"
FT                   /translation="MKALVVHPPNKGVEVKEISDIDRSLNGNEVLIKTIANGICGTDRG
FT                   IVSGLLKFSRPPTGKNSLVLGHENLGQVIDKGSNVQGLSKGDYVVSIVRRGCGKCSNCL
FT                   AGRQDFCETGEFVEAGIRGLDGFMREFYIDNTSYLVRIPYEIVDIAVLLEPLSNVVKAY
FT                   NELMLTQRRMIWWCKDGSYGCKNVAVVGSGPIGLLFSLIFSVQGFNTFVLNKRDPFPTE
FT                   AEIIEKINAKFINTTKGQLPYVIDVLIDTSGYPSAFIPLMNKLNKNSAVILFGTTGGEK
FT                   FEVNADLITYLVENNVLLFGSVNASKRDFEEGVNYLTIWKYRYPNVLNKMITRVVKPEE
FT                   ASEILYTKPRGEIKTIISWV"
FT   gene            580555..581388
FT                   /locus_tag="YN1551_0634"
FT   CDS_pept        580555..581388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0634"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47763"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM15"
FT                   /protein_id="ACP47763.1"
FT                   /translation="MNIETLMIRNPPILSKEDRLGLAFKRINEGGIGRIIIANEKIEGL
FT                   LTTRDLLSTVESYCKDNCSQGDLYRISTTPVIDYMTPNPVTVYNTTDEFTALNIMVTRN
FT                   FGSLPVVDINDKPVGIITEREFLLLYKDLDEIFPVKVFMSTKVRTIYKDVRLDQAVRLM
FT                   LRRGFRRLPVIDDDNKVVGIITVVNAIRQLAKAVDKLDPDYFYNKAVKDVMVTNLVTID
FT                   ELASVNRAAAEMIVKRIGSLLILNKDNTIKGIITERDLLIAVHHILVMEKFKEKL"
FT   gene            581413..581793
FT                   /locus_tag="YN1551_0635"
FT   CDS_pept        581413..581793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0635"
FT                   /product="endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47764"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM16"
FT                   /protein_id="ACP47764.1"
FT                   /translation="MKEIVFTDKAPRPIGPYSQGVKVGDVLYVSGQIPVDPNTNEIVGK
FT                   NIEEQTIRVIENIKAILESAGYMLDDVVMSFVYLKDIKDFQRFNEVYSKYFSKSPPARV
FT                   TIEVSRLPRDALIEISVIAQKG"
FT   gene            complement(581790..581978)
FT                   /locus_tag="YN1551_0636"
FT   CDS_pept        complement(581790..581978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47765"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM17"
FT                   /protein_id="ACP47765.1"
FT                   /translation="MIEPMARKVFEGLAYTIWEDDEASVVLLEGKPIQASCVEHGNHNL
FT                   FDLECPHVEKLLKKIFS"
FT   gene            complement(582016..584025)
FT                   /locus_tag="YN1551_0637"
FT   CDS_pept        complement(582016..584025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0637"
FT                   /product="serine/threonine protein kinase with TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47766"
FT                   /db_xref="GOA:C3NM18"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM18"
FT                   /protein_id="ACP47766.1"
FT                   /translation="MQLVLQLDDQKYLYVDGIIRPFDGKIKTRDDVIGYGVIYDAGKVK
FT                   VLYDYKVVRVSDFSVVTQAILKEKIDNLNIYLFENGNTIYAYFGNVPNPKLNFPYMIIH
FT                   GIPIALGSKTEIIEAIERDYRVALYALDNFRNDPSIVNHSILSLVKFEKCEDAVKYYKE
FT                   LRVSDPEVSLAVAQCMEKIGEELEALKIYSFLSEEKYRELENKIRGKVNSIIEEYKKEG
FT                   NVKLLIDSVKMLPTYDAPLIELGWYFVNKRKFDDAVKYFEEAVKRVPTFHNLLLYAWSL
FT                   ISSEKYKEALEVIEKAERVKRNAGSAYIKGLALEGLNAPSQAEREFLYACREGIIDACM
FT                   KIRSYKLYVPEPFDAAAWLGYVLYGYEVKQLLGNGGMGYVLLVERNGRKYAMKVMKKEY
FT                   TFIEMLYEVAKMQEISKRSEYLVKIFASFLDENWTDYFSSPPAIIMEYMEGGDLRSVLV
FT                   DQEYSALRHSVKWPQVVAFVFSKLAKAVIEVHKEGYTHCDIKPSNILFNKKLPRYGEDA
FT                   LNSLLNFEVVPKLSDLGSSVKIGTPVMHYTPYYAHPLQRFGNKAETMFDVYSFTVSLYV
FT                   SLTNNFPYPEWLENEIEEAVKNPEKRKQALDDFHKAAPRLDYVPVEFKDLIMSGLKGEV
FT                   GMLEINRKLEEILIEDYNIDINNSNSEAEKLISY"
FT   gene            complement(584171..584971)
FT                   /locus_tag="YN1551_0638"
FT   CDS_pept        complement(584171..584971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0638"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47767"
FT                   /db_xref="GOA:C3NM19"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM19"
FT                   /protein_id="ACP47767.1"
FT                   /translation="MKLCNKEISQIGFGTWKIGGGYWNPDYSMDSYYIEILKYVISKGI
FT                   NVIDTAEMYGGGHSEELVGKSIQDLDRDGIFIITKVWSNHLRYDDLIRSAKNSLRRLNS
FT                   KYIDLYLIHWPNSSVPLEESIRAMEELVDQGIVNCIGVSNFDVKLLEEAMSLTKKYEIV
FT                   ANEIEYNVENKSAEKDVIPFCERNNIKLIAYSPLARGNIKNNKILDEIGRKYNRTSVQV
FT                   ALNYLMRRSIPIPKASSKDHIDEILGALGWNLSDEDYERISKSK"
FT   gene            complement(584974..586605)
FT                   /locus_tag="YN1551_0639"
FT   CDS_pept        complement(584974..586605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0639"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47768"
FT                   /db_xref="GOA:C3NM20"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM20"
FT                   /protein_id="ACP47768.1"
FT                   /translation="MIKYQDMNAGKIFLSLLKESGINKIFIVSGTDYASLIEAKVEDPS
FT                   LPDFEIVPHEITAISTAIGYALGNKLSAVAVHTTPGTANALGGIMSAYTSRIPLLVIAG
FT                   RSPYTEKGSTASRNLRIHWTQEARDQGELVRQYVKYDFEIRMADQIPAAISRAIQIMMS
FT                   EPRGPVYLVLPREVSIQEVNEVKRIPMDYYEPAPSPEKINKAKEMLEKSERPVIITWRA
FT                   GRRKEWFESLRRFADSYNIPVLNYAGEVLNYPSNGAMALDRFDLRNADLLLVVEAEVPY
FT                   FPKKIDLDIPIIKVDVEPSYSYIPYYGFRCDLCIQSIPSNFFDYISIRAKSYDEIRELK
FT                   IRQEEYKKQEIERLKDRKSIHPKYLSYEIGNVASEYNLAIFNEYQFNPRYAKLNEFGSY
FT                   FADLSIGYLGLALGAGVGYKMATNKDVLITTGDGSFIFGVPEAYYYVSSKYPTMVVIFD
FT                   NGGWLASAEAVDEVFPEGLAKSKRYYPGADFDKRFEIGKTVEAFHGYYELVEDPWEIKS
FT                   ALIRGLEKVRKENKIAVIQVIVDKVR"
FT   gene            586743..587999
FT                   /locus_tag="YN1551_0640"
FT   CDS_pept        586743..587999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0640"
FT                   /product="aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47769"
FT                   /db_xref="GOA:C3NM21"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM21"
FT                   /protein_id="ACP47769.1"
FT                   /translation="MSKKVDELVKEDQEYLMQSFRRWYPFAIDRGSGAIVYDIEGKEYI
FT                   DFNAGIGVVALGHKNEKIISAVKEQMEKFFHYSLTDFYYEIAVEVAKRLSSLMPFSAKV
FT                   FYTNSGTESVEAAIKIARGHTRRQWIIGFINSFHGRTLGSLAFTSSKAIQRKSFSPLLP
FT                   STYLIPYPDKRDPLCKEDCTETLLGFIEDWIFKKVVDPNEIAAFIAEPIQGEGGVIVPP
FT                   KDFFYKLNNLLKKFGILLILDEVQTGIGRTGKMFAFEHFNVTPDLVCLAKALGGGLPLG
FT                   AVIGRKEIMDLPPGSHANTFGGNPLALAAAKVILEEVPKLLDHVSSIGKKIIEELKDTR
FT                   SPYLYDVRGLGLLIGAELRKDNKPFVEGLEKVLYNSFRRGVLAIGAGESVVRIEPPLII
FT                   EEDLALKGTRILIEEIEKL"
FT   gene            complement(587996..588388)
FT                   /locus_tag="YN1551_0641"
FT   CDS_pept        complement(587996..588388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47770"
FT                   /db_xref="GOA:C3NM22"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM22"
FT                   /protein_id="ACP47770.1"
FT                   /translation="MAEKEVGIAKLTLRWTTAILSALWAGVHMVLTHAILPNSTATMIY
FT                   DTFFGFTSALAIIAAVLIIQGIKYSYPLITAFYAIDLALLSETRLGPALFVGKKLPFNY
FT                   YVDISLALDAILIVLSLVLILVDKRS"
FT   gene            588513..589301
FT                   /locus_tag="YN1551_0642"
FT   CDS_pept        588513..589301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0642"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47771"
FT                   /db_xref="GOA:C3NM23"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM23"
FT                   /protein_id="ACP47771.1"
FT                   /translation="MMILTYLSALETILAGTTIVFGGIVEGYGYGLSLGTNWPYTHDIM
FT                   QLAAKKDPEAIHRILATLVGIFSLAILIIRPSLISIIGFVSVVFTALLGMATLYVLAGK
FT                   LPSIFQGLHDIAAYTTFVSYFLIMLQGLGMFKLDIVSFLISAIVPPHFLYFVIFMGGVV
FT                   TGTRRMKLKIGRPWEKDKERNPWLQAAWVIHGIVSLIFIIAVVLLHYWLTLIFTALEII
FT                   VGLWVWDSSNRNPLKPGMSIGLHQLFSILVVVAIILNSIS"
FT   gene            complement(589317..591629)
FT                   /locus_tag="YN1551_0643"
FT   CDS_pept        complement(589317..591629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0643"
FT                   /product="protein of unknown function DUF699 ATPase
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47772"
FT                   /db_xref="GOA:C3NM24"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM24"
FT                   /protein_id="ACP47772.1"
FT                   /translation="MVNKEQFYDQIIKAFEDGNIRYYRNLVYIEREDYLDYVKEIINLF
FT                   LKFKQDPSVAYGFVPWASGSKERMKTIKEYFSKFDDIDYANAEYYLGNTYDLVILDTID
FT                   NFQPINIGRLVDLARGGGLIIIYTNNLTKDKAFRTSIVRNGLVLDEYEKRFKRKLYEHE
FT                   GIFIVDANGYVSKPFSGNIMLKSEKKVPRNPVMPREIHELSLSEDQNRVIENFTYLLSG
FT                   GQRALVLTAARGRGKSAATGLSIAGLIEKLRERKGKSIRVIVTAPSIASASQVMLFAKL
FT                   GLKVLGEELSVKVSDTGHIKTLRGDYFKVEYVPPDAAIEDDGELLIVDEAAALGINYID
FT                   LALRAWKKVALVTTVHGYEGSNKAFLRYLRRLIESKRIRVKWINIEQPLRYANGDPIEK
FT                   WLYDTLLLDAEPSEPQYLNHTMIYEDVDKSELANDDIKLRAIYGIMVTAHYKNNPDDLM
FT                   IMLDGVHHKIKAIRIGENSYVAACQIAEEGELSDNMVDIALKGGTFDGDLIPDRIIKHV
FT                   RIKDFARLRGWRIVRIAVASELQDKGFGSELLKMIYEEAKDKGMDWVGSSFMSDQKVLN
FT                   FWIKNGFAPVHISPKKNEKLGDYPVVVIRPISDIATKIVKISVYMLKEKLLNTLHDVYF
FT                   NMNPEVVRLILKGSSVAHKTVDVNPILLDKTISFLQGVSPYESSADGIHMLTLKYFWDG
FT                   ERDWGLTQDEELVLIAKVIQGKPWSYVSTILDSNRTHIYELIYSAISKIMQKYYNLTAD
FT                   SKVGLTLKDVMSSQQYE"
FT   gene            complement(591633..591878)
FT                   /locus_tag="YN1551_0644"
FT   CDS_pept        complement(591633..591878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0644"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47773"
FT                   /db_xref="GOA:C3NM25"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM25"
FT                   /protein_id="ACP47773.1"
FT                   /translation="MELKELQSKMKEMYFEKDSQRGIYATFTWLVEEVGELAEALLSND
FT                   SDSIQEELADVIAWTVSIANLKGIDIEEALKKKYKL"
FT   gene            complement(591868..592227)
FT                   /locus_tag="YN1551_0645"
FT   CDS_pept        complement(591868..592227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47774"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM26"
FT                   /protein_id="ACP47774.1"
FT                   /translation="MELPEEVKNNLNEGVCLTCCNDSVVCMTSDYPKNANVEVLFEIDK
FT                   EGREVIFRHIIMDDPSNPLTVEYSVDTKFVENVSRKKWINIHFVDENFNEKIKLRLTFS
FT                   DDEIRVMRREIGLGT"
FT   gene            592272..593711
FT                   /locus_tag="YN1551_0646"
FT   CDS_pept        592272..593711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0646"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47775"
FT                   /db_xref="GOA:C3NM27"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM27"
FT                   /protein_id="ACP47775.1"
FT                   /translation="MPSAVGKKVVTTQNYIASYVGAKVLEEGGNAFDAAIAISATLSVV
FT                   IPHTSGLGGDGFLLAKTPEGLIAYNASGWAPKELKVEKIDNDRSPLTVVVPGLIDLWEF
FT                   IYENYASKSLNELLNSAISLATNGFMVGRGLHHAIVSSFKLSDDWNRIYGNKRFGDEIR
FT                   LKGIARVLKEIAKDPRNFYDGKIAEELTNGLRERGVPMSYEDFSEFRGEIISPVKMKYK
FT                   DFTLYELPPNTQGITTLELLKMVEITELNKLPFNDVRRINDHVRLSALAYADRNKYIAD
FT                   PKFVNVPIEMLLSEKYIANKVAEYGFEVKVDVTGDTTFFAVSDGENEIGFIQSLFYPFG
FT                   SGIVVNDIPFNNRGAGFSEGNNKPEPRKRPLHTLSILMAEKEDERVFIGCAGGDLRPQI
FT                   HAEVFEYYADYNMEIDEAVQAPRFMYLGNKVVAEKRLGVPATQTDYYSPEVGIVQALKY
FT                   KMGRYIGVADIRSEGVVLPVK"
FT   gene            complement(593908..594804)
FT                   /locus_tag="YN1551_0647"
FT   CDS_pept        complement(593908..594804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0647"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47776"
FT                   /db_xref="GOA:C3NM28"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR039758"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM28"
FT                   /protein_id="ACP47776.1"
FT                   /translation="MILVGVDGGGSKTSAIAYTCSGSFLGKGLAGPANFHNVGVEETVK
FT                   NVNKAILLATKGMKPDVAYIGLAGIDSKYDYNVMSEALRLVAKDVYIDHDGFVALYAET
FT                   RGNPGVIAIAGTGSVIVGYDGNRRVRFGGLGWLIADEGSAYWIGREALRAFGKMLDGRM
FT                   NKTLIAEKIMRSLNINNLDDLIKWAYHEGHKVKEIASLSKIVDEAANEGDEIALNILKS
FT                   AAFELASDAVKMAVKIGVDKIYLKGGMFSSPIYFSFFRSYLDSNNIRSIVAEHEPEQGA
FT                   LLLAFKQAGCDINVLDF"
FT   gene            complement(594821..595582)
FT                   /locus_tag="YN1551_0648"
FT   CDS_pept        complement(594821..595582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0648"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47777"
FT                   /db_xref="GOA:C3NM29"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3NM29"
FT                   /protein_id="ACP47777.1"
FT                   /translation="MLKKAVITSAGKGSRMKHITSVLPKALLPLFVTENGGKVTRPVID
FT                   LIMDSLNKVGIEKFCIVVGRNGMLLMQYLFDRTPTFVFQDMPKGFGDAVLRAEDFSSNE
FT                   PFFVHADDGVLTKGYDSLKLLFDEVSPDAVLFVRRVENPSRYGVVTIQDKGVYDGHKLY
FT                   KVIDAEEKPLHPKSNLAIAAVYIFKPSIFSALKQINVEEGKEIELTYGIHNLLLDGKEV
FT                   YALEMNEDEKWLNVGDPKSYLDALNYSFKFL"
FT   gene            complement(595627..596967)
FT                   /locus_tag="YN1551_0649"
FT   CDS_pept        complement(595627..596967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0649"
FT                   /product="amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47778"
FT                   /db_xref="GOA:C3NMF8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMF8"
FT                   /protein_id="ACP47778.1"
FT                   /translation="MSTSSLSKAQQSQEPKRHLGFIDIVFLSMGSQAPFLSILTYGVEA
FT                   FIIAGFLAPIAIILGTLLVLLNGFVVYELSKRFTKAGGYYTYAFYSLTKRLGFETGWLY
FT                   VLYSTTYGVAYVFGTTYIIYHILGVNPWIIGLGLLSIASLFAIMGIKISTKYAVFTSLL
FT                   EIGIMTILAIVFLSSTGFHLYNPLSFHVSLGTLAYAILFGSSIPTGYGSITPVSGEAKD
FT                   AKKTISRAIITVILLGGLLAAFDIYAIGDHLLFYKISANNVDILHLIENKFGLITFIFV
FT                   LFAAINDGILGSLGFIIATSRTIFAMSYTNLLPKVFSKFESYKGPTNAVVLSVLLYFLT
FT                   SLLGLYFINNPFLAFGVLGTIALFSSLFVHVAANFSLIKISIKKFRKRLLQIIIGISAV
FT                   IFSVFELVNSISSASPIEVYIFMSFIIIGFLAAETLSMIEEENEEEE"
FT   gene            complement(597026..598144)
FT                   /locus_tag="YN1551_0650"
FT   CDS_pept        complement(597026..598144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47779"
FT                   /db_xref="GOA:C3NMF9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMF9"
FT                   /protein_id="ACP47779.1"
FT                   /translation="MQLKWINFFFYLALVVLISVYTYETIITFSSINSYIGDEVWYPTA
FT                   AYNMLKLVFHVTPPPMINIGYPNEQNIQTYINPEHPPLAKYIMAVFIYFIGYYPIAWRL
FT                   PSWILGDLMLIVGYFLAKKMIGNGILGNLAGILSSLLIALDPNVWSLHGIGLLEIYVSF
FT                   FSLLSLYFLLKDKPLWASLALALAMLSKESAYVLIFPFLYYLGEISNNVKKRAIYGIGL
FT                   PILIYVLFSTPLIAYYGGVKAWLDATVIHSASWDITNGHITLTATSQISTPWDWFLNIH
FT                   SFYLGYNLYANTNPYVLILWIITTPLAFIFRDSKMITTTMWAWTMWIGFVIVYFLGNHT
FT                   LFSFYVTDFMPVADTYVVVSLFRLVKKINILK"
FT   gene            complement(598155..598973)
FT                   /locus_tag="YN1551_0651"
FT   CDS_pept        complement(598155..598973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0651"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47780"
FT                   /db_xref="GOA:C3NMG0"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMG0"
FT                   /protein_id="ACP47780.1"
FT                   /translation="MVGSEIRMARLFEKGRAFVVALDHGLVMGPLKGIENPIEVVAKIA
FT                   KNGPDALQMTPAMVKLVKENFFSRGSPMLIARLDTANVWRQKYKVYNEGYYASIYTVKD
FT                   AINIGADAVVTYLVVGYGSDIVEGYNLSALGSLRKEANDYGIPFIIEPLYVTKDNPDSV
FT                   KELDLVKYVTRLASEIGADILKVDYTGSKESFRQVVNVAFSPILIRGGPKTNTNEEFLK
FT                   MLRDALEAGAKGVTVGRNLWQADEPDKLAKAISKVVHENLDIGEALKILK"
FT   gene            complement(598984..600456)
FT                   /locus_tag="YN1551_0652"
FT   CDS_pept        complement(598984..600456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47781"
FT                   /db_xref="GOA:C3NMG1"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMG1"
FT                   /protein_id="ACP47781.1"
FT                   /translation="MDKKESVRVTRIGIINLLTRTLGAPISFIFTLLVARYLSNPPYGI
FT                   IYFATWQTLYVFTIGYFTIPANLFSLITSRYSAERKNVGGIVITNLIAGIISGLVFALL
FT                   VPYYISLTKLNVPIYFYSAISLIILTYLLTVTNSIAQGRTPKIIGISALIFQVLRLVSG
FT                   IVFMFLFNLSILAVILAYSIGYLAQILFNLFFIRANLKIDFKVAFSAVRKAVVYIANYI
FT                   QYILEASIVWITLAIVKSDLVVAYFESAIIVSNVQIWSQAIYTGLMAKLAEDKNPSIIS
FT                   DAIKLYSIVGSLFLILIYIDGYGLLYKLRPEYTAAIFSLYILTFSNFIRGFYNIFYQGI
FT                   TMADPTLSVESKNEFKGHLFKLTTSNLLFSLLGLGISTLLIYLFSSYSPYLLAAFMSIG
FT                   IIINSFSMLFTSYRACRQIYKFNFPVKEFLVPLGLGALSLPLSVVYRPVSFLAMGIYAI
FT                   MIISIFTLYNYAFNPYGRRLVIAIIREFKQRV"
FT   gene            complement(600541..600930)
FT                   /locus_tag="YN1551_0653"
FT   CDS_pept        complement(600541..600930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0653"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47782"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMG2"
FT                   /protein_id="ACP47782.1"
FT                   /translation="MKEEFVREYMKSNVVTVSKNTVLREVTRIMTDNNVGSVIVVDNGK
FT                   PIGIITERDVVRAIGKGKSLDVKAEEIMTASLITIKEDSPITGALSLMRTYNIRHLPVI
FT                   DHDGNLRGIISIRDIARAIDDILEG"
FT   gene            601038..602018
FT                   /locus_tag="YN1551_0654"
FT   CDS_pept        601038..602018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0654"
FT                   /product="peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47783"
FT                   /db_xref="GOA:C3NMG3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMG3"
FT                   /protein_id="ACP47783.1"
FT                   /translation="MNWEVVKLRLNMALATLGIVLLGFALALAVADYAFGAQFGVGLML
FT                   SILMFIFFLNIIQWLFGPYMINWAYRTVEVTPTDPVYGWLYSTVAEVAKYNGFRDVPKV
FT                   YIADVPFPNAFAYGSPIAGKRIAFTLPILKLLNRDEIMAVAGHELGHLKHRDVELLMAV
FT                   GLIPALIYYLGWWIFWGGMFGGGGGNGRGNNGGLLFLIGIAMMAVSFVFQLLVLSINRM
FT                   REAYADVNSALTVPGGKENLQLALAKLTLSMDPGALEKFKKKSTTNQMASMLFFTNAIE
FT                   EVPTWNARELVEIWKTTKVPWYAEIFMDHPHPAKRIQLLEKVSKY"
FT   sig_peptide     601038..601127
FT                   /locus_tag="YN1551_0654"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.687 at
FT                   residue 30"
FT   gene            complement(602019..603122)
FT                   /locus_tag="YN1551_0655"
FT   CDS_pept        complement(602019..603122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0655"
FT                   /product="GMP synthase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47784"
FT                   /db_xref="GOA:C3NMG4"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR026598"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMG4"
FT                   /protein_id="ACP47784.1"
FT                   /translation="MFDPASFVKEIGPQLKQKVGNERVLAAVSGGVDSTTAAVLAYNLL
FT                   GNKVIPVLIDTGFLRKNEAEKIKAYLSNVLPNLIVVDERETFTSEIEGMEEAEAKRKKF
FT                   RELFYSSISSLMRKFNAKYLMQGTIAADWVETQGGIKTQHNVLVQIGIDTEKEWGFTLI
FT                   EPLADLYKNEVRELARYLKLPKEISERQPFPGPGLLVRTIGKLTREKLEVVREANDIVE
FT                   KYLDPFNYSQYFAVSFESDGNFVILDGIDAFLYKARATGVKGDVRAYGNIAKVECSDIN
FT                   AAKSFVDTLVKYDITHVLCSLDERSNGKYSIAIRAVITEDFMTADYARIPKEVLEKISS
FT                   EILQKIPNVKEVLYDVTSKPPATIEFE"
FT   gene            complement(603140..604537)
FT                   /locus_tag="YN1551_0656"
FT   CDS_pept        complement(603140..604537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0656"
FT                   /product="cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47785"
FT                   /db_xref="GOA:C3NMG5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMG5"
FT                   /protein_id="ACP47785.1"
FT                   /translation="MSIIVASTMSDSGKSFVTTGLVRILNAKPLKIQNMSLNSISTWDG
FT                   GEIAFIQAYQAWGAGIRPERHMNPILLKPMGKGLEVIFMGNSLGIMSGNEYYNLATNTL
FT                   WQKISQFLSSNVVIEAAGGIGEPNFIDKDITAIKVMKDKGIPAILVLDIDRGGAFASGY
FT                   GTYMMLPQSIREKLKGFIINKFRGDEKFLYDAIKWLEEKTGMKYLGYLPFLSEVPIMPE
FT                   DSMNIYNFGEGDVEVAIIAYPYMSNFNELYALAKSNAHVSFVKKPKEIVKADLVILPGS
FT                   RNTLESLKWLVENGFVEYLRQKTRGILGICGGFQILGKKLIDPYGIEAGYPIEYEGLGV
FT                   FDVNIHYGKAKVVSISSGVSEYGKIDGYEIRRGVVKYVDEKPLLKITVRNGEKVSVEDG
FT                   ARKDSIIGLSVHGSLFSEGMKKLLKEFNINIYSLSMVDEIQQQAIRVEQFLRKYLHIDE
FT                   IVEIYKQ"
FT   gene            604573..605334
FT                   /locus_tag="YN1551_0657"
FT   CDS_pept        604573..605334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0657"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47786"
FT                   /db_xref="GOA:C3NMG6"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMG6"
FT                   /protein_id="ACP47786.1"
FT                   /translation="MRLKGVLALFSFFTAIPIKSNASLEEIAEYSYISPLIIGISLALI
FT                   ESAVYVLLYRILEALAGIVLLGVVELLRGFNHLDGLLDLGDALMIKGDRERKIKALKDV
FT                   EIGSGGIGLLLVYLSIQIVALLKLGFSFYTIFHLISSNVLSMTIGLYILSTISPIPESN
FT                   LGKIFHNKLKGKSTVLLLELIPFISLYNIIVFLVFYMIMHKICRSLGGSSGDIAGASIT
FT                   LSFPLFLLTNEITNLNYSLLSILCYLFLHLH"
FT   sig_peptide     604573..604641
FT                   /locus_tag="YN1551_0657"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.968 at
FT                   residue 23"
FT   gene            605307..606224
FT                   /locus_tag="YN1551_0658"
FT   CDS_pept        605307..606224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0658"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47787"
FT                   /db_xref="GOA:C3NMG7"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMG7"
FT                   /protein_id="ACP47787.1"
FT                   /translation="MLFVLALALIWDLTISEPPIYIHPVVWTGKISEALIKPYKGYSYG
FT                   VLLWIMSVLPPLFIFVYLPVEAPIPIYLNLIILAFSLKTTFSIKMLYDIVKKGSRLDEQ
FT                   ARYYAQQIVRRDLSKSDKGHIASALIESLFESTVDGIASPIFWFLIFGIFGAMLQRLAN
FT                   TMDSMVGYKTPELRKEGWFSAKIDTILNYIPARLTGMIMLTSGFILGLNVKQGWKTLRE
FT                   AKMESINAKYPIAIAAGLLNVSLEKVGHYRIGNGNLPDEKDVKNALKLFKLSLILYFLL
FT                   ILTIYYYLYGISLLSYPYGLIELI"
FT   gene            complement(606153..607190)
FT                   /locus_tag="YN1551_0659"
FT   CDS_pept        complement(606153..607190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0659"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47788"
FT                   /db_xref="GOA:C3NMG8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMG8"
FT                   /protein_id="ACP47788.1"
FT                   /translation="MVEEFSHMKSVVIENGKVAIRELPLPKLHQGDVLVKMKACGLCGT
FT                   DIEKICGQYTASQPILGHEPAGIIQESTVDWLKPGDRVFAHHHVPCYECYYCKKGSPTM
FT                   CPYYRKTNLDPGGFSEYFRVPAWNVVRGGILKLSDNVSFEEGAFIEPLATVIRAQRRVM
FT                   INKDDIVFIVGVGPMGLLHAMMAKVNNAGVVIASDVSEFRVEFGYKVGIDYSLNVKKVS
FT                   VVDEVKKLTDGRGADVTIIASGSPSAIISGLNATRKGGRVLLFGVPYKGTILNYDISDL
FT                   LNNEISIIPSNAAVEEDTKEALSIIANKKIDVTKLITHRFPLDEFNEAVRVAKEGNAIK
FT                   VIIYS"
FT   gene            607232..607780
FT                   /locus_tag="YN1551_0660"
FT   CDS_pept        607232..607780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0660"
FT                   /product="peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47789"
FT                   /db_xref="GOA:C3NMG9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMG9"
FT                   /protein_id="ACP47789.1"
FT                   /translation="MDLIITFGLLTLVILLEFVVVPAIVLKRVTKFSTLYDYPIYIVNS
FT                   NEVNAYSLNSVWGKFIVITRGLVNEEDEEHVRAAIMHELGHLKLNHHVKMSLYIISVII
FT                   AFTYLLNLNLFVLIPFGLFALFMQRYFQRRFELSADKFALRFTNRRLLEDLITKYDVKE
FT                   TTFLSTHPNIHVRLKNIDQ"
FT   gene            607789..609921
FT                   /locus_tag="YN1551_0661"
FT   CDS_pept        607789..609921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0661"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47790"
FT                   /db_xref="GOA:C3NMH0"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMH0"
FT                   /protein_id="ACP47790.1"
FT                   /translation="MYVGKPIKRIEDPKFLTGGSTYVDDIEFPGTLFVAFLRSVKPHAK
FT                   IKIKKNHNGIFTGEDINPGSDFPIPVEETTYVGQPLAMVVGRDRYEAYDLLESIEMEYE
FT                   ELPYVIDPQEALKNDVKVYSKKESNIYEYKKWEAGNVEQSLREADLVINGELYNQRVIA
FT                   NPLETRGVLAYFDGNRLNVWSSTQSSHYLRRNLINFLGIDNIRVIQPDVGGAFGSKIIA
FT                   HPEEYAISKLALKLKRPLKWIPTRSEEIQSAGHGRDKRLRFKVGVKRDGTILGIEGTLI
FT                   ADLGAPYPDANDDEIGNVHSTVRMMLGPYRIQNIRIEHYAVNTNKAPTQSYRGAGRPEA
FT                   TYFIERIINIISLELGKDEFDIREKNLIRELPYKNALGITYDTGDYVGLLNKAREYYQR
FT                   LKNEANVNECVGSSMYVEITAFGPWETARVLAKSDGKIMIITGSGPHGQGDGTAFAQIV
FT                   ADVLEVTIENIEVRWGDTDIISDGIGTWGSRTLTIGGSAIYKAAEELRRRLIEVSAKML
FT                   NADTEEIEYKNGVLFHKKSGKSVTIKEVIQNAYSMGYSLDVTYVYNVAKPGYTVPYGVH
FT                   MALVKVDKETGSVRVKKYIALDDVGKVVNPLLAEGQIVGGAVQGIGQAIYEGAIYGKEG
FT                   YLLNSNLTDYGFPTAVEVPRIEWHYIEKGFSSHPTNSKGIGEAGAIASTPAVINAIEKC
FT                   TGKRIVNIPPKPEEVI"
FT   gene            609925..610383
FT                   /locus_tag="YN1551_0662"
FT   CDS_pept        609925..610383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0662"
FT                   /product="Protein of unknown function DUF1947"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47791"
FT                   /db_xref="GOA:C3NMH1"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015266"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR022430"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR039757"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMH1"
FT                   /protein_id="ACP47791.1"
FT                   /translation="MQRHIMSSKDAKIFINKIKEKYNIDISNAKLEVGKEKKETWYYVN
FT                   DILAFFDDLIPTLCAIMKLKISLPYVIIDEGAVRAVSKGADLFAPGIVEYGCECKENDI
FT                   ILAKTKTNQPVAVLRVLMSKDKALVEKRGKFAINLHHVGDTIWEMCNG"
FT   gene            610376..611077
FT                   /locus_tag="YN1551_0663"
FT   CDS_pept        610376..611077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0663"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47792"
FT                   /db_xref="GOA:C3NMH2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMH2"
FT                   /protein_id="ACP47792.1"
FT                   /translation="MANFSIVIPTYNERDNIVKLVEEIKKIVPYTSRILIVDDNSPDGT
FT                   ALILQDLNIHNLTVLVRYDERGLGSAIRYGIKKAIELKSDFIVTMDADFSHDPKYLPEM
FT                   MKIALNENYDLVIGSRYVKGGGIENWPFSRRIISRGANYLFKLVSHSPINDNTSNYRIY
FT                   SRKAALLALECDTTNGYEFQICSIFKIIRNNLTFKEYPIIFVDRKTGKSKLDFREILNW
FT                   FLYIVKLSLSS"
FT   gene            complement(611055..611375)
FT                   /locus_tag="YN1551_0664"
FT   CDS_pept        complement(611055..611375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0664"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47793"
FT                   /db_xref="InterPro:IPR017009"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMH3"
FT                   /protein_id="ACP47793.1"
FT                   /translation="MELTPRLQDIVNILKNKGSINVKDLALEIKVSPKTAKGYARELQR
FT                   LGLVDMDQDGNIRLKEHKVEHPDSEKLLKTLENHENEITLLKKEIEAIKGELEKLKKKG
FT                   KA"
FT   gene            611436..612392
FT                   /locus_tag="YN1551_0665"
FT   CDS_pept        611436..612392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0665"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47794"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMH4"
FT                   /protein_id="ACP47794.1"
FT                   /translation="MTLLLKENDVINLLDYKQIYESLLNAFLLFDNKLAINLERSRISF
FT                   HGTTLTFQAAAMENYMGYKTFISSSHLTFLYDTAGNFLSIIESDRLSQVRTAVLSILAT
FT                   DYIYGDFSSLGVIGLGKYGLAIVEIVSQLRKGIKINIFTPSQQRMEKALAIFRSEGIDV
FT                   SPKDSIKKICEESEVITTITKAKDPFLKLEYVNHKRIHINAMGSNIPEKIEIFPEVIKA
FT                   SNLIVVEELEQSLKESGELVIAKKMGMLDMSKITLLSSILSRRINVAREGITIFKSVGI
FT                   GLEDLAVSRLIYEKALSKGLGTEIEVKGVWYRESEKK"
FT   gene            612365..613507
FT                   /locus_tag="YN1551_0666"
FT   CDS_pept        612365..613507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0666"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47795"
FT                   /db_xref="GOA:C3NMH5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMH5"
FT                   /protein_id="ACP47795.1"
FT                   /translation="MVSRIGKEIEISPVELGSQIAKRVKINMASGTPDPSKMPLKEIEE
FT                   AYNEVLNELGSKVLFYPGAGGQDELIREIKDKFLPLLNLNKRKGERIVVTSGAQHAMEL
FT                   LGKYFLENDVIAVENPTFIETFNALKFRSSSVIPISLDSSGINVNELETLLKIVKIKLL
FT                   YVIPNCHNPAGVNMSECKRKTLVELAEKYDFYIIEDDPYRPIAGEIPNPIKNYDNTGRV
FT                   IYVSSFSKIIAPGLRVGFLVAKEDIAEKISLMEQLDFSTSTINQYVVARLLRKGIITER
FT                   SKELYEHYKIKMRALIDSLKDKGLDKFNEPKCGFFLLLDVGRDSWNVFHKAVEKGLSFV
FT                   PAKPFFLRGGDTMVRLSVSVATKEEIIEGVRILNEVIRNS"
FT   gene            complement(613504..613869)
FT                   /locus_tag="YN1551_0667"
FT   CDS_pept        complement(613504..613869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47796"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMH6"
FT                   /protein_id="ACP47796.1"
FT                   /translation="METVNEPKKEFYTYFISTSKFYYDLSSTVNSPIVVCEMLYEAINA
FT                   GIKLLTYYFSLQYKPRNEVVKELSNILGDWVEYYWSLGLTLHYDCYLSGNVDQDDIPFY
FT                   ENQVKDFISKVEEVVFG"
FT   gene            613962..614315
FT                   /locus_tag="YN1551_0668"
FT   CDS_pept        613962..614315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0668"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47797"
FT                   /db_xref="GOA:C3NMH7"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMH7"
FT                   /protein_id="ACP47797.1"
FT                   /translation="MKLIYFSLILTAVSLLVGSIMLLNFVPRIFTVGTLVIVVFLIISL
FT                   FLINKYNFLKYILFILAILAIIISSSSGAHIQAFREFGQSLYITALDILMILGFYVGPI
FT                   LYIIALLRDNLKR"
FT   sig_peptide     613962..614036
FT                   /locus_tag="YN1551_0668"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.672) with cleavage site probability 0.460 at
FT                   residue 25"
FT   gene            614336..614806
FT                   /locus_tag="YN1551_0669"
FT   CDS_pept        614336..614806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0669"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47798"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMH8"
FT                   /protein_id="ACP47798.1"
FT                   /translation="MEIIDPHARVADLVGLLYSLENTFNGKTDLYMLEKEMEVDLDDLM
FT                   PIVYTANSLGFITVGEGDIIITDKGMEFLKSNLKRRKEIIRDSIKKIEPFKTTLELKYF
FT                   TIEELKYILEKKGIQVYNSPEGLYDLQITLVEWGVYSGLLKKEGDKFIVVTT"
FT   gene            614811..615596
FT                   /locus_tag="YN1551_0670"
FT   CDS_pept        614811..615596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0670"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47799"
FT                   /db_xref="GOA:C3NMH9"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMH9"
FT                   /protein_id="ACP47799.1"
FT                   /translation="MLEKYINILNKKSLMKQEKGEELVHYIHEADTFRTKVFGIQDGLI
FT                   GVGAIVLGAAGFSHDAIAVLVAGLIATIGQAFSMGIGEYISTRVRMQVIQNEIRKEKYQ
FT                   LRNFPDMEKQELVEFYIKKGFNKEVSEKIADYLLKNEDVALEEMLMHELKVFPEEFDSP
FT                   IRLGFLMSFYLIIGGLIPILPFAIGAYFRQSEFNFALITSILLVIITLGIFGVLGTKYT
FT                   GLSKHRGALEQIGTGLIALMGSYVAGMVLAHFIPVSYLP"
FT   gene            complement(615593..616519)
FT                   /locus_tag="YN1551_0671"
FT   CDS_pept        complement(615593..616519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47800"
FT                   /db_xref="InterPro:IPR014426"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMI0"
FT                   /protein_id="ACP47800.1"
FT                   /translation="MKITPIAFESLGVRSQATLIETKDLRVLVDPAISLAPRRYNLPPH
FT                   QREVDRLTELAKVLVDVAKDVDVIIVSHYHYDHHDPGYVIPTDIYKNKLVFIKDPQNMI
FT                   NNSQKYRRAPRFLRSIKDKPSKIEIADGKTLELGHTTISFSPAVPHGADERLGYVIQVA
FT                   ISDKDSTVIFTSDIEGAPKDVHLKFTKEKMPKTIIIDGPLSYLLGRVLKEEELEKSIRN
FT                   MEEIVKNGLETVIIDHHVLRDINYAEVLKPVYDIAKDLGVRVTTAAEYLNLEPLILEAR
FT                   RKELFKEDNRPARIPRGLANLLSAGEG"
FT   gene            complement(616547..616798)
FT                   /locus_tag="YN1551_0672"
FT   CDS_pept        complement(616547..616798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0672"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47801"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMI1"
FT                   /protein_id="ACP47801.1"
FT                   /translation="MFKELLGDYEPRGRVIQGVGRFIALGLDDPFHITTISGFTIYGLG
FT                   KYIEKKRTNYGIRMTKMDIENVRKDLREITLDISTIRF"
FT   gene            616897..618078
FT                   /locus_tag="YN1551_0673"
FT   CDS_pept        616897..618078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0673"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47802"
FT                   /db_xref="GOA:C3NMI2"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMI2"
FT                   /protein_id="ACP47802.1"
FT                   /translation="MLEILLITLSGIVSSWTVYNGILSIVGVAWKPFESKNHSGITFSL
FT                   IVPVKNEERVLPRLLDRLVNLEYDKSKYEIIVVEDGSTDRTVQICKEYEAKYNNLVRCY
FT                   SLPRANVPNGKSRALNFALSISKGEIIGIFDGDTVPRLDILEYVEPKFGDSNIGAVQGK
FT                   LIPINVRESITSRLAAIEELIYEYSIAGRAKMGLFVPIEGTCSFIRKSLIMELGGWNEH
FT                   SLTEDLDISLKIVNKGYRIIYSPTTISWREVPASLRVLIRQRLRWYRGHLEVPFGKLRK
FT                   IDLKVIDGMLIVLTPFFMVLNLVNYSLVLVYSSSLYIVAAGLVSLASLLSLILIILIAR
FT                   RHMIEYFYMIPSFVYMNFIVALNFTAIFLELMRAPRVWIKTERSTKVTGEVIG"
FT   gene            618075..618683
FT                   /locus_tag="YN1551_0674"
FT   CDS_pept        618075..618683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0674"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47803"
FT                   /db_xref="GOA:C3NMI3"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMI3"
FT                   /protein_id="ACP47803.1"
FT                   /translation="MITEFLLKKKLEEQLSHVKEENTIYVTDLVKCPRKVKYESEYKEL
FT                   AISQVYAPSAILGDILHLGLENLLKENFTAEAEVETQREIQVEGRVYKIKGKADAIIKN
FT                   SSGESIIIEIKTSRSDKGLPLIHHKMQLQIYLWLFNTKKGILIYITPDRIAEYEINEPL
FT                   DEATIVRLAEDTITLRNSPRFNWECKYCIFSVICPAKLT"
FT   gene            618715..619917
FT                   /locus_tag="YN1551_0675"
FT   CDS_pept        618715..619917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0675"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47804"
FT                   /db_xref="GOA:C3NMI4"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMI4"
FT                   /protein_id="ACP47804.1"
FT                   /translation="MHTRPVVATIAGSDSGGGAGLQADLKTFTALGVFGTTIITGLTAQ
FT                   NTKAVTKVLEIPPDFIEAQFDAVCQDLRPSHAKTGMLASGKIIELVLRKIKEYQIKLVL
FT                   DPVMVAKSGSLLITEDISEQIRKAMREAIISTPNRYEAEIIANTKINSQDDVIKTAREI
FT                   YSKYGNVVVKGFNGVDYAIIDGEEIELKGDYIGTKNTHGSGDVFSASITAYLALGYKLR
FT                   DAVIRAKRFTSLTIKYGLDLGGGYGPVDPFAPVESIVKREEGRNELENLLWFLESNLNI
FT                   TLKLINDTSKVNVAYMTNYNDVLSLAGGLIKYLEKIKIDGPILNNVSNEITKIMRETSS
FT                   EKIGILLPLTDKILDAAEKGKIKLSKSGINGDAILRDNMVLVVGKDKDDLIRKLKEVVL
FT                   G"
FT   gene            619914..620795
FT                   /locus_tag="YN1551_0676"
FT   CDS_pept        619914..620795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0676"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47805"
FT                   /db_xref="GOA:C3NMI5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMI5"
FT                   /protein_id="ACP47805.1"
FT                   /translation="MIAVVGSYNVDVILRVSKIPEIGETVIADEVYITHGGKGSNQAVS
FT                   ASRLGSHVKIIAAVGDDKHGTNAIEFWKSENIDVSKVKIKNGINTGTAYIFVDKKGRNI
FT                   IVVNRGANYNLSEDDLNNSLEGDILLIQLEIRENVVKKAAKEFNGIKILNPAPANLKDT
FT                   EILSLVDIITPNEIEFKELVNTDDFEYGLNVLLKKVKKAVIVTLGERGALLATRDGKKV
FT                   LIPSPKVNVIDETGAGDVFNAALSVYLEKGFDLETAVEYANKVAALSVTKIGALGPKLD
FT                   EVRKFLEEIDNE"
FT   gene            620886..621572
FT                   /locus_tag="YN1551_0677"
FT   CDS_pept        620886..621572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0677"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47806"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMI6"
FT                   /protein_id="ACP47806.1"
FT                   /translation="MKITFIGTGAGSSLGLKRVKSSILINDKVLLDLGPGAELRLEDMS
FT                   THPKALFITHLHVDHFNGVFDYLVQRKIRQIPDLEIYSTKGFLEVLNSYIRVGNNISAK
FT                   VYESDLPRGKIDDMEIYSIQACHSIYAVSYIISDGNTKVLYTGDTKEPCNTILENVKDV
FT                   DLIIHETTCMNDCSAWGHTSIKQIFELFSNKRIIATHIPVEIEEKIISFANNKIIIASD
FT                   GLSLNV"
FT   gene            621565..622287
FT                   /locus_tag="YN1551_0678"
FT   CDS_pept        621565..622287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47807"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMI7"
FT                   /protein_id="ACP47807.1"
FT                   /translation="MCRILAFHTKAEISKKYVNALIKASRNDIFSKYGSHPDGWGLSVF
FT                   LKKNDKWKVIYYRSEDPIFEDPNFNYLIDIAKGEEIIGIIHARKAGRKFLTGVSHAHPY
FT                   YVRANIYDLYFAHNGSVSRTSFKDNNRPFTDSYLILEEIKTLIENNMSPFEAYVNTLDK
FT                   LKDYSTSLNSGLIYYNKKEGPSLLIGYYYNKNRLSKETNEEYYKLYTDNERYVFSSTIK
FT                   YYLGVDAEELMMGSIMHL"
FT   gene            622329..623177
FT                   /locus_tag="YN1551_0679"
FT   CDS_pept        622329..623177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0679"
FT                   /product="transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47808"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMI8"
FT                   /protein_id="ACP47808.1"
FT                   /translation="MKESLIEAKVIDYGKLKDIQKEIVYYKLYVDALRKKGIKEKVDPP
FT                   PTLPKSIVTSILTGGIPRDGPLQIEVVDDDMIKIKEYNTLVKIKSDSRPPLYAIVEYTD
FT                   TDVRVYLAYQENPSIVGVDLGLRHLITIVALKDNKPWKVRFFNEPKLMEQFANFLSENQ
FT                   GIIKLEEMKTNARKILYEAVSFIEELEPKIVAMENLEYFETKTGKGLRALQNMLENEIR
FT                   KRGIRYRKIDPYNTSRVCAKCGYKKGEILGSLFVCPACGYKADRDYNAAYNIALKCYYT
FT                   C"
FT   gene            complement(623180..624163)
FT                   /locus_tag="YN1551_0680"
FT   CDS_pept        complement(623180..624163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0680"
FT                   /product="histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47809"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMI9"
FT                   /protein_id="ACP47809.1"
FT                   /translation="MITIVYDDIYRYHAPKKYHVENPSRIDKALSAINQLEVKFEKPVR
FT                   VDDPQIVHSEDYIKLVEKHSKLEENLDADTYTNKYTYESALYAMGGALKAFETNGFALV
FT                   RPPGHHAGVNGRALGAPTLGFCIFNSVAYPIKRYKLKRVAIIDFDVHYGNGTQEIFYDD
FT                   PDILHIDVHQDPRTIYPGTGFVDMIGGKDAEGTKINLLIPPLGSDDLYEELIPIIQAIL
FT                   DDFKPVVVAYSAGFDSYVGDGLASVNATEYTFYNFGMISNKFTRKYAVLEGGYNKGLVK
FT                   GLKAFLEGFANLKIEYKKYKSSDTVKSRFMNYLSEEKNILRNYWSI"
FT   gene            624205..625260
FT                   /locus_tag="YN1551_0681"
FT   CDS_pept        624205..625260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0681"
FT                   /product="peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47810"
FT                   /db_xref="GOA:C3NMJ0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMJ0"
FT                   /protein_id="ACP47810.1"
FT                   /translation="MDRIQRLQKELEKTDTDYLIIGTTSNMFYLVGFSEEQMERPLLLF
FT                   VTKDDYFMLVPKLYEQQLKQLPLIVYRDGEDPYSKLNLKESSNILIDDTTFSLFTIEIL
FT                   NRFRPRRIGKASAILRKLRQVKDDEEIEKMEKGVKKAEELLLEFVPNIKENITECEIER
FT                   KLKSFLIGEAGYISFDPIVTSGPNSSMPHLRCSDKKIKRGEVIVIDYGIKYEGYSTDTT
FT                   RVFTLGRPNDTLALEIVEIVKSANEEAEKHVREGIRAKEIDDIARKVITDKGYGVYFIH
FT                   RTGHGIGIDVHEDPYISPDNDDVIEQNMVFTIEPGIYLPSKFGIRIEDEVVVKKGYGKV
FT                   LNTLQKELYIL"
FT   gene            625330..628308
FT                   /locus_tag="YN1551_0682"
FT   CDS_pept        625330..628308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47811"
FT                   /db_xref="GOA:C3NMJ1"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMJ1"
FT                   /protein_id="ACP47811.1"
FT                   /translation="MILRTKEGKHLKAFRYIFLKVILMRRSLIILFFVILSPLTYLALP
FT                   ISSQSTPIQGYATSNELITPGEIEVPITFHLINLGQTLTDVTIIPADTYPFYLYPYNNG
FT                   TELTHIPLWNQGQTVNVTYLFDIASAAKTGTYTDVVIVQGVTTSGTQATYDVLVPVVIA
FT                   GYVNFSASSVWGTTSNPMVVGPGENNIPLTIILQNLGNSLVTNITLELNSQFPVKFLQN
FT                   NATISAIPAGYYGEATVMASVYPNVTQGLYYIRLNIIYYHNATTTVLVPIDIGSSNQVS
FT                   LEDAWGTPSDPIVAAPGETLLPLTIYVKNLGENLLSNVMLILQSHYPIQFLQNYTMIGF
FT                   VPAGGYNYVTVVANVYKNVTPGVYYVPITLVAYDGGFMQTFEMPVYILGYVNFSASSVW
FT                   GTTSNPMVVGPGENNIPLTIILQNTGIVSITNATLFLQSQYPVEFLQNNVTIGNIPVGY
FT                   PIPVTVLANVYPNVTNTGVYYITAKVMYYDGVIQYVKVPIYIQSLNQVSVEGVWGSLSN
FT                   PILVAPGENNVPLTIVIKNLGENLMTNVSLILQSHYPIQFLQQNASVGFVPAGSYNYVT
FT                   VTANVFPNATPGVYYIPATLVAYGGFKENIMITVDILGYITIQAQSLWGGVTSPITVSS
FT                   GENDVPLTILLKNTGDVNILNATLVFQNVEYPLIFHQTNAQIGIVPAGQENYATVTISV
FT                   FPNATPGVYYIPATLYYFNHKTTITIPITIYSPNISVNLITIPPQVFPSYYDVRLLVIL
FT                   TNFGGGIAENANVSIRSPFQVISSNPLHLGALPVGVPVNATFLINVPNDTIPKTYIINV
FT                   TITYDGGKETYQYPLQIYPKANLIIAGVSYPSLSAGDSNVPITITLKNNGNSTAKNVIV
FT                   RLGTSNLIYPHVSSSNPLQALTASEVFAGDIAPGQTINVTFVVDVSSGASSGTYPLAIA
FT                   LIWNQTGSLFPFEQSDTFYVTISPPFYEQFFKSPAGIIAVIVIIIISIVIVTVLLRVRN
FT                   KRK"
FT   sig_peptide     625399..625461
FT                   /locus_tag="YN1551_0682"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.558 at
FT                   residue 21"
FT   gene            628324..628491
FT                   /locus_tag="YN1551_0683"
FT   CDS_pept        628324..628491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0683"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47812"
FT                   /db_xref="GOA:C3NMJ2"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMJ2"
FT                   /protein_id="ACP47812.1"
FT                   /translation="MIRAFILLTLFFRPIYSELALLFSLLFILLILLLSSLSVLIKILR
FT                   LMKKGTKLKI"
FT   sig_peptide     628324..628440
FT                   /locus_tag="YN1551_0683"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.549 at
FT                   residue 39"
FT   gene            628794..629411
FT                   /locus_tag="YN1551_0684"
FT   CDS_pept        628794..629411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0684"
FT                   /product="protein of unknown function UPF0126"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47813"
FT                   /db_xref="GOA:C3NMJ3"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMJ3"
FT                   /protein_id="ACP47813.1"
FT                   /translation="MYMTLELLNVVGIIAFTISGSLKGTNKGLDIFGVTILGVVTSYAG
FT                   GILADILLGIYPPDILKEWNYLLLSVCISIFVFYFYKWLQTNPIKMVIIISDAIGLSTF
FT                   ATLGASLAYSYGLNPISVGLIAAIVGTGGGVIRDLLVNETPMILTKEIYATAALLGGVI
FT                   YYFTTPYLHHGSLFASFLSTFLLRVLAIKYNFNLPKRKSNKS"
FT   gene            complement(629419..629598)
FT                   /locus_tag="YN1551_0685"
FT   CDS_pept        complement(629419..629598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0685"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47814"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMJ4"
FT                   /protein_id="ACP47814.1"
FT                   /translation="MEDVKQSVEKIIKDREWVTFNDLLKYIPYPAPEVYDALSQLIKEN
FT                   KVGRRGRYFYYIKR"
FT   gene            629701..630321
FT                   /locus_tag="YN1551_0686"
FT   CDS_pept        629701..630321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0686"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47815"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMJ5"
FT                   /protein_id="ACP47815.1"
FT                   /translation="MLLYFKPVKKERDINVALEIVSELFASKVGKLLGLPIPEVFLIEY
FT                   GEETGLLMDYLPDKASKENISNLDEIKMSLAFEEWILNIDLKEDHVLSKNGKGFIIDHG
FT                   HSLSAWKPLYYIIQIIDKKVSRFNLWANEDDFKNGIELLSSIDYNMILNTLKESFSEVV
FT                   ESNFCKLLTKQVIDEYTELNLKILEKRMEYLKGGKILLTYEYR"
FT   gene            complement(630298..630681)
FT                   /locus_tag="YN1551_0687"
FT   CDS_pept        complement(630298..630681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0687"
FT                   /product="protein of unknown function DUF1634"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47816"
FT                   /db_xref="GOA:C3NMJ6"
FT                   /db_xref="InterPro:IPR012861"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMJ6"
FT                   /protein_id="ACP47816.1"
FT                   /translation="MDFNSIIGNALRIGVIISAIIIIFGVALLFLNNGSNGFTITQISN
FT                   SNSIINSSIFKPSEIFTGLPKLYGLDYIYLGLMVLIATPVLRVLLGIAQFASERNKLYT
FT                   IITIIVFFNLMFSIFILPILISK"
FT   gene            complement(630671..631531)
FT                   /locus_tag="YN1551_0688"
FT   CDS_pept        complement(630671..631531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0688"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47817"
FT                   /db_xref="GOA:C3NMJ7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMJ7"
FT                   /protein_id="ACP47817.1"
FT                   /translation="MLSPIEFFVIVVLISALSGILGALTGLGGATFLVPIYTLYLNVPI
FT                   AYASGASLISTIATSSGAASAYIKDRITNVKIGMGLEIATTTGSIAGALTVAYIYAHHL
FT                   EFIVYIVFGIVLLSQVYVQLDKSKFELPKPIKPDWTTRVFELYGKYYDTVLKREVEYHG
FT                   VRWWLGEIIMFFAGFISGLLGIGSGALKVLGMDWAMNLPMKVSTTTSNFMIGVTAATGS
FT                   SIYWIFGYIQPFLAAGTALGVLIGAFIGTKILVRVTNKTIRYIFTVILIFLGIQMILRG
FT                   LGYGL"
FT   sig_peptide     complement(631460..631531)
FT                   /locus_tag="YN1551_0688"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.668) with cleavage site probability 0.330 at
FT                   residue 24"
FT   gene            complement(631569..632963)
FT                   /locus_tag="YN1551_0689"
FT   CDS_pept        complement(631569..632963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0689"
FT                   /product="exsB protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47818"
FT                   /db_xref="GOA:C3NMJ8"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMJ8"
FT                   /protein_id="ACP47818.1"
FT                   /translation="MCSVSGVLILNPKNFDKVERKLADILKRAEDRGRDSFGIVVIQKD
FT                   GTVKVRKSVGKPSEKEELLYGILDEDSRVVIANNRAEPTTEYVRQKTEEDIQPFIGDRY
FT                   IVTHNGIIANDLELEKKYELKRKTKIDSAILPSLLDKTWDGNIGTLKGILEQIRGSFAL
FT                   VIGDKRNHDRIFLAQNFKPLYMAYDYSLESIFFTSLDEYFDVKPFDLVNVTKLEPYSVV
FT                   MVSSNKQITTLPIIEKRKKHKVLVVASGGLDSTVAATKLLREGHEVTLIHFNYHHKAEE
FT                   REREAVRKIAEHLQVPLIEINTDLFKMIGHATLIKGGGEIVKDRKGEEGAEFAHEWVPA
FT                   RNLIFFSAALAIAEAYGYDAIASGINLEEAGAYPDNEMEFIRMLSKLSPYATGPNKKVE
FT                   VLMPVGNLVKHEIVKLGYEIGAPLHLTWSCYEGGQKHCGKCGPCYMRRVAFKINGLRDP
FT                   VEYAEE"
FT   gene            complement(632983..633204)
FT                   /locus_tag="YN1551_0690"
FT   CDS_pept        complement(632983..633204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47819"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMJ9"
FT                   /protein_id="ACP47819.1"
FT                   /translation="MVDVLNTKKDVEVFLSKQREKCKLGDVITVVITENTLEDIPFIAS
FT                   KYGFSMIDGENLEGDLIMIKLELRQIFR"
FT   gene            633238..635463
FT                   /locus_tag="YN1551_0691"
FT   CDS_pept        633238..635463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0691"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47820"
FT                   /db_xref="GOA:C3NMK0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMK0"
FT                   /protein_id="ACP47820.1"
FT                   /translation="MEILSEINDKLKTFNARIAHVHTETFLEPELGPSINEMDIDNKLK
FT                   KTITEYGIERLYKYQYEAYRKIKNKENVMIVSGTGTGKTEAFLIPILDLALRGERSVLI
FT                   YPTKALARDQLTRVYKLAGELGLNIGIFDGDTPEKERERLYKNPPHILITNPDMIHLGL
FT                   ALSNRFRFLLRTADHFIFDEVHVYEGVLGAHIRNLADRIKEFKNDIHIVASSATIGATK
FT                   YLFGELFGVEGEIIEGTRRRKGIALHGLIDSGNSSRWTLAAYLAAVLVKKGFKVLVFTD
FT                   SQQMTELVAKIADRFRVNLEVHRAGLNAEERIKVEEKLRNGELDGVVATPTLELGIDIG
FT                   SIDAVIMAENPPSYTKYIQRAGRAGRRNNAGLIFTILGDDPIDSYYLRHPEEFFNRKIQ
FT                   PLTFDPTNMEVIKIHALAYLAEKYRIRLDNLPPLWKKAYEMLNIEGKAKIIGSNVLAVS
FT                   ETKKYLASTSLRSVGPIVRIYEDKKKIGERELPAALHDLYPNAVYLISKKTYIIEELDI
FT                   GRLIAKARKVNNELSYYTKPLYSMDLLEFNKKDEREVYGEKVEYGEMKLLMRVEGYVTY
FT                   DVYLKGKGGRNEYFYENPISFTYNTKGLLIYHPLIDDFTLIDHMEAYHATEHVLISAAR
FT                   VAAGASLTDLGGISYPSGHVVIYDSSIGGSGIAKLLFERLDQAYEVALDIVKNCNCEDG
FT                   CPNCVYSPYCGNNNKYLSRKKSLRLIDGLIRGSIRRGSKDREGSPIA"
FT   gene            635456..637315
FT                   /locus_tag="YN1551_0692"
FT   CDS_pept        635456..637315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0692"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47821"
FT                   /db_xref="GOA:C3NMK1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMK1"
FT                   /protein_id="ACP47821.1"
FT                   /translation="MHNKFYRILKPTKIGNVEVKNVIKYSEGSSMLPNAVPRYEYFRGS
FT                   EGENVVDFIDYRGIDDLGEKLKIKAGTKWREVLEKYKVEFWSNMDFTVGGSVYFNDPII
FT                   GFNEFGKINGRVEVDAYLDGKYYSGRYKGGIVINVYLKKEDKEIIYKRLDGELSELIPI
FT                   IKSWYASRIPVFREVSLVKKGMESYILISYPKIREVLLQKLLNGFYDEISPVVEQLEYE
FT                   YWYLGYSSLSDLENIINLMKESQLSVIRFRKDEIAFSIYSNRLLESIGNTLEYSTTEGE
FT                   GLFNGCILCGKCVSVCPYGEQTNDVFHTPLGFYSISYFEKENDLANCHMCGLCEQVCPV
FT                   RLDITKELRKVTKINQIPPKNLLRSIKSDLNSVLIITSLSEELEDQIIKSLIYLLKKGK
FT                   RLGIFYLAEDFSKIVKDESSLEELLKFKEIYTITPEEYFYLQRLKKKTVVDIYNLQLLA
FT                   MNDLKINKDNLHIPCLLRSELNESNFTCSSVFLNILNNKDNINRTIEKKITLCPLTARE
FT                   LNIKTPIDLLEINLDQNYINNFFKKLEIATKDLREDIEEDLGWYKDIDDRIVDEVYSTL
FT                   IDGIIKGENIENLVLLYFKLNSMNLTENIKVILMDKLTKIIFS"
FT   gene            complement(637302..637838)
FT                   /locus_tag="YN1551_0693"
FT   CDS_pept        complement(637302..637838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0693"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47822"
FT                   /db_xref="GOA:C3NMK2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMK2"
FT                   /protein_id="ACP47822.1"
FT                   /translation="MSSHKQHRQHAPTNINFYVITISTSRYEKMMKKEPVIDESGDIIK
FT                   QLIIQSNYNVVGYDLVPDEKVKILKAFANALDNSQTDVIISTGGTGYTQSDVTVETIRR
FT                   IFDREIEGFSDVFRLVSYNDPEVRSASYLTKATAGIVNGKVIFLLPGSPDAVRLAIREL
FT                   ILPEVGHLLYIVRRK"
FT   gene            complement(637853..638668)
FT                   /locus_tag="YN1551_0694"
FT   CDS_pept        complement(637853..638668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0694"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47823"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMK3"
FT                   /protein_id="ACP47823.1"
FT                   /translation="MNKVVEGYFLKYKNVIWSVKGCYHPDGYAVALPRLVDGIKIKRLN
FT                   DALEIVRSKFSNLLKYIDEIGFSVPLVPLNESEILDPFNFKVFDNKLREFLSFFDREVG
FT                   ITGSYLYLGKGNDMDLLSFKPEHYHMLEELRKKGITRPLLTVEDSEIETLDYSSFKLLK
FT                   SKRVLEGTFEGQGYTFKIVQCEEFGQVKEIKEFDGHIRIAKLIKPFTIPVKYLAIDDSG
FT                   NEYILTSFRIRFTELSPNTIMYIKGKILVREKFNDLDLDIAEVVKLKSS"
FT   gene            638689..639720
FT                   /locus_tag="YN1551_0695"
FT   CDS_pept        638689..639720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0695"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47824"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMK4"
FT                   /protein_id="ACP47824.1"
FT                   /translation="MAYQHYDLKITIVGGGIVGSSIYRMLKKNGIEVRLIDPKVKRPFP
FT                   SLIHSLLLKEKDIELAKLSLNFYKKFNIPYYPYKSYTLGKISPSIVDSWISAGVNINIK
FT                   YVNWIDDETIEAIGGDGLVSIGSLIRYTEKIVYHSNIFINKGKGFIKINDKLYESDLII
FT                   LSAGAWSKYLVNVKLPVKTYYCWASLFLSRKKEVGSNIIYDYVNNFYSRPVIGLGLPFA
FT                   IMGDGKVIEATPFQQNICIEDKNEVSSRISRRLGEVKELYTSGNFCEATPDMRPAYGKI
FT                   AENVYYIGGFNGYGAEVGPGLANILVEEILSKKEDTYFKEYKLERFNEYNDDFEIGQEP
FT                   HEL"
FT   gene            complement(639708..640148)
FT                   /locus_tag="YN1551_0696"
FT   CDS_pept        complement(639708..640148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0696"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47825"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMK5"
FT                   /protein_id="ACP47825.1"
FT                   /translation="MISWLVGSQAPPWSYLEDLFQDYRNVAVYVDNKNIVQTVKVSDID
FT                   EFYTPFSVLIHAKYFKYYSTYYIKLEKMVAFQTMSEKVANHLIAKKGWRGIKYYYGDEF
FT                   LGAWILYDCTRCREKQRAHLEISKFAVSEDEIIEAHLKIYNS"
FT   gene            640253..640870
FT                   /locus_tag="YN1551_0697"
FT   CDS_pept        640253..640870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0697"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47826"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMK6"
FT                   /protein_id="ACP47826.1"
FT                   /translation="MRSKLMFINDIEKLAKRVEESYGGVELDDIIQRLINFYELGFTNI
FT                   NHSSIQLILSAYFKSLGYRVFVEYERKGRLLDLYVSDEDMGIEVEYGYIPNSNAIDAEE
FT                   YLKSRISLKILRYSTLSSKFYIAVPSFYIPPIPDELIVDIKDKTKLRRILELIGKFHKT
FT                   NDIMLNDAKLAKINGIISVDVSNLSISIIDISKYKQLKDFYK"
FT   gene            complement(640850..641497)
FT                   /locus_tag="YN1551_0698"
FT   CDS_pept        complement(640850..641497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47827"
FT                   /db_xref="GOA:C3NMK7"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMK7"
FT                   /protein_id="ACP47827.1"
FT                   /translation="MLFTINDVTWGIVLSLWVVIVVLYISKLISQIFGAYVSRKAIHML
FT                   GGGIVAVLSPYVFNSPLVPIVTSYLLMVYLIAIRVLRKEMRWFMDRENLGEVFFAFSFG
FT                   TILLLMFLLDHNYWTNASLIYVAILPLIFMSFGDGITGIIRNFVYKRRVKGFWGSLGML
FT                   IFCTVVGYYLLNIPGLIAGIIATIAEVLPYIDDNISVPFLSFLVLYLFIKVF"
FT   gene            641551..642168
FT                   /locus_tag="YN1551_0699"
FT   CDS_pept        641551..642168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0699"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47828"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMK8"
FT                   /protein_id="ACP47828.1"
FT                   /translation="MQLYRYSFKDGYLVPDENGDVTVFVEGNLISIVDKNGNKIEGVRF
FT                   KYLGNESVSLKKLRYLAKFVNIEVNEDVLMVYPTLRQRTLAINKLMGEVFEVFIHNLLI
FT                   SKNYRVKRQNEIYPSLHNFTLTRWHNRPDFIIEDKVVIEAKIRKNDYLQTLEYSKYFKY
FT                   GMVVFPFTGECRVPKGWICVFHTIKDQSRFYSLLENLLSRVK"
FT   gene            642176..643369
FT                   /locus_tag="YN1551_0700"
FT   CDS_pept        642176..643369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0700"
FT                   /product="Phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47829"
FT                   /db_xref="GOA:C3NMK9"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMK9"
FT                   /protein_id="ACP47829.1"
FT                   /translation="MEIGTPLFEGSKKILLLGSGELGKEMAIEAQRMGLEVITVDRYDL
FT                   APAMHVAHRKYVIDMMNPNAVKAVVKRENPDAIIAEIEAINTDALVDLESNGFRVIPNA
FT                   NAVKACMNRIELRRFATEKLALPTTKYAFAENEEEAKHACKDIGFPCLIKPEMSSSGHG
FT                   HVLVNKIDDVEEAYRESVSHARGKGRRVIVEEFVKIDTELTVLTYRYYSNSGSIITKTI
FT                   EPIEHKRPSYYYVESWHPSTVSREVKETARGIAQKVVEELGGLGIYGVEIIVSGNRILF
FT                   SEVAPRPHDTGLVTLASSDINEFQIHVRSAIGLPIPEVKLVSPAASHVILAQTENVWGP
FT                   KFINVEKAMEIPGVQVRLFGKPVTYEKRRMGIVLATGNSVEEAIEKVRKASSIILVK"
FT   gene            complement(643358..644413)
FT                   /locus_tag="YN1551_0701"
FT   CDS_pept        complement(643358..644413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0701"
FT                   /product="histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47830"
FT                   /db_xref="GOA:C3NML0"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C3NML0"
FT                   /protein_id="ACP47830.1"
FT                   /translation="MHKTAFIWTDEYYNYSFPDYHPFKSLRESMTKRLLEERSAFHFIT
FT                   LIEPKPISEEVLQLVHSKEYIEFVKYKSKEGQGYLDDGDTPAFKGIYEAALIRISGSVK
FT                   ALELIKGGEFNHAINIGGGFHHAKRNRAAGFCVFNDVALIAKLGENSFSKIAIVDIDGH
FT                   HADGTQELLIDDDKVLKISLHMFHPNFFPGSGDVNEIGVGKGEGYTINIPLPPGTGDDG
FT                   YLLAFDEIVIPVIERYKPELIILITGGDSYFNDPLVELKLSTHGYLDVVTKVHHLAHKY
FT                   SSGRLIMLGGGGYNYDATARIWTISIAEIAGIYDLEYETLHDPFSTKSSQFVMEKIRST
FT                   IDRIKKIHSFN"
FT   gene            644461..645603
FT                   /locus_tag="YN1551_0702"
FT   CDS_pept        644461..645603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0702"
FT                   /product="CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47831"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR014651"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:C3NML1"
FT                   /protein_id="ACP47831.1"
FT                   /translation="MIDSTLITKPQYIAHSMDKLSDIISKMKENKMWTVPVIKDRKLLG
FT                   LISYKDLLSRRVSLETKAINVMNPSVTVQIDEDINRLIAKFYTTKARVIPVVNEKKEFI
FT                   GFVTRESLLSYLLKADEIPENKTAREYMTSPATTIDENDSIARARWVMIRDNISRLPAT
FT                   KEYRLTGIISARDIVDALYSVSGRKRESIMKDEERVMAMPVKEIMKYPVITANGKEPLP
FT                   DVVEKLLKFRISGMPVMEGDRLSGVISGLDIIKAVAEKMQLSIPIEAKIPQELKSNLDF
FT                   KANIDDILERYLSKIERLTEVINFKVSFKEEMRSSVGNKKLYTAMVRVTTKIGDYVAKD
FT                   TDWEPIVALKNAVEKIEERILRKLRKIEESNKKGIKAEEA"
FT   gene            645600..646316
FT                   /locus_tag="YN1551_0703"
FT   CDS_pept        645600..646316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0703"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47832"
FT                   /db_xref="GOA:C3NML2"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C3NML2"
FT                   /protein_id="ACP47832.1"
FT                   /translation="MKIGVIQPLEVKSAILLVEKALKEGAELVLLPEKWTKNIDDVPLV
FT                   EFQKLAKRYTAYILPGAFEDGVSVITPIIDDSGNLKGIAKKIHLFNEEKLRLIPGNEAV
FT                   LFTYRGIRFGILICYDIDFPEVARELFSKGVEIILVPSKVRGNGLDIWNEFLRIRVLEN
FT                   RIGIVNANVYNPPDFPGRSVAIVPEQRQDGIVIPKVVGVLGSEEGYMIVDIDPLKYMYL
FT                   RGDRLKEYVKFTVKEL"
FT   gene            complement(646311..647111)
FT                   /locus_tag="YN1551_0704"
FT   CDS_pept        complement(646311..647111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0704"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47833"
FT                   /db_xref="UniProtKB/TrEMBL:C3NML3"
FT                   /protein_id="ACP47833.1"
FT                   /translation="MDSLKLLSKYSNLIKILELTKEYANKLDLVFAIHAYFENDIISNV
FT                   ARSLESKVKNIYEEYKFDRTLFVKNAAKTLGIKEDDFIYYPYYAIPISQETKVKFVDNS
FT                   TIPPKALITKGVMRFTFMVYRSFQELDYRIASREEEDIVIEFENGKIKSHNRKRNIFTD
FT                   ANVVSKILSSNKEVLLNLALPGSYYLIPSLISMNVLPYENEVLITREEESLDFRILNGK
FT                   ASNDKVVMGETLHPRFKLELYYDYKSKRILKEDMARGLAYKIPS"
FT   gene            complement(647247..647744)
FT                   /locus_tag="YN1551_0705"
FT   CDS_pept        complement(647247..647744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0705"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47834"
FT                   /db_xref="UniProtKB/TrEMBL:C3NML4"
FT                   /protein_id="ACP47834.1"
FT                   /translation="MFEKLYSAIIYSDEFKKILLGKGVDDLEVVSAYIAFLYEDLPIIG
FT                   KNLCAGFLRMGLDAIYNITPSGKVYSSKHKLYPISRYGINGVCIDCNGGKIILRIRNSG
FT                   YDPEDLIESKSLESRVFVSENFREKSMRIMEKTFDVDKMRLNAKKEILERISAGGILHK
FT                   IR"
FT   gene            647858..648520
FT                   /locus_tag="YN1551_0706"
FT   CDS_pept        647858..648520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0706"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47835"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NML5"
FT                   /protein_id="ACP47835.1"
FT                   /translation="MIVTVINQKGGVGKTTTSVNLSYYLSKEKKTGLLDLDPEGGATIS
FT                   YGMKRELKELPLGEKSVNIFNVEVFPAHIGLLKLELNGDVEEISNKIKEIGKQFDFLVI
FT                   DTPPNLGTLAISAMLVADRIVSPVTPQPLALEAIKNLDSRLKSIGKNAYSFTNFSKKVV
FT                   KLDNLSSVKFTEIIIPPSRLFIEASRLGVPALRYEEVRLRKPKLVIYYQKLAKVISE"
FT   gene            648517..648846
FT                   /locus_tag="YN1551_0707"
FT   CDS_pept        648517..648846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0707"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47836"
FT                   /db_xref="UniProtKB/TrEMBL:C3NML6"
FT                   /protein_id="ACP47836.1"
FT                   /translation="MSELDFLLKKKKKSEDAEKSVNINESVKKEESLHEEEKIKNEMLK
FT                   FIERDPKIGVWSYPAFLVLQYLYHTVPGFKMSRTAKEALEKGLKEMYPILFDVAEKIAK
FT                   EKFKE"
FT   gene            648929..649378
FT                   /locus_tag="YN1551_0708"
FT   CDS_pept        648929..649378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0708"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47837"
FT                   /db_xref="UniProtKB/TrEMBL:C3NML7"
FT                   /protein_id="ACP47837.1"
FT                   /translation="MDICLKARNDEEVSRALKLNYNCIVYTKPLNNVLTFIPDQYISDI
FT                   DIFSENTIIITNDVQLINKLKNRNMKIAYRVDKPSMNILEYNYFVIEFIPKNIRDLRFY
FT                   KGKIYIDNIDNLDTYSKLENLKITGIFTNNLDFIVDVKKLSLYRK"
FT   gene            649641..649876
FT                   /pseudo
FT                   /locus_tag="YN1551_0709"
FT   gene            649984..650449
FT                   /pseudo
FT                   /locus_tag="YN1551_0710"
FT   gene            650617..650817
FT                   /locus_tag="YN1551_0711"
FT   CDS_pept        650617..650817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0711"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47838"
FT                   /db_xref="UniProtKB/TrEMBL:C3NML8"
FT                   /protein_id="ACP47838.1"
FT                   /translation="MKLVVIKQKLEYLEYMKNFRSTEFKLLLRDEKSIITGISNMVISA
FT                   YKILNDNIVNYVIEKGKFYSN"
FT   gene            650873..652585
FT                   /locus_tag="YN1551_0712"
FT   CDS_pept        650873..652585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0712"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47839"
FT                   /db_xref="GOA:C3NML9"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:C3NML9"
FT                   /protein_id="ACP47839.1"
FT                   /translation="MKKGISSILGAIIIIQIVVLSAGLILYLTSLNAKMSSIAYSQIHK
FT                   ELQNTPISVVPTYQGPMIFSSSASHLTITYIIYPNGQVVHTNIPITQNGVYINFAGYPW
FT                   SIVVLNDGNWYNISANDRLIDPNITALGEIRIYEPYSYTINQGKINLSYLITPPLYGKN
FT                   LDPANWNLLSESPASYTPYGIQNSIIFTPENSSIPIVANLTSGFQYFDIAIPYANQVFV
FT                   GVLQGATPGIYYTKNSPQFSYYLPLEFGISYQVDYLVPLYNATFKYSTWVDGATYYVTL
FT                   SYVTYNMIYFMKENNYIIKSYQGEIQLLGYKFLGYLIASKIDYGSAEFGLWSPLIGTSI
FT                   SDVPIPGYNNYTLYSGVMINASYTVFNESGVIPPSASIIPLQGGNEYLNSSNITEESLV
FT                   SVEMMISGGNLDYNSSGTPIPNVMNYTYFWYFFNPQINPNNVNLIISITPNSQISVALR
FT                   DYGEFIYPNFGYVAYSLAEKYSVTHNYVGLNGGPPLTVVKDYVAGTLINSSNEGYLPLG
FT                   YPVVSANYEYMVIPQNYNQYTETAIYQYFRAINSQIEYDLPFIIMIPENVYYP"
FT   sig_peptide     650873..650938
FT                   /locus_tag="YN1551_0712"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.290 at
FT                   residue 22"
FT   gene            652635..653081
FT                   /locus_tag="YN1551_0713"
FT   CDS_pept        652635..653081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0713"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47840"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMM0"
FT                   /protein_id="ACP47840.1"
FT                   /translation="MISKFGFQRLKRGALKYLVLECLNEKPMRTYEIIKSIEKKFEGSY
FT                   RPSTGSIYPVLKGLVEKDLVEVKVENGKKIYIITDKGKKELEEIKNKSLKLLGDNAKFS
FT                   RQILQELLQIAFYLYNNRSKIDENNIQKIIQHLRNCRNELRDIL"
FT   gene            complement(653064..653660)
FT                   /locus_tag="YN1551_0714"
FT   CDS_pept        complement(653064..653660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0714"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47841"
FT                   /db_xref="GOA:C3NMM1"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMM1"
FT                   /protein_id="ACP47841.1"
FT                   /translation="MPRYYLFSMQDESEREYVLKRLKEAADIFVSNERAYLLVPEIRTN
FT                   IGYAVSNAANVNDVAAIPGRLTVAFKKVIYCMLPAFGASDHVARIILTIMKYDKNLRSA
FT                   INLKYYTEVIEKLPSQDICIFNRSSEPKEVKYREHSTMNFMVESCFRKLSKVPTYIVDL
FT                   GDFGKEPSLFILDKDPVIVVNKSLELVKYISQDIP"
FT   gene            654216..655985
FT                   /locus_tag="YN1551_0715"
FT   CDS_pept        654216..655985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0715"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47842"
FT                   /db_xref="GOA:C3NMM2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMM2"
FT                   /protein_id="ACP47842.1"
FT                   /translation="MGLKDVIVDLFQLDKDWTTRIVMGMLVLGIIWGLLGVIDSLMVRL
FT                   VEASWGLSAVLPLTPQEYFAGITLHAERDLFGFAQQIIYAIFIYFTIKLLNIEPRAKWM
FT                   LNLGFIAVNLSMMFMEGPILIVPAAGFDNYFSATIWYYISPLGIPGYSQYVVSPLFFWG
FT                   WILLDAFTYIGGFWIVYHYYLASKNMKEKLPVPLVYFLMVTLMFMIGYSGVTAADVWDV
FT                   LAFYHIVGLDPIANQIAFWIFGHAVVYMAWVPAVGALYLLIPMLANKPLYSDRMGRISA
FT                   LLYLIFSNNVPIHHLYMVNLPITLKFLQEVLTYSVVIPSMMTFFNLWATAKGTNVNWNI
FT                   ITAWTVTSFAGAIAAGVTGISNATISFDAIVHNTDWIVGHFHAMILFSIVPAAWAVLYI
FT                   MITMISGRMWFSKVMAWVHYIGYMIGTTLLIVGFELVGFYGIVRRAEVYPRVPGLIDAE
FT                   VITTVGAIIADLATLVWFLNLVLTLVKGRLVRLEGLSLPQIAGAVAMSLEWPSSVPFTP
FT                   ILQFIKAHNASKKGLGSMIALAVVGAILIIISAFILAFAGDAYTTQTWIWITILTIGIV
FT                   FSAIGSLKGMKSI"
FT   gene            655996..657054
FT                   /locus_tag="YN1551_0716"
FT   CDS_pept        655996..657054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0716"
FT                   /product="terminal oxidase, subunit (DoxC)"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47843"
FT                   /db_xref="GOA:C3NMM3"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMM3"
FT                   /protein_id="ACP47843.1"
FT                   /translation="MDKKEKFELYWVIYVIVLFAIVIYATAPAVYTIGGDSTSVQAGVI
FT                   IPTSAVNEGKIVQGTLYAYQYYFAIKENGGGITSNELGSPFYYNIMVTHPGQYINLTMY
FT                   AAPHMATTDFYFPDYATHVDDVQVVPGIVQYAPIVVPNITGAFAFLNGEYNGPWFSYQD
FT                   GLLLVLPYQGYMNPTDIDKYITQTHLAQTSTLVGDPYNPPIVVYNTTTSPTITLVANNY
FT                   AMFNDSVPGPTAIVLASSNVTVNMYIPTPNNDHNFLYNYSTTGTSYPVTDVYVGIYAVW
FT                   WNGSITLVKEVPIQYDKTITFTFTATAPAYLYGLITPVYYNYNFMKMSTTLTGEQTGYV
FT                   MGLWGAILVEQG"
FT   gene            657060..657251
FT                   /locus_tag="YN1551_0717"
FT   CDS_pept        657060..657251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0717"
FT                   /product="terminal oxidase, small hydrophobic subunit
FT                   (DoxE)"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47844"
FT                   /db_xref="GOA:C3NMM4"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMM4"
FT                   /protein_id="ACP47844.1"
FT                   /translation="MVSFFKLLGIAYILAIGLLVWELTMETLHAAAVSYILPFTIGAFI
FT                   GFISFFLFVYFAPEDEHK"
FT   gene            657348..657542
FT                   /locus_tag="YN1551_0718"
FT   CDS_pept        657348..657542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0718"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47845"
FT                   /db_xref="GOA:C3NMM5"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMM5"
FT                   /protein_id="ACP47845.1"
FT                   /translation="MERIDKPMAISGILILGLSLTMLLMAIFSSSMLAWLAPEPRYYIP
FT                   TLGFIISMFLLACCKTTRN"
FT   sig_peptide     657348..657458
FT                   /locus_tag="YN1551_0718"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.715 at
FT                   residue 37"
FT   gene            complement(657513..658259)
FT                   /locus_tag="YN1551_0719"
FT   CDS_pept        complement(657513..658259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0719"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47846"
FT                   /db_xref="GOA:C3NMM6"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMM6"
FT                   /protein_id="ACP47846.1"
FT                   /translation="MLVDSHAHIDVGDFDADRDFIVNECEILIVNAGVDLQSNLKTLKL
FT                   ARKYNNIIPAIGFHPEFVKDKINEVDKCVELTRYANIISEVGLDYFWIKENELKRKQIE
FT                   ILERFLQIAEIEEKPVIIHIRGGMKDFLEMITSFRKVKFVIHSFEGSIKIADKVIELGG
FT                   LISIPPIIVRDKDRQRVVKEIPLDFILTETDSPFMGPEKMSRNKPCNVKFAIKQISQLK
FT                   RVEEDEVEEKIYKNFLALVSSRLTTS"
FT   gene            complement(658291..658455)
FT                   /locus_tag="YN1551_0720"
FT   CDS_pept        complement(658291..658455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0720"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47847"
FT                   /db_xref="GOA:C3NMM7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMM7"
FT                   /protein_id="ACP47847.1"
FT                   /translation="MAVEEIVKVSRNYQVTIPAKVRQKFQIKEGDLVKVTYDESEGVVK
FT                   IQLLKEPWK"
FT   gene            658704..659093
FT                   /locus_tag="YN1551_0721"
FT   CDS_pept        658704..659093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0721"
FT                   /product="transcriptional regulator, TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47848"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMM8"
FT                   /protein_id="ACP47848.1"
FT                   /translation="MSETQLSEGTRIKLPSGKDAGLVDILSFCYGLSETDVTVLLALMK
FT                   GDARGTEELESDLKLSKASINRSLNKLLEMGLVMRIKEPGNKAGRPRYLYKARDYTELK
FT                   GKMLSDIKDCADKMAQLVEKEFKPL"
FT   gene            659160..659555
FT                   /locus_tag="YN1551_0722"
FT   CDS_pept        659160..659555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0722"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47849"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMM9"
FT                   /protein_id="ACP47849.1"
FT                   /translation="MFWHRRRGLKWLILYVLSKGTMTGAQIMDEIERTSYGMWRPSPGS
FT                   VYPALDALESEGLIRISKVDGWKKYYELTEEGRKAIGVMSEEDKVKEAIEQLEFSARYI
FT                   VENLEKLNDEDKRKVKNILDELSKVMR"
FT   gene            659589..660338
FT                   /locus_tag="YN1551_0723"
FT   CDS_pept        659589..660338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0723"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47850"
FT                   /db_xref="GOA:C3NMN0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMN0"
FT                   /protein_id="ACP47850.1"
FT                   /translation="MPIEVYEYDKYILLKFYPKDNKYNLFNVEFMTQLIDTLSAINDNK
FT                   GKRFLIIRGEDNFGTGADIRELIKASNDNEFAITFFTYMREIFHKMLDMNKIVISQVKK
FT                   IAYGASMELLLLSDYVISESKAMFATPGVKIGVFPPVLSSIGHFILGYNNIKRIAMKGE
FT                   VIDANEAKSIGLVHIVNDDLDKATFELIKELSISAPSATLYIKRNMLRPFRDYIDKAFN
FT                   DLIIQIQSEEAREGLLSFINKTNPPWF"
FT   gene            complement(660335..661336)
FT                   /locus_tag="YN1551_0724"
FT   CDS_pept        complement(660335..661336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0724"
FT                   /product="ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47851"
FT                   /db_xref="GOA:C3NMN1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMN1"
FT                   /protein_id="ACP47851.1"
FT                   /translation="MNRILLTVSALVKDNLRNRFVIFWIIIFPIIITLLFGLVFGGFSS
FT                   YFHVIVAVEGDYGLAKYLNTTEIFQGLTNVSLKYAVEHDYIYVKVNGSSFTIYTSKQNQ
FT                   EFVPVLESVIDQYYQKVNNTRDFTVLQISGYTYYYYLISGIIGIISLSNGILSTIGVSA
FT                   SYFRDRIIERLATSPLKSYEWVISLIIYVIIITLISTAAVIILGILFGFIPIIGIEFLG
FT                   FLVISTLLFGGLGAIIYGLTPKDKIFLSEIVANVLVFPLMFLSNAFFPPNVYPPIVRIF
FT                   VEYQPLSVIITIIRDLIVYGVSPNPILVSIVFFFTVLFLYAGGRLLKLREID"
FT   gene            complement(661329..662069)
FT                   /locus_tag="YN1551_0725"
FT   CDS_pept        complement(661329..662069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0725"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47852"
FT                   /db_xref="GOA:C3NMN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMN2"
FT                   /protein_id="ACP47852.1"
FT                   /translation="MSNVIVEVRDLYKNYKDKEVLRGISFTVYKGEIFSLLGPNGAGKT
FT                   TTVKVLSCVIKPYRGEVRVIGYRVPEECGKIREKIGVMPQDYQGFLDLTVRENIEYFVK
FT                   LYNGKETQVDELISLLDLEEVKNQKLRYLSGGYMRRVGLASAFAGNQEILFLDEPTLGL
FT                   DPKARREFWEIIKMMKNKGVTIFLTTHYLDEAQKLSDRVAILYGGKVIKVSTASEIMAE
FT                   FKTSNLEDAYLELIKSLEDGENNE"
FT   gene            662098..663054
FT                   /locus_tag="YN1551_0726"
FT   CDS_pept        662098..663054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0726"
FT                   /product="AIR synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47853"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMN3"
FT                   /protein_id="ACP47853.1"
FT                   /translation="MNFGKVSINKFIYNLPTGDCLTCPSIGEDAAVLETKGEYLIVHSD
FT                   PITEAKSDNGFLSIAVACNDINMKGAQCRWVNSVILLSDISHLGGIISGISEACNLIGC
FT                   KVVGGHTEVTSNVKQDIVITTAMGTSNKFLNYKSVKEGMKVVLVGSPGIEGTWILAKDY
FT                   SELLLEKGVSREVIEKAKGFKMDIIVQQRALSILDYVAAMHDATEGGVMQALLEIAKAT
FT                   GYTVLINLDKIGLRYETKIITKALNIDPLKLISSGSFIAISNHPEKILERISEAYVIGE
FT                   IKRGDSVLEIKGVGTFNQDFEEELVKFESNYLSWGKG"
FT   gene            663020..663514
FT                   /locus_tag="YN1551_0727"
FT   CDS_pept        663020..663514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0727"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47854"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMN4"
FT                   /protein_id="ACP47854.1"
FT                   /translation="MKAIILAGGKGKRVTLFKPFLVVCGKPLISWVFDAVNKVCDKVYL
FT                   GISPSHPLFPIFKDSIFKIFPTPDISYENDIKYVVDNLKPPILVLPIDLAFIDDNAIKT
FT                   LIDKCNVDVCSLKSNGNYLGVSYWIGLNFSNYATIEVKRRLYNINTWEDYIRANKECNM
FT                   L"
FT   gene            663511..664239
FT                   /locus_tag="YN1551_0728"
FT   CDS_pept        663511..664239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0728"
FT                   /product="protein of unknown function DUF1614"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47855"
FT                   /db_xref="GOA:C3NMN5"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMN5"
FT                   /protein_id="ACP47855.1"
FT                   /translation="MKRIIVLSPFRGLFRSILYFLLGLIMALISAGYFSQLFSIVGINK
FT                   DIAIIVSIAISFLSLFSSPFNLVLKEVKKEAIAIEEDVVFFFGFPIFIPRISRRNMNTL
FT                   VAINLGGALIPVGVSLFLMYELQGYSIYFIINILIVTIISKFFSRVIRGIGVIMHPIIP
FT                   SVFSVITSYVLFYKFHFLIPLSAYIGSILGTLIGADLLNLRRIINEARPQIISIGGMGT
FT                   FDGIFVSGIISVFISELLII"
FT   sig_peptide     663511..663618
FT                   /locus_tag="YN1551_0728"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.680 at
FT                   residue 36"
FT   gene            complement(664244..664483)
FT                   /pseudo
FT                   /locus_tag="YN1551_0729"
FT   gene            664814..664889
FT                   /locus_tag="YN1551_R0002"
FT                   /note="tRNA-Pro1"
FT   tRNA            664814..664889
FT                   /locus_tag="YN1551_R0002"
FT                   /product="tRNA-Pro"
FT   gene            664971..665066
FT                   /pseudo
FT                   /locus_tag="YN1551_0730"
FT   gene            665210..665341
FT                   /locus_tag="YN1551_0731"
FT   CDS_pept        665210..665341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47856"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMN6"
FT                   /protein_id="ACP47856.1"
FT                   /translation="MTAKQQQIYDSLKTLSEHKTAMPLSKLSKEELKLLPELREKGI"
FT   gene            665719..665982
FT                   /locus_tag="YN1551_0732"
FT   CDS_pept        665719..665982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0732"
FT                   /product="ORF D-335 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47857"
FT                   /db_xref="InterPro:IPR012922"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMN7"
FT                   /protein_id="ACP47857.1"
FT                   /translation="MGNKTYTFGDIRIREVKGKYYVYIIEKDNEGNRRDHYIGPLDKIV
FT                   EFYISSGGLEGTPNGGSKGTPYRSGLVLVIAGSNPTVSISWV"
FT   gene            665987..666427
FT                   /locus_tag="YN1551_0733"
FT   CDS_pept        665987..666427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0733"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47858"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMN8"
FT                   /protein_id="ACP47858.1"
FT                   /translation="MTRNKAKSLLINSVRRVKISLFYLESGFIDEARKEIQKSWREVIS
FT                   ALLILNLYSIVEDNKDREIIHYSVPRSKIFSISKSLEDRGYKDLVKISSMYFSSLQELP
FT                   KSEIKVLISALADEEIMHIKEWFSEIWDEKLDEMLNEVKIRR"
FT   gene            666501..666587
FT                   /locus_tag="YN1551_R0003"
FT                   /note="tRNA-Asn1"
FT   tRNA            666501..666587
FT                   /locus_tag="YN1551_R0003"
FT                   /product="tRNA-Asn"
FT   gene            complement(666875..666959)
FT                   /locus_tag="YN1551_R0004"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(666875..666959)
FT                   /locus_tag="YN1551_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(667009..667296)
FT                   /gene="ffs"
FT                   /locus_tag="YN1551_R0005"
FT   ncRNA           complement(667009..667296)
FT                   /gene="ffs"
FT                   /locus_tag="YN1551_R0005"
FT                   /product="SRP RNA; RNA component of signal recognitionparti
FT                   cle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(667365..668333)
FT                   /locus_tag="YN1551_0734"
FT   CDS_pept        complement(667365..668333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0734"
FT                   /product="glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47859"
FT                   /db_xref="GOA:C3NMN9"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMN9"
FT                   /protein_id="ACP47859.1"
FT                   /translation="MSISGILLSIFISFFISYITTVWVIRQAKKSGLVGKDVNKPDKPE
FT                   IPLMGGISIIAGFIAGSFSLLLTDVRSERVIPSVILSSLLIAFLGLLDDIFNVRQSVRA
FT                   FLPIFASVPLIVYSVGHSVISIPFLGPVNFGILYYVIIIPFALTITSNAFNMLEGLNGL
FT                   GVGMGIIMLSALAYIGLTHGGSSYQAGLVALSAIFSLVAFLLFNKYPAKIFPGNVGTYF
FT                   IGALIGAIGIAGFMYTALAILYIPYVVEFMLKLRTKFKGVSFGKVDSSGRLYWDEKPHS
FT                   LTHIVMKMGRFKEYQVVIILWGVEAIFAIIAVILQSVTIVI"
FT   gene            complement(668334..669329)
FT                   /locus_tag="YN1551_0735"
FT   CDS_pept        complement(668334..669329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0735"
FT                   /product="Farnesyltranstransferase"
FT                   /EC_number="2.5.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47860"
FT                   /db_xref="GOA:C3NMP0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMP0"
FT                   /protein_id="ACP47860.1"
FT                   /translation="MSDELSSYFNDIVNNVNFHIKNFVKSNVRTLEEASFHLFTAGGKR
FT                   LRPLILVSSSDLIGGDRQRAYKAAAAVEILHNFTLVHDDIMDRDYLRRGLPTVHVKWGE
FT                   PMAILAGDYLHAKAFEALNEALKGLDGDTFYKAFSIFINSIEIISEGQAMDMSFENRVD
FT                   VTEEEYVQMIKGKTAMLFSCSAALGGIINKASDDIIKNLVEYGLNLGISFQIVDDILGI
FT                   IGDEKELGKPVYSDIREGKKTILVIKTLSEAKDDEKKILVSTLGNREAKKDDLERASEI
FT                   IRKYSLQYAYNLAKKYSDLALEHLRKIPVYNETAEKALKYLAQFTIERRK"
FT   gene            complement(669331..670437)
FT                   /locus_tag="YN1551_0736"
FT   CDS_pept        complement(669331..670437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0736"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47861"
FT                   /db_xref="GOA:C3NMP1"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMP1"
FT                   /protein_id="ACP47861.1"
FT                   /translation="MPDIVNRKVEHVEIAAFENVDGLSSSTFLNDVILVHQGFPGISFS
FT                   EINTKTKFFRKEISVPIMVTGMTGGRNELGRINKIIAEVTEKFGIPMGVGSQRVAIEKA
FT                   EARESFAIVRKVAPTIPIIANLGMPQLVKGYGLKEFQDAIQMIEADAIAVHLNPAQEVF
FT                   QPEGEPEYQIYALEKLRDISKELSVPIIVKESGNGISMETAKLLYSYGIKNFDTSGQGG
FT                   TNWIAIEMIRDIRRGNWKAESAKNFLDWGVPTAASIMEVRYSVPDSFLVGSGGIRSGLD
FT                   AAKAIALGADIAGMALPVLKSAIEGKESLEQFFRKIIFELKAAMMLTGSKDVNALKKTS
FT                   IVILGKLKEWAEYRGINLSTYDKVRKRE"
FT   gene            complement(670430..671149)
FT                   /locus_tag="YN1551_0737"
FT   CDS_pept        complement(670430..671149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0737"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47862"
FT                   /db_xref="GOA:C3NMP2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR024192"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMP2"
FT                   /protein_id="ACP47862.1"
FT                   /translation="MDMGSELAYDYRVLKLGGSLITCKDLPRCVRLELLRKVSEEIKKF
FT                   VDENPNEKIILLHGGGSFGHYEASIFDDSRAVRTSEAMQELNYMITKQLLKSGVNVISI
FT                   PGKFYTFDIVLNALEKGLVPLIYGDIKFDASIISADDMSIDIAKKLNARLLFAIDKAGI
FT                   LGRDGRVISELRRIDEVGRLLQANYYDVTGGISSKIQKIFENNLNAMIFDGSKAGNIYL
FT                   ALKGYNIGTLVRGNPNA"
FT   gene            complement(671101..671823)
FT                   /locus_tag="YN1551_0738"
FT   CDS_pept        complement(671101..671823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0738"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47863"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMP3"
FT                   /protein_id="ACP47863.1"
FT                   /translation="MQLLVTLRDLKIQLWVILQRVLGVRVPFLGIPLKGVNNPILVLDG
FT                   IIEPLNIFVKTEAIGQFIRQFNEAIGFQCVKEEEYWDSSIPFSSYYIYVTEKLANDAIR
FT                   NCEVPMSEDEKFEILHLVDEAIFPQNSLVKALRTSQQLNSPILFRDGEEPIRIQLESIK
FT                   IKVVSSYPFYGNPKYLDNSLIHLTGIIPVEYAESKARNLIEFENGLWSAIYSLPYLKIN
FT                   NWKWIWDLNWLTIIEFSN"
FT   gene            complement(671750..672604)
FT                   /locus_tag="YN1551_0739"
FT   CDS_pept        complement(671750..672604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0739"
FT                   /product="protein of unknown function DUF52"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47864"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMP4"
FT                   /protein_id="ACP47864.1"
FT                   /translation="MKRLPAVAGSFYESDPKKLKMQIEWSFRHNIGPRDIPKQTYEKKK
FT                   RDNLFFVVPHAGYIYSGPVAAHSYYYLVSEGRPDVVIILGPNHTGLGSYVSAWPKGEWE
FT                   TPLGSVKIDEEILMQLVKESEVIDLDEKSHLYEHSIEVQLPFLQYFFDDDFKIVPIVIM
FT                   MQTPEIAEFLADAIYNVMQKNPDKDIVVLASSDMNHYDPHEITVKKDVEAIEKIQQLDY
FT                   KGLYEVVEGKDVTLCGYGPIMVNLILAKKFGKKAYILKHATSGDTSGPKDSVVGYLAAR
FT                   FGS"
FT   gene            complement(672601..673290)
FT                   /locus_tag="YN1551_0740"
FT   CDS_pept        complement(672601..673290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0740"
FT                   /product="ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47865"
FT                   /db_xref="GOA:C3NMP5"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023454"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMP5"
FT                   /protein_id="ACP47865.1"
FT                   /translation="MINLSEKEERGGELTEAEKEELRKSEKGTIIELLVPVETYLSAGV
FT                   HIGTHSCTKYMESFVYRVRAEGLYVLDVRKIDERLRIAAKFLSRYEPQDIIAVASRPYA
FT                   YRPVQKFAEVVGARALVGRIIPGTFTNPYLSTYTEPKVLLVSDPRTDTQAIKEAAKVGI
FT                   PIVAFADTDAKIDYIDLIIPANNKGRKSLALLYWALARQILREKRIIPLDGDLAVPVSE
FT                   FEMRLVQ"
FT   gene            complement(673294..673494)
FT                   /locus_tag="YN1551_0741"
FT   CDS_pept        complement(673294..673494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0741"
FT                   /product="RNA polymerase, N/8 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47866"
FT                   /db_xref="GOA:C3NMP6"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMP6"
FT                   /protein_id="ACP47866.1"
FT                   /translation="MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCC
FT                   RRMLLSHIDIISEVIHYTRPI"
FT   gene            complement(673501..673914)
FT                   /locus_tag="YN1551_0742"
FT   CDS_pept        complement(673501..673914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0742"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47867"
FT                   /db_xref="GOA:C3NMP7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMP7"
FT                   /protein_id="ACP47867.1"
FT                   /translation="MSEEQKVIISSARRKTARATCYILPGKGRVFVNNIPIELIPIEMV
FT                   RLKVMEPLLLAGNGVRSKIDAKIVTYGGGIMGQTDAARMALARALVKFTGSDELKKIYR
FT                   AYDRTMLAGDPRQTESEKWMRYSARRWRQKSYR"
FT   gene            complement(673911..674360)
FT                   /locus_tag="YN1551_0743"
FT   CDS_pept        complement(673911..674360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0743"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47868"
FT                   /db_xref="GOA:C3NMP8"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMP8"
FT                   /protein_id="ACP47868.1"
FT                   /translation="MSTQVQEQEVVINAEGQILGRMASNIVRLLKEGKKVVIVNGEKAV
FT                   ISGEKNRVIESYKLLLTVRTLFNPYRNGIRRPKSPINIVKRTIRGMLPKSSKGRRMLNN
FT                   VKVYIGVPKEFEGRQFIKFPDADVSRLKGKYVTVEVVAKELGWSG"
FT   gene            complement(674357..674716)
FT                   /locus_tag="YN1551_0744"
FT   CDS_pept        complement(674357..674716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0744"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47869"
FT                   /db_xref="GOA:C3NMP9"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMP9"
FT                   /protein_id="ACP47869.1"
FT                   /translation="MKVTGSTNIMVRKVIRNLEKSKKPLWRKVAEELSASSRKRPYINL
FT                   YKINKYTRPNDIVVVPGKVLGIGKLDHVVTVIALDFSKSAIEKIRASGGQAMSIYKALE
FT                   TFKDFKGKNVRLMKQ"
FT   gene            complement(674713..675510)
FT                   /locus_tag="YN1551_0745"
FT   CDS_pept        complement(674713..675510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0745"
FT                   /product="RNA polymerase insert"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47870"
FT                   /db_xref="GOA:C3NMQ0"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR022842"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMQ0"
FT                   /protein_id="ACP47870.1"
FT                   /translation="MSINLLHKDDKRIDLVFEGYPLEFVNAIRRATMLYVPVMSIDDVY
FT                   FIENNSPLYDEILAHRLALIPFTSEEALDTYRWPEECIECTENCEKCYTKIYIEAEALN
FT                   EPKMLYSKDIKSEDPSIVPISGDIPIVLLGANQKISLEARLRLGYGKEHAKFIPVSLAI
FT                   VRYYPKVEILGNCEKAATVCPEGVFELKDGKLSVKNELACTLCEECLRYCNGLIRISSI
FT                   EDKYILELESVGSLKPERILLEAGKSIIRKIEELEKKLVEVIK"
FT   gene            complement(675522..675920)
FT                   /locus_tag="YN1551_0746"
FT   CDS_pept        complement(675522..675920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0746"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47871"
FT                   /db_xref="GOA:C3NMQ1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019961"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMQ1"
FT                   /protein_id="ACP47871.1"
FT                   /translation="MSSRREIRWGIAHIYASQNNTLITISDLTGAEIISRASGGMVVKA
FT                   DREKSSPYAAMLAANKAASDALEKGIMALHIKVRAPGGYGSKTPGPGAQPAIRALARAG
FT                   FIIGRIEDVTPIPHDTIRRPGGRRGRRV"
FT   gene            complement(675904..676449)
FT                   /locus_tag="YN1551_0747"
FT   CDS_pept        complement(675904..676449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0747"
FT                   /product="ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47872"
FT                   /db_xref="GOA:C3NMQ2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR022802"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMQ2"
FT                   /protein_id="ACP47872.1"
FT                   /translation="MGDPKKSRKKWESPGHPWIKERIGYEQELLGKYGLRNKREIWIAQ
FT                   SIIRKFRHQARSLLALPPAERAVREKQLVGKLLKMGLLKRETATVDDILSLTEQDLLER
FT                   RLQTIVYKKGLANTTYQARQLIIHGHIAVNGKRVTSPGYIVNVDEENLIDYYVTSSFKS
FT                   RPPVMAQQEGGEAGVKQA"
FT   gene            complement(676460..676960)
FT                   /locus_tag="YN1551_0748"
FT   CDS_pept        complement(676460..676960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0748"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47873"
FT                   /db_xref="GOA:C3NMQ3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019977"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMQ3"
FT                   /protein_id="ACP47873.1"
FT                   /translation="MSQQFKYVVRIFGQDVDGTMKLPYALAMVKGIGYNTAKAMILKLG
FT                   MDPNARLGELSDADIKKVESVISDHAIKGLPSWLYNRRKDYESGLDLHLVTSDLIFYVR
FT                   NDIEREKKSRSWRGVRHSLGLKVRGQRTRTTGRTGMTIGVARKKAAQPQAQQSSSQQQQ
FT                   KSS"
FT   gene            complement(676981..678258)
FT                   /locus_tag="YN1551_0749"
FT   CDS_pept        complement(676981..678258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0749"
FT                   /product="AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47874"
FT                   /db_xref="GOA:C3NMQ4"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR009186"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMQ4"
FT                   /protein_id="ACP47874.1"
FT                   /translation="MDLEGIVRRLYPDVEKAKTKLIEEIRFYKGDRYNAEEISNVILTE
FT                   VMNSMKADSIFGFPKTNIKAGEAGLGSRGIGDNLIHTKLFELTGKQIEEYDDAGIRENI
FT                   VVSIDGIHSRLSYFPFLAGFYATRATLRDIMVKGAYPLGLIVDIHLSDDSDVGMLIDFE
FT                   AGVTSIGKALNVPILSGSTLRIGGDLVLGDRISGAVGSIGVLKSKDFLRRRVTKGLKIL
FT                   MTEGNGGGTIATTAIYNGMPDVISETLNIKDLITCIVVRDHLSSNVYSMTDVTNGGIRA
FT                   DALEVSKITNLSFVIDDEKFLSLINPKVRKMLEEINIDPFGISIDSILIFTDNPDLVKE
FT                   RLAQHNIRSEVIGYIDDFRQYPIITYGGKELKPQFRESPYTPIKKYIGNYSPYSIEYIS
FT                   NRLDYAIAEAKTKMDNILKNLKTSFT"
FT   gene            678464..678817
FT                   /locus_tag="YN1551_0750"
FT   CDS_pept        678464..678817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47875"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMQ5"
FT                   /protein_id="ACP47875.1"
FT                   /translation="MGQKLPPTNKPPFEKLYDCESESCIQKLVDDYIYNLMANNNNSNN
FT                   YTMFKLFKDEDDSDHKFVLNEKVMLNSYLFIKVLLRRILETDLDFEYVIDDLEKKLGNT
FT                   HPVVLFLKQFKDD"
FT   gene            678863..679948
FT                   /locus_tag="YN1551_0751"
FT   CDS_pept        678863..679948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0751"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47876"
FT                   /db_xref="GOA:C3NMQ6"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023617"
FT                   /db_xref="InterPro:IPR023678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMQ6"
FT                   /protein_id="ACP47876.1"
FT                   /translation="MSIDQRLQLITRNAAEIITIDELRKKIESEEKLKGYIGFEPSGLF
FT                   HIGWLIWTQKVKDLVEAGVNMTLLRATWHAWINDKLGGDLSLIKMAADYTVEVIKNYGV
FT                   DTTKLNIVDADDMVKEKDYWALVIKVAKNASLARIKRALTIMGRRAEEAEIDASKLIYP
FT                   AMQVSDIFYLDLDIALGGTDQRKAHMLARDVAEKMGKKKIVSIHTPLLVGLQGGQRMSI
FT                   TEGMEEDDIQAEIKMSKSKPESAIFVSDSREDVERKIMGAYCPKGVAENNPILQILKYI
FT                   IFPRYNFVKIERDIRYGGDVEFKDYEELERAYIEGKIHPMDLKKATARRLNEILEPIRK
FT                   SLERKPEFEEMIQKISKSVTR"
FT   gene            679968..681176
FT                   /locus_tag="YN1551_0752"
FT   CDS_pept        679968..681176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0752"
FT                   /product="TOPRIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47877"
FT                   /db_xref="GOA:C3NMQ7"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR020607"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMQ7"
FT                   /protein_id="ACP47877.1"
FT                   /translation="MKYDIKLRFEVEGIVEKTDVIGAIFGQTENLFGDEFDLRELQDKG
FT                   RLGRIIVEIRTKGGKSEGEIIIPSNLDRIETALIAAMVESVDKVGPYNSKFELIEIEDI
FT                   RAEKLKKIIERAKGILSSWSKEKSLDIKEVINEISSAVKVGEITEYGPERLPAGPDVDK
FT                   DPNLIIVEGRADVINLLRYGYKNVIAVEGATSRIPETVVSLSKMKKTVIAFLDGDHGGD
FT                   LILKELLSNNVKIDFVARAPVGREVEELTGKEIAKALSNMMPLTQYLKKIQEAEQAIAK
FT                   NVIAKEEKPIQLEATQQLVQITLPQNVLEEIKKLPGTLEGVLYDNNWNLIEKVQVRDII
FT                   PKLEAYEDNKVAYIVFDGVITQRLLDLASQKNIKMIIGARIGGINKRPQNVDILTFTDI
FT                   ISS"
FT   gene            complement(681163..683454)
FT                   /locus_tag="YN1551_0753"
FT   CDS_pept        complement(681163..683454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0753"
FT                   /product="DNA polymerase B exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47878"
FT                   /db_xref="GOA:C3NMQ8"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMQ8"
FT                   /protein_id="ACP47878.1"
FT                   /translation="MIKDFFILDFSYEIKDNIPLIYIWSIDDEGNSCVVVERNFKPYFY
FT                   LVYEGNGDEIIENIRKNCEVLLITKVKRKYLGNVVDALLVQTSTPTQIKRCREKISRIN
FT                   GIKSIFDADIRFTMRYSIDFDLRPFTWFKAEVSEVKLEGFRTKKVYILDKILSHYEGKI
FT                   PELRAIGIDFQIYSKYGSLNPRKDPIVVLSLWSKEGSMQFSLDESMDDLKIIRKFVDYI
FT                   LNYDPDIIYVFDVDVFHWKYITERANSLGVKIDIGRKIGSEVSQGTYGHYSISGRLNVD
FT                   LVGLLMNERLTGHVDLIEVANYLGISPRRDSLNWYEISRYWDDEKNRDLVKQYSLENAK
FT                   SIYLLGNFLLSPYSELVKITGLPLDKLSVASWGNRIEASLIRTAAKSEELIPVRMDNPN
FT                   RSLKIKKTVIEPKIGIYSDAYVLDISSVYLSVIRKFNIGPDTLVKGQCDDCYVSTISNY
FT                   KFKREPSSLYKTFLEELSNIQDIRKLEVIEELMSSFYDYIHWINSRWYSREIASAVDEL
FT                   SYEIVKLVIDLIKNSGFEAILANDLLVFVKGGSGDKLNELIFKINSLYDLNLKVRKIYR
FT                   SLLILGNDRYAGLLEGDKIDIARIGKEDMDLCELVRNVKRKVVEEILISKDVKKAVKLV
FT                   KSAVIKLRRGEFNIRELITWVHIEKDLSEYDKQLAFVVAARKAIQSGYLISKDSRIGYL
FT                   IVKGHGSVHDRAEPFFFVKEKNRIDIEYYVDQLLRESLKVLTPLGVSEESLKKTNITDI
FT                   LDMFGASKKK"
FT   gene            complement(683506..683961)
FT                   /locus_tag="YN1551_0754"
FT   CDS_pept        complement(683506..683961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0754"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47879"
FT                   /db_xref="GOA:C3NMQ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMQ9"
FT                   /protein_id="ACP47879.1"
FT                   /translation="MVIITDATEADLGQIFQIETESFDDPYPYSLLRTYLFLANKLYLV
FT                   AKEGEKIIGYIIGIIQYGYRGHIVSIAVEPAYRKKGIGTKLLSEIEERFKLNGAKYSYL
FT                   EVNINNLPAISFYQENGYLIMYIRRNYYGRSKHAFVMIKNLYYKFLD"
FT   gene            683980..685014
FT                   /locus_tag="YN1551_0755"
FT   CDS_pept        683980..685014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0755"
FT                   /product="translation factor pelota"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47880"
FT                   /db_xref="GOA:C3NMR0"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR023521"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMR0"
FT                   /protein_id="ACP47880.1"
FT                   /translation="MRILEFDEKRQAAKLHIESEDDLWILHLILEKGDKVVAKTTRDIG
FT                   LGKESRRIPMTIVLKVDYTEFQEFTNRLRIHGIIEDAPERFGIRGAHHTINLDIGDEII
FT                   IIKQQWNKYALDKLKKQADKRSKIIIALVDFDEYLIAIPFEQGIKILSEKSLRSLNEEE
FT                   GIIEQNALEVATELAEYVKQYNPDAILLAGPGFFKEEVAKKVNNILKNKKVYIDSVSSA
FT                   TRAGLHEILKRDIIDKIMSDYEIAIGAKKMEKAMELLAKQPELVTYGLEQVKNAVEMGA
FT                   VETVLLIEDLLSSNNQERLAIERILEDIENKRGEIILVPKESPIYFELKNLTGILAILR
FT                   FRIN"
FT   gene            complement(684985..686037)
FT                   /locus_tag="YN1551_0756"
FT   CDS_pept        complement(684985..686037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0756"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47881"
FT                   /db_xref="GOA:C3NMR1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040087"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMR1"
FT                   /protein_id="ACP47881.1"
FT                   /translation="MTIIGNPEIGLYTGKLPKGCELCRLGGKLVLFITGECDDNCYYCP
FT                   VSDDRFGKNRIFANETEVKDAMDVIYEAYRMKALGAGITGGDPILEIGRVIEIIDKLKN
FT                   EFGSDFHIHLYTTGRYVNDDVMKELVSAGLDEIRFHPVKELYLNAVKIALKYDIDVGLE
FT                   LPAIPNEGYKIVRLVKWAEENNVKFVNLNELELNARNYLNLNSKGLHAKHGITGVEGSF
FT                   DTALDVLKKFEEDKKITVHYCSSVYKDLVETRTRFFRIIKYNSKPYEEYTNEATIVRAI
FT                   VKTNHKIPSLENFGEFNGSNEYSVSPSIIKDLLNEYTDLIDEIYIVEEHPDSRRLRVGE
FT                   KLIYSKSKNS"
FT   gene            complement(685985..686563)
FT                   /locus_tag="YN1551_0757"
FT   CDS_pept        complement(685985..686563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0757"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47882"
FT                   /db_xref="InterPro:IPR008304"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMR2"
FT                   /protein_id="ACP47882.1"
FT                   /translation="MSELNGVSLSLYYKLEVRDLKNTHIKELVSFNLVLNDGSQIGKCN
FT                   YFSGRGYYTPWLEIDYYPILRNENLEENFFKVIYNFLSPGGKLFVTYIRDNETREMLYK
FT                   GTHPVETPLGLSLLLAGFTWFKDWYFPEGGNEGFPKLQSNKPLNGYEGVRQLEVIREEI
FT                   KNVNIIKRIDELIDHYRKSRDRTIHWKIT"
FT   gene            complement(686556..687212)
FT                   /locus_tag="YN1551_0758"
FT   CDS_pept        complement(686556..687212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0758"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47883"
FT                   /db_xref="GOA:C3NMR3"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR009185"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMR3"
FT                   /protein_id="ACP47883.1"
FT                   /translation="MQIDYTERHWKILNGKRKIAIEILSLLKQYGMEGYVYGSVARGDV
FT                   NEKSDVDVIVFNPNQIVLDTLNVNHKYIVQATPNSAPKAYLSIDEEETIVISFPLGRLR
FT                   RNEIEFYSFGGLVDLKDLLENRRVPGVNKKLMLIIPTENGHMEIPLEGNEDYVSKLLKI
FT                   SLDTIMERKRLLTKRIERGHTGIFLRYDLSGNESIYDAFNKMYKSNKFFKRMVDV"
FT   gene            687186..688340
FT                   /locus_tag="YN1551_0759"
FT   CDS_pept        687186..688340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0759"
FT                   /product="peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47884"
FT                   /db_xref="GOA:C3NMR4"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMR4"
FT                   /protein_id="ACP47884.1"
FT                   /translation="MTLRIIYLHIFLISKYIIRFVDQIYLAVTIFLSFWLIIYVFRRKL
FT                   EKYNLTVYPFFILWRKKAREYWFPRFSRSKGYKVYEKIALPLGFLLMIAGISTILYVII
FT                   EMLTIKPNQTPTIALKPIIPGLTISISQLPYILLAIGVSVAIHEIFHALSATSNNVKVK
FT                   NGGVLLLGIFPGAFVEPDEDDFNKSTTDAKLKIIAAGIVINLVLALIALPFSFELPYLP
FT                   SELSQGIMIEGIVNNSPAANASIHAGDVICYINGYRVTTLSQLHELLYKYNTVFITLKH
FT                   PNGTLSNVTVNVLDHLLGVYVTYYIPDYLIAILTFFTWLFIVNFSLAIFNAAPLIITDG
FT                   GKLFTELLKRVLGESNGEKISYYLQSLFFLIFIFAIFLSNRPLG"
FT   gene            complement(688321..689799)
FT                   /locus_tag="YN1551_0760"
FT   CDS_pept        complement(688321..689799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0760"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47885"
FT                   /db_xref="GOA:C3NMR5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMR5"
FT                   /protein_id="ACP47885.1"
FT                   /translation="MNWDERRIKIVEELRKNGIEPYPHKYEITHLIKDIKLLASSQGNK
FT                   SHEPFMFNISTAGRVANIRRHGKASFVDIFDEGEKLQIYMRVDELKEKYDRFFTYVGRG
FT                   DIIGVRGDLFYTMKGELSLLVKDYQLLSKALIEPPDWSKLSPEFRYAHRYVDFLYNDSA
FT                   RKAMEIRYMIIREIREFLYSKGFIEVETPIVQPVYGGALAKPFKTHVNYLNEDWYLRIA
FT                   LELYLKRYIIGGFNKVFEIGKVFRNEDIDVTHNPEFTLLELYWAYADYNDIMNLTEDLL
FT                   KSVIKRVTNSTKVAYGKYEIDFEAPFKRISMYDSLSEILGKNVENMSDDELKELMKKYN
FT                   LIPRGNQYVRGLMIEKLFDKLVTPTLTNPTFITDYPIETTPLCKPHRNKPGLVERFEMF
FT                   IAGMEIANAYTELNDPILQDKLFREEQEMFRRGDEEAHPYDKDFVRALSYGMPPTGGLG
FT                   IGIDRIVMLVTNNYSIKEVIPFPMISSKVILEDD"
FT   gene            complement(690059..690442)
FT                   /locus_tag="YN1551_0761"
FT   CDS_pept        complement(690059..690442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0761"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47886"
FT                   /db_xref="GOA:C3NMR6"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR022481"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMR6"
FT                   /protein_id="ACP47886.1"
FT                   /translation="MSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVER
FT                   GQAKLVVIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEP
FT                   GEAKDLVDEIVKRVNEIKGKTSS"
FT   gene            complement(690834..692561)
FT                   /locus_tag="YN1551_0762"
FT   CDS_pept        complement(690834..692561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0762"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47887"
FT                   /db_xref="GOA:C3NMR7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMR7"
FT                   /protein_id="ACP47887.1"
FT                   /translation="MSSSELREIIYKYALQNAVKHDGKAEAGPVMSKIIAERPELRSNA
FT                   KEIVKIVKEIIDQVNSLTLEQQIAEIETKYPELLEEKKHEEKKKILPPLPNVRGQVVTR
FT                   FAPNPDGPLHLGNARAAILSYEYAKMYNGKFILRFDDTDPKVKRPILDAYDWIKEDLKW
FT                   LGIKWEQELYASERLEVYYKYARYLIEKGHAYVDTCDSSTFKKFRDSRGKMREPECLHR
FT                   SSSPESNLELFEKMLEGMFKEGEAVVRLKTNLMDPDPSQIDWVMLRIIDTTKNPHPRVG
FT                   SKYYVWPTYNFASIIDDHELGVTHILRAKEHMSNTEKQRYISEYMGWEFPEVLQFGRLK
FT                   LEGFMMSKSKIRGMLEKGANRDDPRLPTLAGLRRRGILPDTIKDVIIDVGVKVTDATIS
FT                   FENIAAINRKKLDPVAKRIMFIKDGEEFAIELPQTLKAKIPLIPSKQEEVDRTIIVNSG
FT                   DKILIESIDAEDGSVLRLMELCNVRVDKRNRKLVFHSKTLDEAKKVNARIVQWVKSDEK
FT                   VPVIVEKAERDDIKIINGYAERIVKDLEIDEIVQFYRFGFVRVDKKDGNMVSVIFSHD"
FT   gene            complement(692548..693234)
FT                   /locus_tag="YN1551_0763"
FT   CDS_pept        complement(692548..693234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0763"
FT                   /product="SPP-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47888"
FT                   /db_xref="GOA:C3NMR8"
FT                   /db_xref="InterPro:IPR006382"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMR8"
FT                   /protein_id="ACP47888.1"
FT                   /translation="MIKLVLMDLDGTLTEDRDSTRIDLDAIYAIRLLQEKRIKVGLVSG
FT                   NSYPILRGLYTYLYLDGGIVAENGCIVFYKEKYRLCKQMDKSLVIEFKSLFKLRDTWQN
FT                   EYRECDFGFVPAKLTDEMINWAKEKNLYIKSSGYAVHIAYNAAGKSVGVEKLLQLQGLK
FT                   KEDVAAIGDSSTDIELFQQVGFKVAVGNADDELKDIADYITSNKSGKGVREFVDKLLKG
FT                   ELDVIK"
FT   gene            complement(693231..694430)
FT                   /locus_tag="YN1551_0764"
FT   CDS_pept        complement(693231..694430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0764"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47889"
FT                   /db_xref="GOA:C3NMR9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMR9"
FT                   /protein_id="ACP47889.1"
FT                   /translation="MKKVYDEIYAYIKLDDREAKIIDMPEFQRLRRIKQTSLAYLVYPG
FT                   ATHTRFSHSLGTFYLTTILSEKFKQLGIITDEESTYLKYSALLHDIGQFPFSHSLEPLY
FT                   LEKGLSNKDLRYMIISKSPYFRDFFDKESIDYNKILDILNGNSMISSIINSDVDVDRMD
FT                   YLVRDSRHTGVQLGNIDLYRLLDTIFYGNNNEIIVQDKGIYSLENFFISRLHMYQAVYY
FT                   HKTIIGYELMLREIFRTIHDCCYSSILSVDNLRDLVYDSSISYWDDEWVFMILYTYLYS
FT                   SNSPLYLKDKIRNFLDRRGPKVVYEEVSYNNEMKGGDVEIKELVDRLERNQIPRTSIYP
FT                   IEEKIKILSKDKINIISKNNEINIIKYKSTLINHIPETLTIRRIYVDHEYAKRARDVVP
FT                   "
FT   gene            complement(694483..694586)
FT                   /locus_tag="YN1551_R0006"
FT   rRNA            complement(694483..694586)
FT                   /locus_tag="YN1551_R0006"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(694623..694817)
FT                   /locus_tag="YN1551_0765"
FT   CDS_pept        complement(694623..694817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0765"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47890"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMS0"
FT                   /protein_id="ACP47890.1"
FT                   /translation="MSSNQQQTVSVYTVIKCVNGDYETERPFQDGDYVLKVVGTCPKDG
FT                   RNLYIVGIYAVVPEEKKGS"
FT   gene            complement(694818..695948)
FT                   /locus_tag="YN1551_0766"
FT   CDS_pept        complement(694818..695948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0766"
FT                   /product="Protein of unknown function DUF1512"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47891"
FT                   /db_xref="GOA:C3NMS1"
FT                   /db_xref="InterPro:IPR009995"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMS1"
FT                   /protein_id="ACP47891.1"
FT                   /translation="MSLITLAQTSLNQASSLYYILTYVLFFVLLFLLYLPGVNTRLTVS
FT                   MLARGIEGQLSMIERYLNESKSKMEQLLKERGVQDPKPFIERVSEMFIIDPVNVEPTDI
FT                   ISRMKLLLRSGEDKIRDLITLMVPNIDNVNRSKLEVSAEVVNSLNLIYKVVRHYLILAK
FT                   KLNSVVLLYQLQFVVPQLVKISEAYSKAMSTFIRGIPVGDSLGPLVAAYLFMNADKKWN
FT                   PSRDTVAGEVEFEGRRLVVIKAEGPMATVGRPGEAVENAVEEYKGKVTRIITIDAALKL
FT                   EGENTGAIAEGTGVAMGDPGPEKISIERVAVRYNIPIDAVIVKMSMEEAITEMRKEIYQ
FT                   AAPKALELVKKIILERTKPGDIVVVVGVGNTAGVAQ"
FT   gene            complement(695993..696898)
FT                   /locus_tag="YN1551_0767"
FT   CDS_pept        complement(695993..696898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0767"
FT                   /product="methionine aminopeptidase, type II"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47892"
FT                   /db_xref="GOA:C3NMS2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="InterPro:IPR028595"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMS2"
FT                   /protein_id="ACP47892.1"
FT                   /translation="MTEDELNKLLLAGKIAAKARDEVSLNVKANAKVLDICEEVESIIL
FT                   ENKAFPSFPCNISINSEAAHYSPVINDEKRIPEGAVVKLDLGAHIDGYISDTATTISLD
FT                   AKYQRLLDASKTALEAAIANFRAGLSVGEIGRVIEKMIRAQGYKPIRNLGGHLIRRYEL
FT                   HAGVFIPNVYERGLGAIQSDSVYAIEPFATDGGGEVVEGKDVTIYSLKNPNVKGLSARE
FT                   SELLDFIYTHFNYLPFSERWLKEFSTNVDELRNNIKNLIKKGVLRGYPILLEIKKGVVS
FT                   QFEHTVIVKGNSIIVSTKSL"
FT   gene            696952..697635
FT                   /locus_tag="YN1551_0768"
FT   CDS_pept        696952..697635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0768"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47893"
FT                   /db_xref="GOA:C3NMS3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMS3"
FT                   /protein_id="ACP47893.1"
FT                   /translation="MAQLRWLGHAATLLIFGNKSVIIDPMIKDNPLSPVKIDYFKNNLD
FT                   IIIVTHDHYDHLGDTLELLKMNPKAKLYATYDLEAYLAETYKISEESIIPANVGGFVEV
FT                   DGIKLALTKAVHSSTHSDPTGAIVSAEGITIYHAGDTGLFEDMKLIGEVFKPDYALLPI
FT                   GGRFTMDPYQASISVEFIKPKKGAIPIHYNTWDLIKVDVNDFVKLVKNKGYNPIVLQPG
FT                   QTITL"
FT   gene            697641..699038
FT                   /locus_tag="YN1551_0769"
FT   CDS_pept        697641..699038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0769"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47894"
FT                   /db_xref="GOA:C3NMS4"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022917"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMS4"
FT                   /protein_id="ACP47894.1"
FT                   /translation="MLSENEAKILFFLKDLKRTNSIEISTKIGIPESSVLSLIELLREK
FT                   GYVKTEIISEKYYVLTEEGRKRKENGLPEDILINSLNGQEKDLNEIKNTLDEDFNIAIS
FT                   WAKRKGLIEIKEGKVIPKVKTYTSPEYLALLNLEKADINTINLLKKRGLIEEKERKIVN
FT                   VKLVKEPKESEIGISNLTREMIVSGEWKKYKLRKYNVEAFPPYYTISKKHYFREFLEKV
FT                   KDIMISLGFKEINTGYIEMEFYNFDLLFQPQDHPAREIHDSFAVEGLGNIEDKELLSNV
FT                   KEIHEKFWKYEWKQDITLRLMLRSQTTATTARVLASRPKAPQKLFTLGKVFRPDAIDAT
FT                   HLIEFHQLDGVIIDDNFTFRELLGVLKEIFYRLGIKEIKFKPAYFPFTEPSVEAYGYLE
FT                   KLGWVEMCGAGLLRPEILSSVGIDSIAGAWGIGIERLAMSFLNISDIRLLYSNNIEYIR
FT                   DMKVKIE"
FT   gene            699044..700681
FT                   /locus_tag="YN1551_0770"
FT   CDS_pept        699044..700681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0770"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47895"
FT                   /db_xref="GOA:C3NMS5"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMS5"
FT                   /protein_id="ACP47895.1"
FT                   /translation="MVTIVLNKYKLLDKIHIGQQKLEDLLFNLKSEVKPIDENNIEIEI
FT                   NADRLDLLSSDGIARAIKGLLEKELGEAKYNVTDTEYTLIVDNVRTRPYALAAIVYNAK
FT                   IDLEELIQFQEKLHGTIGRKRKKVAIGIHDLRKVDSKTIEYKEVPLSYKFVPLYGNKEL
FT                   TISEILEKTEQGKLYGNISIANGVSPAIVQDDGEVLSIPPIINSNKTRLDENTKDFFID
FT                   VTGTSFEAVAQTLDIIVSNLAEAGGTIGRVKVLKSANSSQLSSPLFLHKIQNVREEYVK
FT                   KILGIKTSKEEICKHVMRMRMNCDIENGVIRVTVPQYRVDILNEIDVVEDIAMSIGYNN
FT                   LEPSKYISTNYGSYDYMTLLERKIRELGIGAGYVEISNFVLIKDEKLFSNKYVKILNPV
FT                   TEEYNAVRDSLIPGLLDFLSKNQHAKFPIRVFETGDVVVYDSSTDTGFRNDKRAAYAIM
FT                   DNKVSYEDIQAPIHYILKSLGLEVNYKEENNNIFIEGRSASIFYENEKMGVIGEVNPDV
FT                   LIRFGIEYPAVIAELYISEIGKRLTNQR"
FT   gene            700690..701460
FT                   /locus_tag="YN1551_0771"
FT   CDS_pept        700690..701460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0771"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47896"
FT                   /db_xref="GOA:C3NMS6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMS6"
FT                   /protein_id="ACP47896.1"
FT                   /translation="MILIPFIISNGVRLYYEVRGNGKPIVLIHHLAGNYKSWKFVIPKL
FT                   TLDSTVVVYDLRGHGRSSTPNSPYNIEEHSSDLRGLLVQLGIEKPILVGHSIGSLIAID
FT                   YALKYPVEKLILVGALYKAPSPEVYEKYVRIAVNFGLRALAEYRRLHKEFAETLVSNYH
FT                   AWNSLLEVYEETTPIGYKNAVEGLLKAKDYSDELREINVNTLLVYGTYDGLITNINVFK
FT                   NNMKNVETKTIEGYGHFLNFENPSLLSDIIKNFL"
FT   gene            complement(701441..702232)
FT                   /locus_tag="YN1551_0772"
FT   CDS_pept        complement(701441..702232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0772"
FT                   /product="molybdopterin binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47897"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR023055"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NMS7"
FT                   /protein_id="ACP47897.1"
FT                   /translation="MDYWFAEIVTIGNEVLSGKTVNTNASHIGRRLTSLGFTVRRITVV
FT                   MDDIDEIVSAFREAIDRKPKVIVSSGGLGPTWDDKTAEGLAKALGVNLELNKTAFDMIL
FT                   EKYTKRNIPLTEERKKMAYLPYGAMAVENNEGIAPGIYIYHNNIDILATPGVPREMENV
FT                   LENFINKMLRNKPNLKYLEDFIYVENVMESALAPYVKELVKKYDIYIKTHPKSYELLRP
FT                   ILEIQIAGSGREEEIKVKIEKVKNELLDAIKKLNGIIRNSL"
FT   gene            702273..703478
FT                   /locus_tag="YN1551_0773"
FT   CDS_pept        702273..703478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0773"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47898"
FT                   /db_xref="GOA:C3NMS8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMS8"
FT                   /protein_id="ACP47898.1"
FT                   /translation="MFERFLSNETKYLRTSEIRDLLKLTEGRNVISFAGGLPDPQTFPV
FT                   EEIKKIVDDVLLNNADKALQYTATAGISEFRKELVNLSRLRGISGIDERNVFVTVGSQE
FT                   ALFMLFNILLDPGDNVIVEAPTYLAALNVMRTRKPNFISITVTERGPNLDELERKIRNT
FT                   HNDGKKIKLMYVIPTAQNPAGTTMSTEDRKRLLEIASKYDFLIFEDDAYGFLVFEGESP
FT                   PPIKAFDKEGRVIYTSTFSKILAPGLRLGWVIAHEDFIKEMELYKQNVDLHTPSFSQYI
FT                   AMEAIRRGVIQNNLPKIRRVYKEKRDVILEAIETYFPKDARWTRPVGGMFVFAWLPEKI
FT                   DTTKMLEKALQRGVAYVPGSSFYADYSGKNTMRINFSFPKKEELVEGIRRLGDTIKQEL
FT                   ST"
FT   gene            complement(703471..704334)
FT                   /locus_tag="YN1551_0774"
FT   CDS_pept        complement(703471..704334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0774"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47899"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMS9"
FT                   /protein_id="ACP47899.1"
FT                   /translation="MKALVFNLGITINDVPEKQVNRDYVLLKPKRVLVNGLENSIYVGL
FT                   LWVEPTRILGSTGIGRIENVGLDIDKSLEGKLVLVLPYSQTYGGIGTEIDGILAEKATL
FT                   PLDSIVILPQSNFNEKYILYPYVSFALQLPKYISSGNTLIIGSGLYGITSALYLRDVVS
FT                   KVAVYREDGINPKIVGVEEIRHLSQEWDNIVITTFRSWIRAFVDHISKSNTKIIMPKLM
FT                   NTWPVVSSTKAIFIPPREVDGVLEFIDKKITDKLFNELVSFSNDLLTSFPSPRAGVVIN
FT                   TEEVFK"
FT   gene            704390..704758
FT                   /locus_tag="YN1551_0775"
FT   CDS_pept        704390..704758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0775"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47900"
FT                   /db_xref="GOA:C3NMT0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMT0"
FT                   /protein_id="ACP47900.1"
FT                   /translation="MEKAIHNLGKDARLHIIHILLQNRSKKELADELGITPAAITKYLK
FT                   GITHPSDEIIEKCIEVAKEDEYYEIIKIIISDITEALIELSREIDIEKIMENENVQKLK
FT                   KLLDKAFDKMLSTSPSFV"
FT   gene            complement(704735..705127)
FT                   /locus_tag="YN1551_0776"
FT   CDS_pept        complement(704735..705127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0776"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47901"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMT1"
FT                   /protein_id="ACP47901.1"
FT                   /translation="MSSVTEDNLKPNIVLLSTSDLEQEIRQLTEELKNIKDNNNEEHKK
FT                   IYAMVDNITRTLNWINIAKSQGVWKSKTCKHAINFVCQAWNISDESKLGIPSDVIVIND
FT                   DGTKRVVVSKFSEICIVCPLYEARRS"
FT   gene            705195..705890
FT                   /locus_tag="YN1551_0777"
FT   CDS_pept        705195..705890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0777"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47902"
FT                   /db_xref="InterPro:IPR018693"
FT                   /db_xref="UniProtKB/TrEMBL:C3NMT2"
FT                   /protein_id="ACP47902.1"
FT                   /translation="MVKEIYRERIKVLTDIWSLLMESWESLSREDVIEIVKNAYTKKNI
FT                   KPFRGFNADGLYEKELVSLFVVGKYGLGLFEDNKEIFDKLLSKEEDYDEISKLIIDGNV
FT                   NEAFEKSGNSKEVLARALRTTFTKIIFSFESEDKMYKSLKNLNISEKDEIKHTSRSFSR
FT                   FYTAFKLAESMAEGIVRDRLTYIATKKAIAISIGIKYPLPKADYVALIAKEVFNVNKKI
FT                   LNKILGIKV"
FT   gene            705932..706834
FT                   /locus_tag="YN1551_0778"
FT   CDS_pept        705932..706834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0778"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47903"
FT                   /db_xref="GOA:C3NF07"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR016436"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF07"
FT                   /protein_id="ACP47903.1"
FT                   /translation="MQNLSPTQREILLALTDLYNRQKRMIKSKEVADIIGKDEGTVRNI
FT                   ILSLKVLGLVESKPGPNGGYMPTLKAYEIINNPTLTPILDKLNLYKGMIETDIKVENIE
FT                   IIDITNPSANRVLLKVEGDLRKLKVGDAVRLGPTPYSRLVIEGLVLHLDENSKEIVVDV
FT                   KRMISIPKEKVKNLISKKLIALKPETSLREASMIFYKEAIRGAPVINQDEKVVGILTTA
FT                   DIIKAFFEGNYTAKVSEYMKTNVISINENEDLLDAIRKMIIYNVGRLLVLDSNNKAVGI
FT                   VTRTDILRSIAGLEGLWTS"
FT   gene            706822..707172
FT                   /locus_tag="YN1551_0779"
FT   CDS_pept        706822..707172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0779"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47904"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF08"
FT                   /protein_id="ACP47904.1"
FT                   /translation="MDILKEKCGIICNSAFYELKNISYLEHEFLCDPSDFYTIVQSKCN
FT                   GKIKAIVHTHEESCEPSYKDIISMKIWNIPWIIISKNCIKGILYSNGSILELDINSLLS
FT                   QELYNSIMKLLH"
FT   gene            complement(707089..709716)
FT                   /locus_tag="YN1551_0780"
FT   CDS_pept        complement(707089..709716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0780"
FT                   /product="DEAD/H associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47905"
FT                   /db_xref="GOA:C3NF09"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF09"
FT                   /protein_id="ACP47905.1"
FT                   /translation="MSSTYFYSDEEIYNLLRPYVVKWFKEKYTTFTPPQRAAIPLIKQN
FT                   YNVLVSSPTGSGKTLAAFLGILDSLFELGDNNELEDKVYAVYISPLRALNNDMQRNLLE
FT                   PLNELKQINPRLPDIRVGIRTSDTTPYEKQKMLKKPPHILITTPESFGISITSPKFSQK
FT                   LTDVKWVIVDEIHELANSKRGAYLSAMLELFRSLLAKKEFVRIGLSATVSPLEDVAQFL
FT                   VGKGREYRIVDARFVKPIDIKVISPVKDLVHSSESEVDKGIYKTILNEVKKHRATLIFT
FT                   NTRHATERVAYKLRKLAENEKVFDVDAIEAHHSSLSRDVRLDVEDKLKKGILKVVVSST
FT                   SLELGIDIGYIDLVVLLSSPKSVSRLLQRIGRAGHHIRSISKGRVIVVDRDDLVECSVL
FT                   AKLARDRKIDNIHIPKNPLDVLSQIIVSASLISPIDREELYNILKRSYNFSDLNESEYS
FT                   LVLRYLSGDFFGVELKNVYAKIRLKEEKIIYPKKGSRLIFYTNSGTIPDEAMISVVTEN
FT                   NRYVGNLEEEFVEILSPGDIFVLSGRTYEFIGSKGSKVIVKEAIGQRPTVPSWFSEMLP
FT                   LAYESALEVGKFRREIAEMIKKGVTHTEIIQNISKQYDIDKHSSMSIYTYILEQYLFTN
FT                   GKVPSDNLILIEIYDDEEGIRNYIFHALYGRRALDALSRAFAYVLSEELNIDVKVSVTD
FT                   NGFVLSVKRDISLDYDIKNLFEKVNPDNVYEIVTNAIMRTEMLKRRFRHCAERSFMILR
FT                   KYKGRETNLERRELNSEILLKAVREIENFPVIKETIREILEDHMDIMRAKEILRKVADH
FT                   EITIDVFGPTSIPSPFSHSIILKGHSDVVLAEDRRELMKKLHDRVIEFLRQKGVNIELE
FT                   YTSV"
FT   gene            complement(709758..711131)
FT                   /locus_tag="YN1551_0781"
FT   CDS_pept        complement(709758..711131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0781"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47906"
FT                   /db_xref="GOA:C3NF10"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF10"
FT                   /protein_id="ACP47906.1"
FT                   /translation="MLNLLLNLAIFIVPSLVVWNQIIFYIYGKNYNAVNLILHDNGINL
FT                   PKLSIIVPTKGERIDVIQGLINNIYEARWDKNKLEIIIVSDDDQAYFDKLLSTLIIPPG
FT                   LDVKIFRREKRLGYKSGALAFGLQKSTGDLILTLDVDARIEKDSLIRAYNHMVNLGCDA
FT                   VTMEWHGYSNISTSLARALMVSTVLTSRSILRGRDKLGLKVLPIGCGTIFKRNALEAVN
FT                   GWDYTMVQDDYELGTRLINRGFRICASSSPVYVEVPDNLIAFYVQQTRWAMGTMEVLSR
FT                   RFKYIVSSNIKIWQKIEIIAYLSQYIPIILTFISATVFGIAGFLGIRLSMSLSMFVIWA
FT                   ITLSVYAIIFVNSSKRSGLDTITAINALGRLSAYTVGISPFLLVGILNAFKKTRTYIVT
FT                   PKGKKAKSNIGYPILAFGIFFLLSAFLYMFRGDFLTFIWLAYYSIAFLYTFIAYIKGL"
FT   gene            complement(711124..711612)
FT                   /locus_tag="YN1551_0782"
FT   CDS_pept        complement(711124..711612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0782"
FT                   /product="ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47907"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF11"
FT                   /protein_id="ACP47907.1"
FT                   /translation="MQKIRAIKPIIVDENTHVILDGHHRFTAALRLSLPRIPVIYVNYN
FT                   STSISVSIWHRRFSKPHIVKSILSSIYSSGGICARFDSIRICDDSLYKLYWKLEKVESF
FT                   LNSIGIHVEKDMVGHLEPPSIYKEDVISIANRGLRFPPKTTRHVYEFIIPQKAILIDA"
FT   gene            complement(711653..712354)
FT                   /locus_tag="YN1551_0783"
FT   CDS_pept        complement(711653..712354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0783"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47908"
FT                   /db_xref="GOA:C3NF12"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF12"
FT                   /protein_id="ACP47908.1"
FT                   /translation="MKCAPEIVYHKLSAIYTIKEEDYIAYYVWLKTRNCFKVLVATILS
FT                   QNSTDKSALKAYLELEKKVGVTPEKLSDADLSDIENALKISGLYKTKAKRLKIISKIIL
FT                   EKYNGLIDNLLNSSNPREELLKFEGIGEKTADVVLLTCRGYEVFPIDTHITRVSKRLGI
FT                   VPMNAKYELISSTLKELFSAYDLLQLHHLLIAHGRQICKARKPLCNSCIIKECCEYYSH
FT                   RDGEARKSNTS"
FT   gene            712410..712673
FT                   /locus_tag="YN1551_0784"
FT   CDS_pept        712410..712673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0784"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47909"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF13"
FT                   /protein_id="ACP47909.1"
FT                   /translation="MYEIEMVLDAIKEGAVNPGDAVIKTGLPRYEVLALFHILEELGLI
FT                   EPVYSKGSHKAFRLTKKGEEILEGLKKGYELHVFVKPNLIQG"
FT   gene            complement(712654..713058)
FT                   /locus_tag="YN1551_0785"
FT   CDS_pept        complement(712654..713058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0785"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47910"
FT                   /db_xref="GOA:C3NF14"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF14"
FT                   /protein_id="ACP47910.1"
FT                   /translation="MKAISSIFSTLIVVMITLSLIVPLYLFFAQSYTNSSIQANSAYNN
FT                   YLTDINVKISVIYLGNSANTTFVYNYGSVPIIIDKVIVNNVSYNVKYEILTGSLVPLSS
FT                   IINSNIPVKENSTIILQINGNYYYFNLGSD"
FT   sig_peptide     complement(712963..713058)
FT                   /locus_tag="YN1551_0785"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.718 at
FT                   residue 32"
FT   gene            complement(713073..713522)
FT                   /locus_tag="YN1551_0786"
FT   CDS_pept        complement(713073..713522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0786"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47911"
FT                   /db_xref="GOA:C3NF15"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF15"
FT                   /protein_id="ACP47911.1"
FT                   /translation="MKGVYKLKKRKGLSSILGTVIVLAITLVLGGLLYAYSNGLFSSLT
FT                   QNTSLQTQLSIYVNPNTGQAYLQYYISNTGNTQIYLNSIVILNGTKNIVISLNNDLLQP
FT                   GQSIQNITSINGKITAGQYYTVEIVGNLPNGKPYSVVQNVLASIA"
FT   sig_peptide     complement(713415..713522)
FT                   /locus_tag="YN1551_0786"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.781 at
FT                   residue 36"
FT   gene            complement(713579..715090)
FT                   /locus_tag="YN1551_0787"
FT   CDS_pept        complement(713579..715090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0787"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47912"
FT                   /db_xref="GOA:C3NF16"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF16"
FT                   /protein_id="ACP47912.1"
FT                   /translation="MRQRLFEKINLFNLIATRINDNIKYYGDDIERLRKEYTRISFLIP
FT                   VISIISVIFYLKFSKYFLLLDIMNFFIYFYPLLITQIRKDEQRKIIENEIPIFLLFAYV
FT                   NSLLGKNLYKTFEEIRNSKVFKGLRREAMLLVKEVEVLGKSSFSAMESRAKVHRGDFLG
FT                   KIYTTYTSGESIGISMPERIKDLLNETIDNLNLNFGSYVEKVNELVEILFMLFLVTPMI
FT                   LLAFQYISSTINMFELIFPLLLFPIIFFYVSLIQPNIGYDIKININEIKKSLYILPIPF
FT                   IFTFLFHLNLEYEILLFYSIFIVFSFIVYRKISVADAVLNNLPYILSDIADYLRIGYSI
FT                   KSAILKLNVDSTEFKKFLGELVTKIKKNEAMSNVKTNIWIVNAILELIENIDKKGFADT
FT                   YTFKDLSLVLNNYILLRKKVLQNLRMFNILAIITPIIFYFALGVMTKIKAVGNLDLIIV
FT                   LYSIALSIMYAKISRFTIFNFPLLVLVLVNLILILFFGNVIFNLI"
FT   gene            complement(715071..716492)
FT                   /locus_tag="YN1551_0788"
FT   CDS_pept        complement(715071..716492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0788"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47913"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF17"
FT                   /protein_id="ACP47913.1"
FT                   /translation="MNILQEYSVLNAKVIIYEDNGIGYYKVSEPSLDQKEIELLNSILE
FT                   YTYSTPSISNIEETVVKILKNKGITDQGIIEKMIYYLRKRLGYDELTVPLADPYVEEVE
FT                   CKGFSYPVTVVHRIVTRFPRLYTNIVFEQEDHVLKVIEKLANKADKPVSIAKPYLEFSL
FT                   PEGHRVAATVSREVSLPGSTFDIRKFPLKPISPILLIKNVSISSLMLAYIWFLLDYKPF
FT                   FLVIGSTGSGKTTLLNSILSMVNPFFKVITIEDTPEINIVHDNWIRFFARQSISSQFEV
FT                   SLMDLARLSLRYRPDYLVIGEIRGKEIEALVHASASGHGSLATFHAGNPHEALTRLISL
FT                   LNKDVAKLFLQNLWGIIVLGTLRDRNGNIRRIIRSIYEIVYVKGKLRFKPVLKWSFSSN
FT                   TFLPNSVNDLVKKSYRINYISKTYEIPISEITEEISNRVKILDKLVNNEVLDLEDFSIY
FT                   LKKITQGGQVETKAI"
FT   gene            complement(716520..718592)
FT                   /locus_tag="YN1551_0789"
FT   CDS_pept        complement(716520..718592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YN1551_0789"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YN1551_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACP47914"
FT                   /db_xref="UniProtKB/TrEMBL:C3NF18"
FT                   /protein_id="ACP47914.1"
FT                   /translation="MVIPDFILYQKLDLNFITKFNCWLKLKDEDSVQLVCNVLRQPSVD
FT                   INEFGIRMSDNKWIFRKGNFVVMIEDDKETIIRKDENEYVVDYIMYNNNEIYPIYLKGR
FT                   KYILNGEEYEKYLSYLDKKILIGKSKLTIILGNKHLDVDRGDRVYVSRHSISIIYDNVT
FT                   KVINNKGIASYFNFKGDYLGFIQSYGNIYRSSEGIIVSSKKGNIGICIDDAYLIGEFSG
FT                   GLLILCGESLKQYYNTGWREIERTIDSEFFVNSNRNLFGILKNGKLYIFDNNFNKLFIF
FT                   DNVTSFNFNFKRIYLVSNDGTVGIATLEDNYKPIKVINRNNSIQNPIILQVDENYSHSF
FT                   NIKNGKMLDIKVVEDKKKIVLIEPFEYSKDSLEISAGNTFFSFMYTIPYTSQLPKIEFS
FT                   NAKILAADEGGALIGNPDKNALLMFNIKYSIPTRSQITFTIEALSQIYKLTTMENYGKK
FT                   SLKIPLTINNLKLSDVQVNVYAHVDDRLVASLEFLAPMEIVRKKANLNRNKIIIINNSV
FT                   EKEVAIVKNEIFEWKELFEYPLEYKGILFGKVGEKIEVDGEKIIVRDGYDLVKIVKDNG
FT                   NYIREYLLISIKNPIKSINAELKGDQLIIKLDMEPNIPFEIFYGPHSFRGISKEGNHII
FT                   FPIEPVYNSIKIRAYTQGFTWESQYDLVNIIKLSISMALSEAMAIKEVLSNFGIA"
FT   gene            complement(718640..719746)
FT                   /locus_tag="YN1551_0790"
FT   CDS_