(data stored in SCRATCH zone)

EMBL: CP001408

ID   CP001408; SV 1; circular; genomic DNA; STD; PRO; 4098576 BP.
XX
AC   CP001408;
XX
PR   Project:PRJNA29855;
XX
DT   25-MAY-2009 (Rel. 100, Created)
DT   11-DEC-2009 (Rel. 103, Last updated, Version 3)
XX
DE   Burkholderia pseudomallei MSHR346 chromosome I, complete sequence.
XX
KW   .
XX
OS   Burkholderia pseudomallei MSHR346
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; pseudomallei group.
XX
RN   [1]
RP   1-4098576
RA   Harkins D.M., Brinkac L.M., Rogers Y.C., Detter J.C., Munk A.C.,
RA   Bruce D.C., Keim P., Sims D.R., Brettin T.S.;
RT   ;
RL   Submitted (03-FEB-2009) to the INSDC.
RL   Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545, USA
XX
DR   MD5; 0ac2d21aeb7fa35d119d689df27f6280.
DR   EnsemblGenomes-Gn; EBG00001120716.
DR   EnsemblGenomes-Gn; EBG00001120717.
DR   EnsemblGenomes-Gn; EBG00001120721.
DR   EnsemblGenomes-Gn; EBG00001120725.
DR   EnsemblGenomes-Gn; EBG00001120727.
DR   EnsemblGenomes-Gn; EBG00001120728.
DR   EnsemblGenomes-Gn; EBG00001120729.
DR   EnsemblGenomes-Gn; EBG00001120731.
DR   EnsemblGenomes-Gn; EBG00001120732.
DR   EnsemblGenomes-Gn; EBG00001120734.
DR   EnsemblGenomes-Gn; EBG00001120736.
DR   EnsemblGenomes-Gn; EBG00001120737.
DR   EnsemblGenomes-Gn; EBG00001120738.
DR   EnsemblGenomes-Gn; EBG00001120739.
DR   EnsemblGenomes-Gn; EBG00001120740.
DR   EnsemblGenomes-Gn; EBG00001120741.
DR   EnsemblGenomes-Gn; EBG00001120742.
DR   EnsemblGenomes-Gn; EBG00001120743.
DR   EnsemblGenomes-Gn; EBG00001120744.
DR   EnsemblGenomes-Gn; EBG00001120745.
DR   EnsemblGenomes-Gn; EBG00001120746.
DR   EnsemblGenomes-Gn; EBG00001120747.
DR   EnsemblGenomes-Gn; EBG00001120748.
DR   EnsemblGenomes-Gn; EBG00001120749.
DR   EnsemblGenomes-Gn; EBG00001120750.
DR   EnsemblGenomes-Gn; EBG00001120751.
DR   EnsemblGenomes-Gn; EBG00001120752.
DR   EnsemblGenomes-Gn; EBG00001120753.
DR   EnsemblGenomes-Gn; EBG00001120754.
DR   EnsemblGenomes-Gn; EBG00001120755.
DR   EnsemblGenomes-Gn; EBG00001120756.
DR   EnsemblGenomes-Gn; EBG00001120757.
DR   EnsemblGenomes-Gn; EBG00001120758.
DR   EnsemblGenomes-Gn; EBG00001120759.
DR   EnsemblGenomes-Gn; EBG00001120760.
DR   EnsemblGenomes-Gn; EBG00001120761.
DR   EnsemblGenomes-Gn; EBG00001120763.
DR   EnsemblGenomes-Gn; EBG00001120765.
DR   EnsemblGenomes-Gn; EBG00001120767.
DR   EnsemblGenomes-Gn; EBG00001120768.
DR   EnsemblGenomes-Gn; EBG00001120770.
DR   EnsemblGenomes-Gn; EBG00001120772.
DR   EnsemblGenomes-Gn; EBG00001120774.
DR   EnsemblGenomes-Gn; EBG00001120776.
DR   EnsemblGenomes-Gn; EBG00001120778.
DR   EnsemblGenomes-Gn; EBG00001120780.
DR   EnsemblGenomes-Gn; EBG00001120782.
DR   EnsemblGenomes-Gn; EBG00001120784.
DR   EnsemblGenomes-Gn; EBG00001120786.
DR   EnsemblGenomes-Gn; EBG00001120788.
DR   EnsemblGenomes-Gn; EBG00001120790.
DR   EnsemblGenomes-Gn; EBG00001120792.
DR   EnsemblGenomes-Gn; EBG00001120793.
DR   EnsemblGenomes-Gn; EBG00001120795.
DR   EnsemblGenomes-Gn; EBG00001120797.
DR   EnsemblGenomes-Gn; EBG00001120799.
DR   EnsemblGenomes-Gn; EBG00001120801.
DR   EnsemblGenomes-Gn; EBG00001120803.
DR   EnsemblGenomes-Gn; EBG00001120805.
DR   EnsemblGenomes-Gn; EBG00001120807.
DR   EnsemblGenomes-Gn; EBG00001120808.
DR   EnsemblGenomes-Gn; EBG00001120809.
DR   EnsemblGenomes-Gn; EBG00001120810.
DR   EnsemblGenomes-Gn; EBG00001120812.
DR   EnsemblGenomes-Gn; EBG00001120814.
DR   EnsemblGenomes-Gn; EBG00001120816.
DR   EnsemblGenomes-Gn; EBG00001120818.
DR   EnsemblGenomes-Gn; EBG00001120819.
DR   EnsemblGenomes-Gn; EBG00001120821.
DR   EnsemblGenomes-Gn; EBG00001120823.
DR   EnsemblGenomes-Gn; EBG00001120824.
DR   EnsemblGenomes-Gn; EBG00001120825.
DR   EnsemblGenomes-Gn; EBG00001120826.
DR   EnsemblGenomes-Gn; EBG00001120827.
DR   EnsemblGenomes-Gn; EBG00001120828.
DR   EnsemblGenomes-Gn; EBG00001120829.
DR   EnsemblGenomes-Gn; EBG00001120830.
DR   EnsemblGenomes-Gn; EBG00001120831.
DR   EnsemblGenomes-Gn; EBG00001120832.
DR   EnsemblGenomes-Gn; EBG00001120833.
DR   EnsemblGenomes-Gn; EBG00001120834.
DR   EnsemblGenomes-Gn; EBG00001120835.
DR   EnsemblGenomes-Gn; EBG00001120836.
DR   EnsemblGenomes-Gn; GBP346_A0051.
DR   EnsemblGenomes-Gn; GBP346_A0071.
DR   EnsemblGenomes-Gn; GBP346_A0497.
DR   EnsemblGenomes-Gn; GBP346_A0731.
DR   EnsemblGenomes-Gn; GBP346_A1021.
DR   EnsemblGenomes-Gn; GBP346_A1153.
DR   EnsemblGenomes-Gn; GBP346_A1313.
DR   EnsemblGenomes-Gn; GBP346_A1353.
DR   EnsemblGenomes-Gn; GBP346_A1354.
DR   EnsemblGenomes-Gn; GBP346_A1355.
DR   EnsemblGenomes-Gn; GBP346_A1356.
DR   EnsemblGenomes-Gn; GBP346_A1537.
DR   EnsemblGenomes-Gn; GBP346_A1551.
DR   EnsemblGenomes-Gn; GBP346_A1755.
DR   EnsemblGenomes-Gn; GBP346_A1767.
DR   EnsemblGenomes-Gn; GBP346_A1836.
DR   EnsemblGenomes-Gn; GBP346_A1837.
DR   EnsemblGenomes-Gn; GBP346_A1852.
DR   EnsemblGenomes-Gn; GBP346_A1865.
DR   EnsemblGenomes-Gn; GBP346_A2316.
DR   EnsemblGenomes-Gn; GBP346_A2422.
DR   EnsemblGenomes-Gn; GBP346_A2430.
DR   EnsemblGenomes-Gn; GBP346_A2459.
DR   EnsemblGenomes-Gn; GBP346_A2604.
DR   EnsemblGenomes-Gn; GBP346_A2605.
DR   EnsemblGenomes-Gn; GBP346_A2606.
DR   EnsemblGenomes-Gn; GBP346_A2607.
DR   EnsemblGenomes-Gn; GBP346_A2608.
DR   EnsemblGenomes-Gn; GBP346_A2660.
DR   EnsemblGenomes-Gn; GBP346_A2801.
DR   EnsemblGenomes-Gn; GBP346_A2831.
DR   EnsemblGenomes-Gn; GBP346_A2945.
DR   EnsemblGenomes-Gn; GBP346_A2946.
DR   EnsemblGenomes-Gn; GBP346_A2947.
DR   EnsemblGenomes-Gn; GBP346_A2997.
DR   EnsemblGenomes-Gn; GBP346_A2998.
DR   EnsemblGenomes-Gn; GBP346_A3073.
DR   EnsemblGenomes-Gn; GBP346_A3130.
DR   EnsemblGenomes-Gn; GBP346_A3149.
DR   EnsemblGenomes-Gn; GBP346_A3150.
DR   EnsemblGenomes-Gn; GBP346_A3158.
DR   EnsemblGenomes-Gn; GBP346_A3176.
DR   EnsemblGenomes-Gn; GBP346_A3235.
DR   EnsemblGenomes-Gn; GBP346_A3384.
DR   EnsemblGenomes-Gn; GBP346_A3558.
DR   EnsemblGenomes-Gn; GBP346_A3677.
DR   EnsemblGenomes-Gn; GBP346_A3713.
DR   EnsemblGenomes-Gn; GBP346_A3714.
DR   EnsemblGenomes-Gn; GBP346_A3715.
DR   EnsemblGenomes-Gn; GBP346_A3716.
DR   EnsemblGenomes-Gn; GBP346_A3829.
DR   EnsemblGenomes-Gn; GBP346_A3949.
DR   EnsemblGenomes-Gn; GBP346_A3951.
DR   EnsemblGenomes-Gn; GBP346_A3952.
DR   EnsemblGenomes-Gn; GBP346_A3953.
DR   EnsemblGenomes-Gn; GBP346_A3956.
DR   EnsemblGenomes-Gn; GBP346_A3957.
DR   EnsemblGenomes-Gn; GBP346_A3958.
DR   EnsemblGenomes-Gn; GBP346_A3959.
DR   EnsemblGenomes-Gn; GBP346_A4001.
DR   EnsemblGenomes-Gn; GBP346_A4087.
DR   EnsemblGenomes-Gn; GBP346_A4279.
DR   EnsemblGenomes-Gn; GBP346_A4280.
DR   EnsemblGenomes-Gn; GBP346_A4281.
DR   EnsemblGenomes-Gn; GBP346_A4282.
DR   EnsemblGenomes-Tr; EBT00001712356.
DR   EnsemblGenomes-Tr; EBT00001712357.
DR   EnsemblGenomes-Tr; EBT00001712358.
DR   EnsemblGenomes-Tr; EBT00001712359.
DR   EnsemblGenomes-Tr; EBT00001712360.
DR   EnsemblGenomes-Tr; EBT00001712361.
DR   EnsemblGenomes-Tr; EBT00001712362.
DR   EnsemblGenomes-Tr; EBT00001712363.
DR   EnsemblGenomes-Tr; EBT00001712364.
DR   EnsemblGenomes-Tr; EBT00001712365.
DR   EnsemblGenomes-Tr; EBT00001712366.
DR   EnsemblGenomes-Tr; EBT00001712367.
DR   EnsemblGenomes-Tr; EBT00001712368.
DR   EnsemblGenomes-Tr; EBT00001712369.
DR   EnsemblGenomes-Tr; EBT00001712370.
DR   EnsemblGenomes-Tr; EBT00001712371.
DR   EnsemblGenomes-Tr; EBT00001712372.
DR   EnsemblGenomes-Tr; EBT00001712373.
DR   EnsemblGenomes-Tr; EBT00001712374.
DR   EnsemblGenomes-Tr; EBT00001712375.
DR   EnsemblGenomes-Tr; EBT00001712376.
DR   EnsemblGenomes-Tr; EBT00001712377.
DR   EnsemblGenomes-Tr; EBT00001712378.
DR   EnsemblGenomes-Tr; EBT00001712379.
DR   EnsemblGenomes-Tr; EBT00001712380.
DR   EnsemblGenomes-Tr; EBT00001712381.
DR   EnsemblGenomes-Tr; EBT00001712382.
DR   EnsemblGenomes-Tr; EBT00001712383.
DR   EnsemblGenomes-Tr; EBT00001712384.
DR   EnsemblGenomes-Tr; EBT00001712385.
DR   EnsemblGenomes-Tr; EBT00001712386.
DR   EnsemblGenomes-Tr; EBT00001712387.
DR   EnsemblGenomes-Tr; EBT00001712388.
DR   EnsemblGenomes-Tr; EBT00001712389.
DR   EnsemblGenomes-Tr; EBT00001712390.
DR   EnsemblGenomes-Tr; EBT00001712391.
DR   EnsemblGenomes-Tr; EBT00001712392.
DR   EnsemblGenomes-Tr; EBT00001712393.
DR   EnsemblGenomes-Tr; EBT00001712394.
DR   EnsemblGenomes-Tr; EBT00001712395.
DR   EnsemblGenomes-Tr; EBT00001712396.
DR   EnsemblGenomes-Tr; EBT00001712397.
DR   EnsemblGenomes-Tr; EBT00001712398.
DR   EnsemblGenomes-Tr; EBT00001712399.
DR   EnsemblGenomes-Tr; EBT00001712400.
DR   EnsemblGenomes-Tr; EBT00001712401.
DR   EnsemblGenomes-Tr; EBT00001712402.
DR   EnsemblGenomes-Tr; EBT00001712403.
DR   EnsemblGenomes-Tr; EBT00001712404.
DR   EnsemblGenomes-Tr; EBT00001712405.
DR   EnsemblGenomes-Tr; EBT00001712406.
DR   EnsemblGenomes-Tr; EBT00001712407.
DR   EnsemblGenomes-Tr; EBT00001712408.
DR   EnsemblGenomes-Tr; EBT00001712409.
DR   EnsemblGenomes-Tr; EBT00001712410.
DR   EnsemblGenomes-Tr; EBT00001712411.
DR   EnsemblGenomes-Tr; EBT00001712412.
DR   EnsemblGenomes-Tr; EBT00001712413.
DR   EnsemblGenomes-Tr; EBT00001712414.
DR   EnsemblGenomes-Tr; EBT00001712415.
DR   EnsemblGenomes-Tr; EBT00001712416.
DR   EnsemblGenomes-Tr; EBT00001712417.
DR   EnsemblGenomes-Tr; EBT00001712418.
DR   EnsemblGenomes-Tr; EBT00001712419.
DR   EnsemblGenomes-Tr; EBT00001712420.
DR   EnsemblGenomes-Tr; EBT00001712421.
DR   EnsemblGenomes-Tr; EBT00001712422.
DR   EnsemblGenomes-Tr; EBT00001712423.
DR   EnsemblGenomes-Tr; EBT00001712424.
DR   EnsemblGenomes-Tr; EBT00001712425.
DR   EnsemblGenomes-Tr; EBT00001712426.
DR   EnsemblGenomes-Tr; EBT00001712427.
DR   EnsemblGenomes-Tr; EBT00001712428.
DR   EnsemblGenomes-Tr; EBT00001712429.
DR   EnsemblGenomes-Tr; EBT00001712430.
DR   EnsemblGenomes-Tr; EBT00001712431.
DR   EnsemblGenomes-Tr; EBT00001712432.
DR   EnsemblGenomes-Tr; EBT00001712433.
DR   EnsemblGenomes-Tr; EBT00001712434.
DR   EnsemblGenomes-Tr; EBT00001712435.
DR   EnsemblGenomes-Tr; EBT00001712436.
DR   EnsemblGenomes-Tr; EBT00001712437.
DR   EnsemblGenomes-Tr; EBT00001712438.
DR   EnsemblGenomes-Tr; GBP346_A0051-1.
DR   EnsemblGenomes-Tr; GBP346_A0071-1.
DR   EnsemblGenomes-Tr; GBP346_A0497-1.
DR   EnsemblGenomes-Tr; GBP346_A0731-1.
DR   EnsemblGenomes-Tr; GBP346_A1021-1.
DR   EnsemblGenomes-Tr; GBP346_A1153-1.
DR   EnsemblGenomes-Tr; GBP346_A1313-1.
DR   EnsemblGenomes-Tr; GBP346_A1353-1.
DR   EnsemblGenomes-Tr; GBP346_A1354-1.
DR   EnsemblGenomes-Tr; GBP346_A1355-1.
DR   EnsemblGenomes-Tr; GBP346_A1356-1.
DR   EnsemblGenomes-Tr; GBP346_A1537-1.
DR   EnsemblGenomes-Tr; GBP346_A1551-1.
DR   EnsemblGenomes-Tr; GBP346_A1755-1.
DR   EnsemblGenomes-Tr; GBP346_A1767-1.
DR   EnsemblGenomes-Tr; GBP346_A1836-1.
DR   EnsemblGenomes-Tr; GBP346_A1837-1.
DR   EnsemblGenomes-Tr; GBP346_A1852-1.
DR   EnsemblGenomes-Tr; GBP346_A1865-1.
DR   EnsemblGenomes-Tr; GBP346_A2316-1.
DR   EnsemblGenomes-Tr; GBP346_A2422-1.
DR   EnsemblGenomes-Tr; GBP346_A2430-1.
DR   EnsemblGenomes-Tr; GBP346_A2459-1.
DR   EnsemblGenomes-Tr; GBP346_A2604-1.
DR   EnsemblGenomes-Tr; GBP346_A2605-1.
DR   EnsemblGenomes-Tr; GBP346_A2606-1.
DR   EnsemblGenomes-Tr; GBP346_A2607-1.
DR   EnsemblGenomes-Tr; GBP346_A2608-1.
DR   EnsemblGenomes-Tr; GBP346_A2660-1.
DR   EnsemblGenomes-Tr; GBP346_A2801-1.
DR   EnsemblGenomes-Tr; GBP346_A2831-1.
DR   EnsemblGenomes-Tr; GBP346_A2945-1.
DR   EnsemblGenomes-Tr; GBP346_A2946-1.
DR   EnsemblGenomes-Tr; GBP346_A2947-1.
DR   EnsemblGenomes-Tr; GBP346_A2997-1.
DR   EnsemblGenomes-Tr; GBP346_A2998-1.
DR   EnsemblGenomes-Tr; GBP346_A3073-1.
DR   EnsemblGenomes-Tr; GBP346_A3130-1.
DR   EnsemblGenomes-Tr; GBP346_A3149-1.
DR   EnsemblGenomes-Tr; GBP346_A3150-1.
DR   EnsemblGenomes-Tr; GBP346_A3158-1.
DR   EnsemblGenomes-Tr; GBP346_A3176-1.
DR   EnsemblGenomes-Tr; GBP346_A3235-1.
DR   EnsemblGenomes-Tr; GBP346_A3384-1.
DR   EnsemblGenomes-Tr; GBP346_A3558-1.
DR   EnsemblGenomes-Tr; GBP346_A3677-1.
DR   EnsemblGenomes-Tr; GBP346_A3713-1.
DR   EnsemblGenomes-Tr; GBP346_A3714-1.
DR   EnsemblGenomes-Tr; GBP346_A3715-1.
DR   EnsemblGenomes-Tr; GBP346_A3716-1.
DR   EnsemblGenomes-Tr; GBP346_A3829-1.
DR   EnsemblGenomes-Tr; GBP346_A3949-1.
DR   EnsemblGenomes-Tr; GBP346_A3951-1.
DR   EnsemblGenomes-Tr; GBP346_A3952-1.
DR   EnsemblGenomes-Tr; GBP346_A3953-1.
DR   EnsemblGenomes-Tr; GBP346_A3956-1.
DR   EnsemblGenomes-Tr; GBP346_A3957-1.
DR   EnsemblGenomes-Tr; GBP346_A3958-1.
DR   EnsemblGenomes-Tr; GBP346_A3959-1.
DR   EnsemblGenomes-Tr; GBP346_A4001-1.
DR   EnsemblGenomes-Tr; GBP346_A4087-1.
DR   EnsemblGenomes-Tr; GBP346_A4279-1.
DR   EnsemblGenomes-Tr; GBP346_A4280-1.
DR   EnsemblGenomes-Tr; GBP346_A4281-1.
DR   EnsemblGenomes-Tr; GBP346_A4282-1.
DR   EuropePMC; PMC2789088; 19941653.
DR   EuropePMC; PMC3515745; 23227305.
DR   EuropePMC; PMC3680066; 23682954.
DR   EuropePMC; PMC4029289; 24883196.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001408.
DR   SILVA-SSU; CP001408.
XX
CC   The Burkholderia pseudomallei MSHR346 strain was isolated from
CC   sputum of a melioidosis patient who was admitted to the Royal
CC   Darwin Hospital, Northern Territory, Australia in 1995.  The
CC   authors are from Los Alamos National Laboratory, J. Craig Venter
CC   Institute and Joint Genome Institute.  The authors wish to
CC   acknowledge the Intelligence Technology Innovation Center for
CC   funding the sequencing and the NIH/NIAID for funding the annotation
CC   at Pathema Bioinformatics Resource Center.  Source DNA is available
CC   from Paul Keim (Paul.Keim@nau.edu) at Northern Arizona University.
CC   Genome coverage: 10X
CC   Sequencing technology: ABI
CC   Chromosome II of this genome has been deposited under the Whole
CC   Genome Shotgun project accession ACOJ00000000
CC   The NIAID funded Bioinformatics Resource Center PathoSystems
CC   Resource Integration Center (PATRIC; http://patricbrc.vbi.vt.edu/
CC   ) is responsible for annotation
CC   updates of this record.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4098576
FT                   /organism="Burkholderia pseudomallei MSHR346"
FT                   /chromosome="I"
FT                   /strain="MSHR346"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /isolation_source="sputum of a melioidosis patient admitted
FT                   to Royal Darwin Hospital, Norther Territory, Australia"
FT                   /collection_date="1995"
FT                   /db_xref="taxon:536230"
FT   gene            complement(<1..162)
FT                   /locus_tag="GBP346_A0001"
FT   CDS_pept        complement(<1..162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98538"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM12"
FT                   /protein_id="ACQ98538.1"
FT                   /translation="MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDAAANTLSIAAP
FT                   NRFKLDWVK"
FT   gene            608..742
FT                   /gene="rpmH"
FT                   /locus_tag="GBP346_A0002"
FT   CDS_pept        608..742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="GBP346_A0002"
FT                   /product="ribosomal protein L34"
FT                   /note="identified by match to protein family HMM PF00468;
FT                   match to protein family HMM TIGR01030"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97969"
FT                   /db_xref="GOA:C4KM13"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM13"
FT                   /protein_id="ACQ97969.1"
FT                   /translation="MKRTYQPSVTRRKRTHGFRVRMKTAGGRKVINARRAKGRKRLAI"
FT   gene            759..1226
FT                   /locus_tag="GBP346_A0003"
FT   CDS_pept        759..1226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0003"
FT                   /product="ribonuclease P"
FT                   /note="identified by match to protein family HMM PF00825;
FT                   match to protein family HMM TIGR00188"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97401"
FT                   /db_xref="GOA:C4KM14"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM14"
FT                   /protein_id="ACQ97401.1"
FT                   /translation="MSAVRSDAGEAAAVRGSIPLQASAAFPKAARLLKTDEFSSVFRLR
FT                   PWRRTAHFVIYGKPTGRDARLGLVIGKKYAARAVTRNLVKRLAREAFRMRRAEFAGWDI
FT                   LLRLHARFDKKAMPSAASAPLAALCAGEIRELLDRAAREVARRNGAEPASE"
FT   gene            1306..1575
FT                   /locus_tag="GBP346_A0004"
FT   CDS_pept        1306..1575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01809;
FT                   match to protein family HMM TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96624"
FT                   /db_xref="GOA:C4KM15"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM15"
FT                   /protein_id="ACQ96624.1"
FT                   /translation="MQTVLIALLRFYKLAVSPLLGSRCRFYPSCSDYAREAIQYHGAAR
FT                   GTYLAARRLCRCHPFSAGGVDLVPPPNSDARNAPHEAEASSHRL"
FT   gene            1584..3260
FT                   /locus_tag="GBP346_A0005"
FT   CDS_pept        1584..3260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0005"
FT                   /product="inner membrane protein OxaA"
FT                   /note="identified by match to protein family HMM PF02096;
FT                   match to protein family HMM TIGR03592; match to protein
FT                   family HMM TIGR03593"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96279"
FT                   /db_xref="GOA:C4KM16"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM16"
FT                   /protein_id="ACQ96279.1"
FT                   /translation="MDIKRTVLWVIFFMSAVMLFDNWQRSHGRPSMFFPNVTQTNTASN
FT                   ATNGNGASGASAAAAANALPAAATGAAPATTAPAAQAQLVRFSTDVYNGEIDTRGGTLA
FT                   KLTLTKAGDGKQPDLSVTLFDHTANHTYLARTGLLGGDFPNHNDVYAQVAGPTSLAADQ
FT                   NTLKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIENVGAAPVTPSVYMELVRDNSSV
FT                   ETPMFSHTFLGPAVYTDQKHFQKITFGDIDKNKADYVTSADNGWIAMVQHYFASAWIPQ
FT                   SGAKRDIYVEKIDPTLYRVGVKQPVAAIAPGQSADVSARLFAGPEEERMLEGIAPGLEL
FT                   VKDYGWVTIIAKPLFWLLEKIHGFVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKE
FT                   ITPRMQALRERFKSDPQKMNAALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASV
FT                   EMRGAPWVLWIHDLSQRDPYFILPVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSV
FT                   MFFFFPAGLVLYYVVNNVLSIAQQYYITRTLGGAAAKKKAS"
FT   gene            complement(3417..3878)
FT                   /locus_tag="GBP346_A0006"
FT   CDS_pept        complement(3417..3878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95437"
FT                   /db_xref="GOA:C4KM17"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM17"
FT                   /protein_id="ACQ95437.1"
FT                   /translation="MVVFLAAVELHNLAMPTHEEKAAFTERLKFALLRSPEKVTGATEL
FT                   ALHFNLRHHGEHPVSPQTAHKWLTGRTIPTPDKLHTLAEWLRVDLHWLHYGPPPSAART
FT                   TPQPLPRDEKYPPTPETIELASKIEALSPHHRYLVQELIEQFYGDTSKR"
FT   gene            3708..3893
FT                   /locus_tag="GBP346_A0007"
FT   CDS_pept        3708..3893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95116"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM18"
FT                   /protein_id="ACQ95116.1"
FT                   /translation="MLAVMTQIEMQSEFRRAGHFFWTAQQGEFETFGERRFFFVCRHGQ
FT                   IVQFDRCQEDNQSGYV"
FT   gene            complement(4015..4149)
FT                   /locus_tag="GBP346_A0008"
FT   CDS_pept        complement(4015..4149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98492"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM19"
FT                   /protein_id="ACQ98492.1"
FT                   /translation="MEIKETADILECRIVARPRNSIAQTTFQPAIFRNFLFILVALIN"
FT   gene            4174..5577
FT                   /gene="trmE"
FT                   /locus_tag="GBP346_A0009"
FT   CDS_pept        4174..5577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="GBP346_A0009"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00450"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97921"
FT                   /db_xref="GOA:C4KM20"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM20"
FT                   /protein_id="ACQ97921.1"
FT                   /translation="MLATDSDPIVAIATASGRGGIGVVRLSLGRAGEAAARALSDALCG
FT                   ARLMPRHASYVPFLDGAGEPLDRGIALYFPAPHSYTGEHVIELQGHGGPIVLQLLLQRC
FT                   LDAGRAHGLRLAEPGEFTRRAFLNDKLDLAQAEAVADLIEASTEAAARSAGRSLDGAFS
FT                   RDIHALVDDVIALRMLVEATLDFPEEEIDFLEAADARGKLAHIRERLAHVLGDARQGAL
FT                   LREGLSVVLAGQPNVGKSSLLNALAGAELAIVTPIAGTTRDKVAQTIQIEGIPLHIIDT
FT                   AGLRETEDEVEKIGIARTWGEIERADVVLHLLDARSGLGPGDEAIAARFPDGVPVVRVL
FT                   NKTDLTGAPASVTRTGGGAARADVCEVRLSAKRGDGIDLLRGELLRIAGWQAGAESVYL
FT                   ARERHLIALRAAQAHLARAAEHAEQNAQALDLFAEELRLAQERLNSITGEFTSDDLLGV
FT                   IFSRFCIGK"
FT   gene            5746..6975
FT                   /locus_tag="GBP346_A0010"
FT   CDS_pept        5746..6975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0010"
FT                   /product="integrase or site-specific recombinase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97451"
FT                   /db_xref="GOA:C4KM21"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM21"
FT                   /protein_id="ACQ97451.1"
FT                   /translation="MPKISTPLNDTRIKALKPKAARYTVSDGGGLVLEVMTSGSKFWRY
FT                   RYSLHGKQQPVVTIGEYPAVSLTAARERARRYAEIVAGGVSPVADARKDRGAVKSLDTI
FT                   HEFAEYWIEQQMMGKSAEYLRTTRRALEKDIYPAIGGKSVSDVTPGDVLAICDRIKKRG
FT                   APKMALSTRNILKRIYEYAIARQLVTSNPAQAIVARFVATQASRDRVLSPNEIGRVLRA
FT                   VYASSIRRPLKLAIHLLVLTMVRKSELIEARWDEFDLDASIWRIPAERMKKDREHWVYL
FT                   APQAVAMLRELHAIRTSHQYVFPSSRGADRPIAKSTLNQAVRALDMDVQHFVLHDFRRT
FT                   ASTHLHEMGQPSDAIEKALAHSIKGIKGVYNRAEYADERRRITALWADFVDAQIDEGRK
FT                   VVIGKFGSAA"
FT   gene            complement(7624..10476)
FT                   /locus_tag="GBP346_A0011"
FT   CDS_pept        complement(7624..10476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0011"
FT                   /product="primase C 2 (PriCT-2) family"
FT                   /note="identified by match to protein family HMM PF08707"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96884"
FT                   /db_xref="GOA:C4KM22"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="InterPro:IPR014819"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM22"
FT                   /protein_id="ACQ96884.1"
FT                   /translation="MSEFERASVALGYVPADDRDTWRQAGMALKAEFGEEGFTLWNEWS
FT                   QGAQNYNARDARDVWKSFKGGKITINTLFHLAKQGGFDPRAHRAKSIDPAQRERQHAER
FT                   AAREAAELATLTEKQQAASALAESIWSAAEPAPVDHPYLVRKRIPADALRVYRGNLSIG
FT                   TAACDRALVIPARDADGTLRTLEFILTDGQKRYLPNGRKAGCFSLIGDAVSSVLLIGEG
FT                   YATCATLAAATGYPVAVAFDTGNLHAVATALRGRYPDARIVVCADDDHTTNGNPGVTKA
FT                   RAAADAVGGAVAVPDFGPNRPAAGTDFNNLAAHLGPDAVAVAVRAALTSAGSSDADRGK
FT                   ARSPVAKPAKRPKTARAQDGKSRFVVDDKGVWFHGFNNQGDPLPPHWVSTRIDVIAETR
FT                   NEMNSEWGYLLEFTDRDGILKRWAVPAGLFAGDGTELRRMLLDMGVKLGVTQIARTQIA
FT                   NYIQMAQPDERVRCVPRVGWHHGAFVLPDRVIGTGKEALIYQADTPIQSQFKERGTLED
FT                   WRREVAAYCVGNSRLAFCVATAFAGPLLHFSGLQSGGFHLLGTTSKGKSTGGVIAASVF
FT                   GSPDYVRSWKATDNALEAVATQHSDALLILDEIGQVEPRLVGDVIYMLANESGKARASR
FT                   SGSAKPVLTWRLLFLSNGEKSVSALMAEGNKPMKGGIEVRLPAIPAEVGEMGVVEKLHG
FT                   FPTPAALIEHLERHAGMHYGTAGPAFIEWASSQAGELAEHLRIRVDELVGQWVPDGSHS
FT                   QVARVAKRFCLVAVAGELATAHGLTGWPQGEAVEAARRCFEGWLELRGGTGNSDEAEAV
FT                   RQVQHFLAAHGDNRFVWMNRAQDDHRPNVPHRAGFKQHVKRDERRTPIASDREYYAEFG
FT                   GKMSADDAESVETEYLIEAAVFRKDVCAGFDHKIVAKALMKRGVLMPRSDGYPYRQEYI
FT                   PGHGKFMVYRVLPSIFTLEL"
FT   gene            complement(10616..10957)
FT                   /locus_tag="GBP346_A0012"
FT   CDS_pept        complement(10616..10957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97841"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM23"
FT                   /protein_id="ACQ97841.1"
FT                   /translation="MSQYVRTAVIEGFDNAPPLDTNAPIELQFAVDLGAVCADAWLELK
FT                   GEVRLHDYAAFQVDAFVRGLNASMHDNGDIDTHHVTVSGHAFVAGLMGRVQQHLFAALG
FT                   VTRYPRTTH"
FT   gene            complement(10954..11211)
FT                   /locus_tag="GBP346_A0013"
FT   CDS_pept        complement(10954..11211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM24"
FT                   /protein_id="ACQ97249.1"
FT                   /translation="MADALSIHMNDGRRIEFAGALALSHFVASRAMHLESLLLAFADDG
FT                   FTMFQEMNAGARLNLLWLVQGMASELRELAFAMTDIGDTQ"
FT   gene            complement(11204..11380)
FT                   /locus_tag="GBP346_A0014"
FT   CDS_pept        complement(11204..11380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95002"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM25"
FT                   /protein_id="ACQ95002.1"
FT                   /translation="MRQPTHAHSGRNVPLIHSIIRAALREAATADTYQTALDATGAALV
FT                   AIAALVRAEVRHG"
FT   gene            complement(11748..12227)
FT                   /locus_tag="GBP346_A0015"
FT   CDS_pept        complement(11748..12227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98854"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM26"
FT                   /protein_id="ACQ98854.1"
FT                   /translation="MTVNLTQACECMSTQPSVNARRAWLDACAAFEDARVTCGNPDLLR
FT                   MAAFLERVATALWASDSRACHLAAIHATQIARLLVAPGTLSPASRIVLASELEGASLDL
FT                   GDALDDASRPLADPTVQQIDAITGVLWSSGNDERARAAVRLQRIAVMLVESGLSA"
FT   gene            complement(12227..12367)
FT                   /locus_tag="GBP346_A0016"
FT   CDS_pept        complement(12227..12367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0016"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96511"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM27"
FT                   /protein_id="ACQ96511.1"
FT                   /translation="MEGRFPRASRLTQRCTVWSNRELHRWMADPLNYRAVDAANQTTEG
FT                   A"
FT   gene            complement(12620..13141)
FT                   /locus_tag="GBP346_A0017"
FT   CDS_pept        complement(12620..13141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95602"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM28"
FT                   /protein_id="ACQ95602.1"
FT                   /translation="MEDIIPRNVPVGEAMALLAGLLVKCIDEDDFRTAQELMKHELFNS
FT                   RTLEGVVLYARRKTESALLERIDALHEQIAERAEEHEMSRAHLALLEAEQRERQEQAKL
FT                   ERQKAIKPAQAARLSKAKNTKIIEEFNRRRRNGEDFQGRNVCSDIAARFGVTADHVRKL
FT                   KRAWLAGLNR"
FT   gene            complement(13549..14523)
FT                   /locus_tag="GBP346_A0018"
FT   CDS_pept        complement(13549..14523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97905"
FT                   /db_xref="InterPro:IPR014513"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM29"
FT                   /protein_id="ACQ97905.1"
FT                   /translation="MTGIVPLPKLFMIDTLQKNVLEVPVDRPVEALTIALLRDVKHACA
FT                   QLGAKFVLAGATARDILMWHLHDIRAPVATRDVDVAVCAVSWESHDALIELLVQTQRFR
FT                   RHSKQQQKLLFKRSAEDYEGELDIVPFGQIEGPPGEIHWPPDGDIVMTVLGFQEAVDTA
FT                   QPVSIGEGLVVPVVTLPAFVLLKLIAWKDRRLTKNTDSADLLFVLRNYIDAGNIERTYE
FT                   QATDLLKAANFDAGLAAAGLLGRDVRGLAYPDTRAALRALLQSADAYETLRLDLQARAA
FT                   MLLGGFIDDSDALLAAFARELLTEENGSRNGTGPQVGSTGARA"
FT   gene            14426..14539
FT                   /locus_tag="GBP346_A0019"
FT   CDS_pept        14426..14539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97453"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM30"
FT                   /protein_id="ACQ97453.1"
FT                   /translation="MSASTGRSTGTSSTFFCKVSIINSLGNGTIPVIARCD"
FT   gene            complement(15586..15714)
FT                   /locus_tag="GBP346_A0020"
FT   CDS_pept        complement(15586..15714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0020"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98395"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM31"
FT                   /protein_id="ACQ98395.1"
FT                   /translation="MYVFWGRNEKTYSNTSRIAGHNHRGFSVCLYVILNLYVFCVH"
FT   gene            complement(15987..16127)
FT                   /locus_tag="GBP346_A0021"
FT   CDS_pept        complement(15987..16127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98847"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM32"
FT                   /protein_id="ACQ98847.1"
FT                   /translation="MPCFRTYPNTHVRKGTVSDTMNPEQPIWIAEILKLVNGASFDSGW
FT                   K"
FT   gene            16189..16644
FT                   /locus_tag="GBP346_A0022"
FT   CDS_pept        16189..16644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0022"
FT                   /product="resolvase, N domain protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97442"
FT                   /db_xref="GOA:C4KM33"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM33"
FT                   /protein_id="ACQ97442.1"
FT                   /translation="MSRTFAYARVSTTDQTAANQLREIEVVGFSVDKRRVVMESISGSV
FT                   SANQRPGFAELLLKMEEGDVLIVTKLDRLGRNAMDVRATVETLADRGIRIHCLALGGVD
FT                   LTSAAGRMTMQVLNAVAEFERDLLIERTHAGIARAKAEGKTMGRPPR"
FT   gene            complement(16791..16979)
FT                   /locus_tag="GBP346_A0023"
FT   CDS_pept        complement(16791..16979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97929"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM34"
FT                   /protein_id="ACQ97929.1"
FT                   /translation="MLDRWIAKKYLSGSWRSDKAKFSRLFLMFSYPEENQFGGDVAKAY
FT                   KSIQPSIVARMKDGKNK"
FT   gene            complement(17629..19329)
FT                   /locus_tag="GBP346_A0024"
FT   CDS_pept        complement(17629..19329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96567"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM35"
FT                   /protein_id="ACQ96567.1"
FT                   /translation="MKTMAQISEQELVSIFEERAENLSKDELETWTCLSVAEQQVLSKL
FT                   KGPGAKLLSGPRGSGKSTLLRRAYYELCRDETALPIYVNYSRALALEPLFQSRANALEL
FT                   FRQWVFAKLLLGIGETDNDLTLNLDNATRDLIRKASTFVGAMEAGKTPEAAPFAVGPSQ
FT                   MLALLGDLADNIGVTRAVLLLDDAAHAFSFRQQQAFFEIFRELRSRRVSAKAAIYPGIT
FT                   SFSPNFHVGHEAEVLEAWLQPESPSYLDTMRDIAALRVPEHLLALLGPSRQEYIDLLAL
FT                   ASFGLPRGFLNMLSNVIDEAQKGAGSSLRKIVLDAVSAHAESVEAIFHNLALKLPRFLH
FT                   YINIGEELHSKALNVVRTFNAGKSTSHKAVVVALGIPFTNELEKILKMLEYSGLLRKQS
FT                   DLSKGVKGQYQRYAMHYASLIATTSLALGRSYKISDLIDSLQNRTAHALVKVKVETLIG
FT                   KDYAERCILALPPCAKCGTPRVSENQRFCMHCGAELANASVYSELLKAPIDKLPLPQAK
FT                   IEAIKLNTSIRSIQDLITDDEQSLRRQGSYIGPVWSKRIKTVAEEFLSV"
FT   gene            complement(20317..21051)
FT                   /locus_tag="GBP346_A0025"
FT   CDS_pept        complement(20317..21051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96142"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM36"
FT                   /protein_id="ACQ96142.1"
FT                   /translation="MEQDGTYGYEPALSEDDVRSGKATKPLVMMRYVGRRDGTYVLLLI
FT                   DPDNENYATRVTCQAPCNFAKLQTMSGTMVLKTETIRVAPNSLIGAMLDDALSGQLRPY
FT                   GQTVTMPRPMAVPSADIPAMASAQAAVQSTAQPADQSAPQDSSPQSDLQRTSFDCSKVG
FT                   SIPEYLICHDPELAASDRELANIYQQAKDAVPDKAAFAARTRRQWNFRQRNCRDKPCLV
FT                   SWYAYQKETLTKIAQTGDVNAQ"
FT   gene            21617..22774
FT                   /locus_tag="GBP346_A0026"
FT   CDS_pept        21617..22774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0026"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96599"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM37"
FT                   /protein_id="ACQ96599.1"
FT                   /translation="MKTIWKFFGLAAAVSVLLAGCGGGGDNSGQTGTLHVAMTDAPSCG
FT                   FDHIYVTVAKVRVNMSAQAGDNDSGWTDVALAAPQKVDLLSLTNGVLADLGQNALPAGQ
FT                   YQQVRLVLAQNQGNTLANSIVPTGGTEQPLATPSATQSGYKIITPFTVQPNTLVDLVLD
FT                   FNACKSIVQRGNGTYALKPVVTATPTVVSGAIDGYVSPTEAGATVYAEQNGHVIKGTLA
FT                   DSTGHFVLTPLVQSSTNGNYDIVITQNNVSTGIVRSVPVVVNTTTSVSTSSAPITLPAS
FT                   TMNMVSGTATASADAILRALQMVNSLPYEIASTNANLDTGAYALTLPTAAPIVGTYSGS
FT                   LPVAMSAAPSAAGQYTIEADAANGATQQQPANITAGSVSNVNFGF"
FT   gene            22837..22992
FT                   /locus_tag="GBP346_A0027"
FT   CDS_pept        22837..22992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0027"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95242"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM38"
FT                   /protein_id="ACQ95242.1"
FT                   /translation="MKKIIIALAASAGILSGCAVYVPDQPGVIMAPQGGPGNGFCPPGQ
FT                   AKKGNC"
FT   gene            complement(23340..23510)
FT                   /locus_tag="GBP346_A0028"
FT   CDS_pept        complement(23340..23510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM39"
FT                   /protein_id="ACQ95710.1"
FT                   /translation="MIEQVILGVFLVLPLLIVAVLYSDELWQEHRLQHPRDEHTPHIDW
FT                   RHPWRILRRGH"
FT   gene            23672..24232
FT                   /gene="speG"
FT                   /locus_tag="GBP346_A0029"
FT   CDS_pept        23672..24232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="GBP346_A0029"
FT                   /product="diamine N-acetyltransferase"
FT                   /EC_number="2.3.1.57"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98495"
FT                   /db_xref="GOA:C4KM40"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM40"
FT                   /protein_id="ACQ98495.1"
FT                   /translation="MQIQNEQHTLALRPLERQDLRFVHELNNDAKIMRYWFEEPYETFT
FT                   ELSQLYDQHVHDQRERRFVAFDSDGELVGLVELIELDYIHRRGEFQIIIAPNRQGRGFA
FT                   TRATRLAVEYAFKVLNLRKLYLIVDKSNVAAIRVYEKCGFKHEAELIEEFFGNGQYHNA
FT                   LRMCIFQRDYFAAQPGAELHARE"
FT   gene            24244..24477
FT                   /locus_tag="GBP346_A0030"
FT   CDS_pept        24244..24477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95804"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM41"
FT                   /protein_id="ACQ95804.1"
FT                   /translation="MHAGAPRRPGDAGIATGRMPGANAPGIFFVFGRSKGFPCGGAIFL
FT                   DDFMCGASNRWAAAFELPGRFIVEKRRQSKGL"
FT   gene            24719..25066
FT                   /locus_tag="GBP346_A0031"
FT   CDS_pept        24719..25066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96540"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM42"
FT                   /protein_id="ACQ96540.1"
FT                   /translation="MLKRTGLFLALAGSIVAFSVAQANGDASLKPQQEIQLTKNAWGCL
FT                   SKDNLDSVLNHERDGKAQAKQQYFDDYRCLSVPEGQRFRVVSVDKGDVQFVSAENSDQQ
FT                   GLWTDARFIKQ"
FT   gene            25282..25836
FT                   /locus_tag="GBP346_A0032"
FT   CDS_pept        25282..25836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0032"
FT                   /product="YaeQ protein"
FT                   /note="identified by match to protein family HMM PF07152"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96995"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM43"
FT                   /protein_id="ACQ96995.1"
FT                   /translation="MALKSTIYKAELQIADMDRHYYADHSLTVARHPSETDERMMVRIA
FT                   AFALFAHERLEFCKGLSDTDEPDLWQKDLTGAIEVWVDVGQPDERRIAKASGRAGRVNV
FT                   IAYGGRTSDIWWQGARGKVERLRNVQVTTLADGVAAALGGLAERTMRLQCTIQDGAAWL
FT                   SSATHDPVAIEWTTLKAREDA"
FT   gene            complement(26020..26436)
FT                   /locus_tag="GBP346_A0033"
FT   CDS_pept        complement(26020..26436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0033"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97822"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM44"
FT                   /protein_id="ACQ97822.1"
FT                   /translation="MKFHIHEIDHVVLRAADLAAMTRFYCDVLGCHVEKEQRELGLVQL
FT                   RAGRSLIDLLAVGAPIDRAGSGAPGKGRNMDHLCLRVEPFDAAALRTHLAAHGARPGDE
FT                   ARRYGADGYGPSLYLFDPEGNMVELKGPPEAVAP"
FT   gene            26838..27932
FT                   /locus_tag="GBP346_A0034"
FT   CDS_pept        26838..27932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0034"
FT                   /product="regulatory protein ada (Regulatory protein of
FT                   adaptative response)"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01035; match to protein
FT                   family HMM PF02805; match to protein family HMM PF02870;
FT                   match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98133"
FT                   /db_xref="GOA:C4KM45"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM45"
FT                   /protein_id="ACQ98133.1"
FT                   /translation="MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASR
FT                   LPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRELDIVNRACAVLDAHRQDRFTLAQL
FT                   SDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNSPSR
FT                   LYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLV
FT                   DELRTGFANAQIAESPERIAPFIAQVDAYLNGTRRRFELPLDLAATEFQQRVWDALRRI
FT                   PYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIPCHRVVQKGGSLAGYRWGLPRK
FT                   AALLDAEAQRAAGESVESAVDHAA"
FT   gene            27929..28870
FT                   /gene="alkA"
FT                   /locus_tag="GBP346_A0035"
FT   CDS_pept        27929..28870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="GBP346_A0035"
FT                   /product="DNA-3-methyladenine glycosylase 2"
FT                   /EC_number="3.2.2.21"
FT                   /note="identified by match to protein family HMM PF00730;
FT                   match to protein family HMM PF06029"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98777"
FT                   /db_xref="GOA:C4KM46"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM46"
FT                   /protein_id="ACQ98777.1"
FT                   /translation="MSAAVEPAAVRPDSVVLELPFKSPYDWPRVLRFFAGRAIPGVEAV
FT                   GDGAYRRTVDHHGAIGTLTVRKHPRKRCLVALVEGDAARHADAAFAARLSTMFDLQADP
FT                   AAIGAHLARDAWFASLVGAAPGLRVPGAWSGFELIVRAIVGQQVSVKAATTIVGRLVER
FT                   AGERLAPHAPGAIGWRFPEPAALAACDVSRIGMPGKRAAALQGVARAVASGDVPLDAYA
FT                   SDPAGVRAALLALPGIGPWTVEYVAMRAWRDADAWPATDLVLMQAIVARDPALDRPASQ
FT                   RLRADAWRPWRAYAAMHLWNEIADRAGSARGG"
FT   gene            28871..29044
FT                   /locus_tag="GBP346_A0036"
FT   CDS_pept        28871..29044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95426"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM47"
FT                   /protein_id="ACQ95426.1"
FT                   /translation="MRAPAPRGARESTGNAEGQVKRAFRRDVKVPATVKSRQVIRACRG
FT                   SPSPHLHQCRTT"
FT   gene            29083..30642
FT                   /gene="gshA_1"
FT                   /locus_tag="GBP346_A0037"
FT   CDS_pept        29083..30642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA_1"
FT                   /locus_tag="GBP346_A0037"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF04262;
FT                   match to protein family HMM TIGR01434"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96031"
FT                   /db_xref="GOA:C4KM48"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM48"
FT                   /protein_id="ACQ96031.1"
FT                   /translation="MLSTSPTREQLPDGLRGIEKESLRVTRDGMIAFTPHPRALGSALT
FT                   HPSLTTDYSEALVELITPAERDAATTLERLDELHRYVYASLGDEILWTDSMPGLLPADD
FT                   EIPIADYGTSNIGRLKTVYRRGLAYRYGRTMQCIAGIHYNYSLSEEVWRRLHAEEGSTA
FT                   GIVDYQSERYLALIRNFRRTSWLLMYLFGASPALDAGFLRGRAHKLDTFDAATLYRPHA
FT                   TSLRMSDLGYSNTTAQAALQADYNTLSGYLDALSKAVSEPYPPYEAIGTHRDGEWIQIN
FT                   TNVLQIENEFYSTIRPKRVTYSGERPLHALASRGVQYIEVRCLDIDPFEPTGIALDTAR
FT                   FLDAYLLVCALDESAPLTCDAYRESNANFGRVTMEGRKPGLELTRDGAAVPMRAWADEI
FT                   FAQIEAAGRVLDDIRGDDAHARAIAAQRAKLDDPELTSSARVLRAMRENGQSFLEFARA
FT                   QSAAHAAYFHGRPLDEAATRDARALAERSLAEQAELEGKNAGSFDAFVAAYRAYTLNRF
FT                   SV"
FT   gene            complement(30661..32109)
FT                   /locus_tag="GBP346_A0038"
FT   CDS_pept        complement(30661..32109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0038"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="identified by match to protein family HMM PF00140;
FT                   match to protein family HMM PF04539; match to protein
FT                   family HMM PF04542; match to protein family HMM PF04545;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96398"
FT                   /db_xref="GOA:C4KM49"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM49"
FT                   /protein_id="ACQ96398.1"
FT                   /translation="MKVSARELRYEQGIDRLLELAGARDDTEYADVADEFASAPSSAFA
FT                   HDLGEPDSLDHQASDESAGAGSFGDKPTRPAHGDTDVDTDWRDDDAPPSGSNDAAPVDT
FT                   AASTDPLALFVRRMHAVPLLTHAQEIALAAEIEAGREQVLQALAEALDRLDLASLPADP
FT                   ALGRARAALQRARARGDEGARAFARARTAAYAALAAHGWPSAEVDAVRRAMRRLPTSPE
FT                   KSDAGAQRAFADGEARISAATARMAEANLRLVLSIARKYASRGLDLADLLQEGNLGLLR
FT                   AIEKFEHRRGFKFSTYATWWIRQAISRAVADRARTIRVPVHVGDEARRVRKAADRIERR
FT                   SGVSASLAELSEATGLPAERLRAVLTLPREPRSLNAPLGDDDQAEFGDIVEDTSTPSLF
FT                   DALAHGQMCDVVTSLLKTMSAQEADILRRRFGIGGDEPWSYEQIAARAGVSREQVRRIE
FT                   KRALQTLRVTAEACNAHDFLDVQP"
FT   gene            complement(32372..32920)
FT                   /locus_tag="GBP346_A0039"
FT   CDS_pept        complement(32372..32920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97264"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM50"
FT                   /protein_id="ACQ97264.1"
FT                   /translation="MEEAYARRALLLHLGSVLQILSRLEEAPDNQSIEALLAANGMLAD
FT                   VPLVEYVVQDMTVREFSARALRAFCLWPQLLLEDPLDCAALALPVRKHLFAGNDAGWKA
FT                   YAATLREVAPGFDTARSYAAEPHEAEFDLADERDAETGDGPVERDDEADDDGRLRERAA
FT                   ASVESATPAGAPVRRESYE"
FT   gene            complement(33009..33455)
FT                   /locus_tag="GBP346_A0040"
FT   CDS_pept        complement(33009..33455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95383"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM51"
FT                   /protein_id="ACQ95383.1"
FT                   /translation="MRGRAADRRVARRARLRARVAQPGEARRRVGFGFGFGFGRRHDPP
FT                   DEQALSAERHADSNGSIEPRRLPAREMHRTARAPAVRGERERPRAPPRAHLACGGAPRA
FT                   RRRSLTCVNPCLQLACRLATLVCIARRARRGKTCRIARTAFQPP"
FT   gene            complement(33499..34068)
FT                   /locus_tag="GBP346_A0041"
FT   CDS_pept        complement(33499..34068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96941"
FT                   /db_xref="GOA:C4KM52"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM52"
FT                   /protein_id="ACQ96941.1"
FT                   /translation="MKIERYSKGLTVISLTAALWSLGMPVAPAAPASDARAQTPCGRGD
FT                   GMGPGMMGGGYGRGMMGGYGMGPGMMRGDGMGPGMMMGFGGWPSGLDLTSEQRAKINRI
FT                   QDGTRKAHWALMGDMMDRQAKLRDLYDAPKRDGAAIDETSRAIGSLRQKMIDASVDARK
FT                   KMEAVLTSKQLDKLRAYEKQADDMSW"
FT   gene            complement(34171..35139)
FT                   /locus_tag="GBP346_A0042"
FT   CDS_pept        complement(34171..35139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0042"
FT                   /product="LysR family transcription regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96328"
FT                   /db_xref="GOA:C4KM53"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM53"
FT                   /protein_id="ACQ96328.1"
FT                   /translation="MRRIDLLSALETFVCAVEEGSLSQAARRLAKTPSAVTKAIAGLEA
FT                   TLGVQLLERTTRRLALTESGRLYLATATDVLRRLADGARQLSERDDEPRGLLRVTAAHS
FT                   FGHAILAPLCAPFAQAFPRVRIELSLSDHYVDIVGEGFDLALRMGNYDLPSQIVKPIGS
FT                   NRGLLCASPGYLARRGRPTAPADLAQHDCVIYRHPTLANTWTFERGGVRARLEPKGPLV
FT                   TDDYGLALAAALDGAGVLPCPQWSVVDALEAGRLVPLLVDWRFESASFGEDRICAAYPS
FT                   SRRGSTKIRRLVERVQARLADSEARVARVLGDALCADLARR"
FT   gene            35213..36376
FT                   /gene="potF_1"
FT                   /locus_tag="GBP346_A0043"
FT   CDS_pept        35213..36376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF_1"
FT                   /locus_tag="GBP346_A0043"
FT                   /product="putrescine ABC transporter, periplasmic
FT                   putrescine-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97734"
FT                   /db_xref="GOA:C4KM54"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM54"
FT                   /protein_id="ACQ97734.1"
FT                   /translation="MERSPMQRASGRPFSSASSKERSMKRIAWLAAVLASLACAAARAA
FT                   DGNVLNIYNWAEYFAPDTIADFEKETGIKVRLDVYDSNEALQTKLTTGNSGYDLVFPSN
FT                   DFLARQIQAGLYRKLDKSRLPNLTNLDPAIVARAAEVDPGNQYSVPYMQGTFGLGLNIA
FT                   KVKQALGGPLPANTLELIFNPAYAAKLERCGIAFNDAGSEVFPLALRYIGRDPNTTDPR
FT                   DYEAALDMMKTIRPTIRQFIATPVMNDLATGDVCVVTGYSGAVLVAARRAAEAKNGQQI
FT                   VYSLPSAGAPFWFDSMAIPKGAAHADHALRFIDYILRPDVVAKISNKVMYPNPNRVATP
FT                   LVDRRLTANPAIYPDAATMRTLWVKRPMPPQAMRMQTRYWTRFKTGY"
FT   gene            36405..37517
FT                   /locus_tag="GBP346_A0044"
FT   CDS_pept        36405..37517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0044"
FT                   /product="histone deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99009"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM55"
FT                   /protein_id="ACQ99009.1"
FT                   /translation="MIPTGLLFDPAFLSHRQGDLVYVVPHGTLNLGEHFDSPLRLAYTK
FT                   QLLDAVGMTERLTRVAFARATDEQLLRVHRPEYLRQLAEACAVAGEQVVRLGDDAAGSA
FT                   STEDVARLAAGAACAAVDAVMTGPLRQAYALIRPSGHHAGADFAMGYCYYNNVAIAARH
FT                   AQAAHGVERVAIVDWDVHHGNGTQQAFYDDPSVLFVSLHEAANFPVDGGEVRETGGGAG
FT                   AGYNANVPLPSGTGDAGYRHAFDELVLPLVEAFAPQLILVSAGQDANAFDPLGRMRVQR
FT                   DGFRHMARALRQAAGGACGGRIVMLQEGGYSLPYLPIATLGVLEGLVGWNAPFDDPHQF
FT                   VQYPLGEGERDAVKAARAALAPYWPTLHRS"
FT   gene            37528..38403
FT                   /gene="aguB"
FT                   /locus_tag="GBP346_A0045"
FT   CDS_pept        37528..38403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguB"
FT                   /locus_tag="GBP346_A0045"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /EC_number="3.5.1.53"
FT                   /note="identified by match to protein family HMM PF00795;
FT                   match to protein family HMM TIGR03381"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98784"
FT                   /db_xref="GOA:C4KM56"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM56"
FT                   /protein_id="ACQ98784.1"
FT                   /translation="MRKTTVAVTQMACDWNVDANLSRAERLVRDAAARGAQIVLLQELF
FT                   ETPYFCIDQHPAHLALAQPYEGHPWLMRFASLARELGVVLPVSFFERAGQTQFNSVAIF
FT                   DADGRALGIYRKTHIPDGPGYTEKYYFTPGDTGFRVWDTAYGRIGVGICWDQWFPECAR
FT                   AMALAGAELLLYPSAIGSEPHDASIDSRAHWRNAQRGHAAANLMPVAASNRVGVERGAS
FT                   GEIVFYGSSFIAGADGEMIVECDRHGEAIATAEFDLDALAYRRRGWGVFRDRRPECYRA
FT                   LSEGAADRVR"
FT   gene            complement(38540..39004)
FT                   /locus_tag="GBP346_A0046"
FT   CDS_pept        complement(38540..39004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98351"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM57"
FT                   /protein_id="ACQ98351.1"
FT                   /translation="MEFRPIKESDLGSTYDIRFSVTENRILPHQIHLLERDRVLEQLRS
FT                   GFGVLAIEGDAAVGYCTATGSGGPGKRSWRTAPKHCHAGPRRLRERAALAAAAPRATRS
FT                   RPRACVTCKAPSAERRSPSETSCASARTGRRAPFGRFSAFAAHRQAGRRH"
FT   gene            complement(38976..39533)
FT                   /locus_tag="GBP346_A0047"
FT   CDS_pept        complement(38976..39533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95446"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM58"
FT                   /protein_id="ACQ95446.1"
FT                   /translation="MKTSARAGARIWRGLFLKVVAAELVTFEHAEGAVVDARRRHDDNP
FT                   PKTRCLSIHRLPRGQPPQYHIAKSANADAAAISSGIPHTRCPNAARRMRPAMHNGPRAE
FT                   AAASSRAIYRPPAAAHSRARHRHLAKRPACRCEPVFSVSGRSEMNRLKRILNDQTIREN
FT                   RASQARPREENHLDGVPPDKGK"
FT   gene            39403..40494
FT                   /locus_tag="GBP346_A0048"
FT   CDS_pept        39403..40494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0048"
FT                   /product="phage portal protein, pbsx family"
FT                   /note="identified by match to protein family HMM PF04860;
FT                   match to protein family HMM TIGR01540"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96718"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="InterPro:IPR030935"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM59"
FT                   /protein_id="ACQ96718.1"
FT                   /translation="MSSWRRRASTTAPSACSNVTSSAATTLRNRPRQIRAPARAEVFTF
FT                   DDPTPVMNRAEILDYVECWSNGEWFEPPVSFAGLAKSFRASTHHSSALFFKANVLASTF
FT                   RPHRWLSRHAFERWALDFLTFGNGYLERRRNMVGGTLRLEPALAKYVRRKADFSGFVYV
FT                   NGWQERHEFEPDSVFQLVRPDINQEVYGLPEYLSSLHSAWLNESSTLFRRKYYENGSHA
FT                   GFILYMTDAAQKQDDVDNMRDALKNAKGPGNFRNVFMYAPGGKKDGIQLIPVSEVAAKD
FT                   EFFNIKNVTRDDLLAAHRVPPQLLGIVPSNSGGFGTPDTAARVFGRNEIRPLQARFAEL
FT                   NDWLGDEVVRFDDYEIPPAPVAV"
FT   gene            complement(40568..40852)
FT                   /locus_tag="GBP346_A0049"
FT   CDS_pept        complement(40568..40852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96416"
FT                   /db_xref="GOA:C4KM60"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM60"
FT                   /protein_id="ACQ96416.1"
FT                   /translation="MKTIGRILLALVLTWPLLTGISSLPLLTHWFANGGEGWNALSPVF
FT                   RALGSDGGEQNEEIFVGILLVISFVLALVLSFALFGLVDRLRHSTDRRA"
FT   gene            complement(40849..41331)
FT                   /locus_tag="GBP346_A0050"
FT   CDS_pept        complement(40849..41331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95218"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM61"
FT                   /protein_id="ACQ95218.1"
FT                   /translation="MPAECTFVLNRSRLSTLTCPGFGSVPAFSGNGRYINDPGSTAVAD
FT                   KGPLPAGVYYIIDRQSGGHLGWFRDTVMDAALNTYRAEWFALYRIDGQIDDWTIVNGIR
FT                   RGHFRLHPVGRLGESDGCITLTSRGQFDKLRAFLKAQPTTQVPGTSFRAYGKVTVK"
FT   gene            complement(42603..42680)
FT                   /locus_tag="GBP346_A0051"
FT   tRNA            complement(42603..42680)
FT                   /locus_tag="GBP346_A0051"
FT                   /product="tRNA-Lys"
FT   gene            42699..42815
FT                   /locus_tag="GBP346_A0052"
FT   CDS_pept        42699..42815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95250"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM62"
FT                   /protein_id="ACQ95250.1"
FT                   /translation="MGFSSLSSLFCIFFEARPSAAHCRSERARSVASCALPV"
FT   gene            42871..43275
FT                   /locus_tag="GBP346_A0053"
FT   CDS_pept        42871..43275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0053"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99000"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM63"
FT                   /protein_id="ACQ99000.1"
FT                   /translation="MDENTVRDLLDRLLAPWVRSLSLTPVSISEESVTLRLPFSGEFRH
FT                   SGGVICGQVFMAAADTAMVVAISAALGEFRPMTTVALNTHFMRPVRKGDVLVTARVLRM
FT                   GRNLVFGEIELFDEDGKMAVHATSTYALVS"
FT   gene            43313..44182
FT                   /locus_tag="GBP346_A0054"
FT   CDS_pept        43313..44182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0054"
FT                   /product="patatin"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98547"
FT                   /db_xref="GOA:C4KM64"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM64"
FT                   /protein_id="ACQ98547.1"
FT                   /translation="MFDQVVFAGGGNRCWWQAGFWDVVRPALDLRPRVIAGISAGAATA
FT                   CMLYTRDSRWVMRYYEEALRHNRRNVHWGNLLRAEPVFPHYRIYRQALLDIYGEPFAKL
FT                   AGAPDIRIGVSHVPRWLGARSAVAAGLIAYNIEKYVRKTLHPTLGRSLGFRPEFVRAQD
FT                   CARVDELADLVLQSSCTPPFTPVLRRDGRPVLDGGMVDNVPVGALDASPGSVLVMVTRR
FT                   YPRPQTFVVDGGGQRRLYVQPSSKVPISSWDYTSPHQMQHAYDLGRRDGERFVGAMPQC
FT                   LDEDGAVR"
FT   gene            complement(44305..45321)
FT                   /locus_tag="GBP346_A0055"
FT   CDS_pept        complement(44305..45321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0055"
FT                   /product="glyoxylate reductase"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98082"
FT                   /db_xref="GOA:C4KM65"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM65"
FT                   /protein_id="ACQ98082.1"
FT                   /translation="MKIAILDDYQDAVRKLNCFEMLADHEVKIFNNTVRGLGQLASRLA
FT                   EVEALVLIRERTHITSQLLGKLSHLRMISQTGRVSTHIDLEACTERGIAVLEGTGSPTA
FT                   PAELTWALIMAAQRRIPQYVANLKQGAWQQSGLKTSAMPPNFGLGQVLRGQTLGIWGYG
FT                   KVGRLVAGYGKAFGMNVLIWGREHSLEAARADGFEAAESREAFFEQADVLSLHLRLHDD
FT                   TRGVVKLDDLLRMKPTSLLVNTSRAELLEENALVSALAHNRPGMVAIDVYESEPILQGY
FT                   SLLRMENVICTPHIGYVERESYELYFSAAFRNILAFDAGDLSSVANPDALTQGRVRR"
FT   gene            45760..46815
FT                   /locus_tag="GBP346_A0056"
FT   CDS_pept        45760..46815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0056"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97357"
FT                   /db_xref="GOA:C4KM66"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM66"
FT                   /protein_id="ACQ97357.1"
FT                   /translation="MDHLQSMRVFVKVADLGSFARAASAMDISNAVATRHVADLEGRLG
FT                   TRLLNRTTRSLSLTESGQVYLERARQILDELEDVEQMVVARNHEPVGTLRVVAPVVFGL
FT                   HNLAPVLQTYTQRFPKVIPDLTLVDRQVDLVEEGFDVGIVITRQMRSASIVTRRLTTGC
FT                   MVVCATPSYLEKHGMPTHPEQLVEHPCLSLPSEYWGDERVFTGPDGEVRVRPSNVVVAN
FT                   NTEMLRQFAMLGMGVAILPSYLIGSDIARGKLVRLLSDYRLPQVEINIAYPSRRHLPAK
FT                   VRTFIDHLVEHFSQSPDTMLGEQWATQGVAGQHVDALPADALAERSSADPALSPRLPRA
FT                   PRARTVVPSPL"
FT   gene            complement(47037..49646)
FT                   /locus_tag="GBP346_A0057"
FT   CDS_pept        complement(47037..49646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0057"
FT                   /product="DNA topoisomerase 3"
FT                   /EC_number="5.99.1.2"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01751; match to protein
FT                   family HMM TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96656"
FT                   /db_xref="GOA:C4KM67"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM67"
FT                   /protein_id="ACQ96656.1"
FT                   /translation="MSKALIIAEKPSVANDIARALGGFTKHDEYYESDEYVLSSAVGHL
FT                   LEIAAPEEYEVKRGKWSFAHLPVIPPHFDLNPIAKSESRLKVLTKLIKRKDVDRLINAC
FT                   DAGREGELIFRLIAQHAKAKQPVQRLWLQSMTPAAIRDGFAHLRTDMDMQPLADAARCR
FT                   SEADWLVGINGTRAMTAFNSKGGGFFLTTVGRVQTPTLSIVVEREEKIRRFVPRDYWEV
FT                   RAEFVCAGGFYEGRWFDPKFKKDEFDPEKRDSRLWSLPAAETIVAACRDHLGTVTEESK
FT                   PSTQLSPLLYDLTSLQREANSRFGFSAKNTLGLAQALYEKHKVLTYPRTDARALPEDYL
FT                   GTVKSTLEMLKESNNYLPHAKQVLDKNWVKPNKRIFDNSKISDHFAIIPTLQAPKSLSE
FT                   PEQKLYDLVVKRFLAVFFPAAEFKVTTRITEVAGHHFKTEGKVLVEPGWLQVYGRDAEG
FT                   ADANLVPVQKGEKVKTDKIAAHGLTTKPPARYSEATLLSAMEGAGKLVEDDELREAMAA
FT                   KGLGTPATRAAIIEGLLGEKYLVREGRELIPTAKAFQLMTLLRGLGVKELTAPELTGEW
FT                   EYKLSQMERGNLQRDAFMQEIARMTQTIVKRAKEYDSDTIPGDYATLETPCPNCGGQVK
FT                   ENYRRFACTKCEFSISKIPGSRQFEIAEVEELLRKKEIGPLSGFRSKMGRPFSAILKLT
FT                   FDDETKNYKLEFDFGQEQGGEEGEAPDFSAQEPVGACPKCKGRVFEHGMSYVCEHAVAN
FT                   PKTCDFRSGKVILQQEITREQMAKLLENGRTDLLPNFKSSRTGRNFKAYLVKQPDGKIG
FT                   FEFEKKEPKPAAAKKTAARSSAAADDAAADSGEKAEKKAAPARKTAARKTPARKTGS"
FT   gene            complement(49857..50228)
FT                   /locus_tag="GBP346_A0058"
FT   CDS_pept        complement(49857..50228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0058"
FT                   /product="thioredoxin domain protein"
FT                   /note="identified by match to protein family HMM PF00085"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96971"
FT                   /db_xref="GOA:C4KM68"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM68"
FT                   /protein_id="ACQ96971.1"
FT                   /translation="MPALNLDTDEGRIAERLRNPDTLLVACLCAEWCGTCREYRATFDR
FT                   LADTHPGACFAWIDVETHADRLDELDVENFPTLLIEDANAVRFFGTVLPHAAIVERMLA
FT                   DLTALPGAPHAPKLRNLFD"
FT   gene            complement(50288..51592)
FT                   /locus_tag="GBP346_A0059"
FT   CDS_pept        complement(50288..51592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0059"
FT                   /product="DNA protecting protein DprA"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95717"
FT                   /db_xref="GOA:C4KM69"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM69"
FT                   /protein_id="ACQ95717.1"
FT                   /translation="MISQSPWARARGIRSISDDENFITALRSPQAALFEEFIMSPRALT
FT                   RAELSGWLRLAGASGVPAAACAALLGAFASLEALFAASHAELAALVGDAAAQSVLAPPA
FT                   ADFEQRVDAALAWLDEPGNALVTRHDPAYPGPLAELYDPPPLLYIKGRVALLHARAVAI
FT                   VGSRGATPQGLADATRFARELSDAGLAIVSGLARGIDGAAHRGGLDGASGTVAVIGTGA
FT                   DLVYPACHHALAHEIAERGALVSEWPLGTPARSAHFPQRNRLIAALSGGVLIVEAALRS
FT                   GSLITARLANEMGRDVFAIPGSIHAPLSQGCHALIRDGAKLVETAADVLDEFGLDPARP
FT                   VNSKRGAPAAASADADLDDDTRRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELA
FT                   GRVAALPGGRYTRIDGAQAEPAQARGTSAVLHSGA"
FT   gene            complement(51589..51708)
FT                   /locus_tag="GBP346_A0060"
FT   CDS_pept        complement(51589..51708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95940"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM70"
FT                   /protein_id="ACQ95940.1"
FT                   /translation="MISVSGDERPARIGRSADCRDARAGLKMDSTTRAIRASQ"
FT   gene            51671..52210
FT                   /gene="def_1"
FT                   /locus_tag="GBP346_A0061"
FT   CDS_pept        51671..52210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def_1"
FT                   /locus_tag="GBP346_A0061"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98480"
FT                   /db_xref="GOA:C4KM71"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM71"
FT                   /protein_id="ACQ98480.1"
FT                   /translation="MRAGRSSPDTEIMALLNILHYPDKRLHKVAKPVAKVDDRIRKLVA
FT                   DMAETMYAAPGIGLAATQVDVHERVIVIDVSEDKNELRVFINPEIVWTGDGKQVYEEGC
FT                   LSVPGVYDEVERPDRVRVRALDGQGEPFELDCEGLLAVCIQHEMDHLMGRVFVQYLSPL
FT                   KQTRIKTKMKKLERAM"
FT   gene            52242..53225
FT                   /gene="fmt"
FT                   /locus_tag="GBP346_A0062"
FT   CDS_pept        52242..53225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="GBP346_A0062"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99180"
FT                   /db_xref="GOA:C4KM72"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM72"
FT                   /protein_id="ACQ99180.1"
FT                   /translation="MTHSLRVIFAGTPEFAAAALAAIHEAGFPVPLVLTQPDRPAGRGM
FT                   KLQASAVKRYAFERGMAVAQPPSLRRAGKYPAEAVAALDLLHATPHDVMVVAAYGLLLP
FT                   QEVLELPRHGCINIHASLLPRWRGAAPIHRAIEAGDAETGVTLMQMDAGLDTGAMLHEA
FT                   RVAIAPDDTTATLHDKLAAAGARLVVDALVELERTGALAATPQPADGVTYAEKIGKHEA
FT                   ALDWRKPAAALARQVRAFDPFPGGAGTLDGATLKLWAADAVPGRDDAAPGTIVDIGPDG
FT                   VVIACGEGALRVTQLQKPGGKRLPAREFLAGAPLAVGQRFAPADAA"
FT   gene            complement(53241..53363)
FT                   /locus_tag="GBP346_A0063"
FT   CDS_pept        complement(53241..53363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97550"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM73"
FT                   /protein_id="ACQ97550.1"
FT                   /translation="MGDAEHAAPSMLVSENSTRAPGAPRPGRSADCAARAIPMN"
FT   gene            53346..53981
FT                   /locus_tag="GBP346_A0064"
FT   CDS_pept        53346..53981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0064"
FT                   /product="translocator protein, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96212"
FT                   /db_xref="GOA:C4KM74"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM74"
FT                   /protein_id="ACQ96212.1"
FT                   /translation="MFGITHLGLFMAAVFLLNITPGPDTAYIVGRSVAQGRGAGLMSAL
FT                   GISAGCCVHVLACAFGLTAVLAASATAFTVIKVVGAAYLVYLGVRLIFAKQEPAAERPA
FT                   RRGADKSLRQLFMQGFLTNVLNPKVVLFFVSFFPQFVSVDSNHKVLAFLTLGAVFLAMS
FT                   TVWSCTVAWVAGTVTRRFAGKPGVKKWLDRGVGSAFVGLGVKLATSTR"
FT   gene            54091..54948
FT                   /locus_tag="GBP346_A0065"
FT   CDS_pept        54091..54948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0065"
FT                   /product="peptidase family M48"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ94998"
FT                   /db_xref="GOA:C4KM75"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM75"
FT                   /protein_id="ACQ94998.1"
FT                   /translation="MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLIALGMNFFS
FT                   YWFSDKMVLRMYNAQEVDEATAPQFYRMVRELATRANLPMPRVYLIDENQPNAFATGRN
FT                   PEHAAVAATTGILRVLSEREMRGVMAHELAHVKHRDILISTISATMAGAISALANFAMF
FT                   FGGRDENGRPANPIAGIAVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASA
FT                   LDKIHRYASGIPFQTAEEHPATAQMMIMNPLSGGGLQNLFSTHPATEERIARLMDMART
FT                   GRFD"
FT   gene            55113..55238
FT                   /locus_tag="GBP346_A0066"
FT   CDS_pept        55113..55238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0066"
FT                   /product="acetate permease"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95573"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM76"
FT                   /protein_id="ACQ95573.1"
FT                   /translation="MRAAASGVDTCAEAPKRRSAEAPKRRSAEAPKRRSAEAPKH"
FT   gene            55406..56815
FT                   /gene="sun"
FT                   /locus_tag="GBP346_A0067"
FT   CDS_pept        55406..56815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="GBP346_A0067"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01189;
FT                   match to protein family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98244"
FT                   /db_xref="GOA:C4KM77"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM77"
FT                   /protein_id="ACQ98244.1"
FT                   /translation="MTQTRPSRSRASGAPARAPRLSALHLVPDSLGFALDGAAQAVDAV
FT                   DRGAALPAALAAVHAALPSNAQAASRGAIQDIGYRAMRRRGTADWLIAQLVAKAPPAHV
FT                   HALLVCAFALLVDDEHAAYAPFTVVDQAVTAIGARRECSFAKGLVNAVLRRFLRERAAW
FT                   LERLQADRRALWNYEPWWIDAVERAWPDAWQRILAVGDAPGPLTLRVNARRMTADAYLD
FT                   TLRAERIDAEKIGLHAIRLASARPVERIPGFADGIVSVQDAGAQLAAEWLGARDGMRVL
FT                   DACAAPGGKTGHILELAHAEVVALESDPARAPRIGENLARLSLTADVRVGDAADPAQWH
FT                   DGRPFDRVLADVPCSASGIVRRHPDIRWLRRAADIPALVAEQRRILSALWPLVKPGGEL
FT                   LYVTCSIFPEEGELQARWFGDACQDAVRLDAPGQLLPQGATGGAPAVGGSGESGRHVDH
FT                   DGFFYARFQKR"
FT   gene            56812..57402
FT                   /locus_tag="GBP346_A0068"
FT   CDS_pept        56812..57402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99160"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM78"
FT                   /protein_id="ACQ99160.1"
FT                   /translation="MTIKRFFPLRLAAVLWVALTLCLAAVPAARADTIAVQRASLQSDG
FT                   SGWSLDARFDFELNSSLEDAVNKGVPLYFTTDFELSRARWYWFDEQPVSVSQTIRLSFQ
FT                   PLTREYRVSTGGLQLGFPSLKEALAVVKHVTSWHVIDKGQVRPGETYTASVRMQLDTAL
FT                   MPKPFQVDAVNNRDWNLVSDWKRFIFTVAERAK"
FT   gene            57404..59812
FT                   /locus_tag="GBP346_A0069"
FT   CDS_pept        57404..59812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0069"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518; match to protein family HMM PF08448"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99135"
FT                   /db_xref="GOA:C4KM79"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM79"
FT                   /protein_id="ACQ99135.1"
FT                   /translation="MRVRRATSGKSLLIRVIVSTVAITALLLLVLLAAASANTEFFDRY
FT                   YSWLYSANIIVALVFMLVVLGLVGMIVARLRKGKFGTRLLAKLAVFFTLVGVVPGGIIY
FT                   IVSYQFVSRSIESWFDVNVETALTAGLNLGRGMLDTSLADLQTKARLMSEQLSSADANT
FT                   NGTTLTLLRLRDQFGVQDATIVEPGRGTGASPDVHIIAQASGNFAALIPDDMPTPLMLS
FT                   QAREHGVFAAIEGEVDGDPRARGSKGALRLRVVQRIPDSSTSLLQPAERFLQLTQPVSP
FT                   TLARNADAVQRAYREYQEKSLGRSGLRKMYIGTLTLALFLATFIAMMIALALGNQLARP
FT                   LFLLAQGTKEVAEGDYTPKREIKTRDELGFLTQSFNAMTRQLSEARLAVEKNRVALEHS
FT                   KTYLESILANLTAGVFVLDRQFRLTTANRGAERIFRQPFNSLIGTTLDQIGVVAEFGAM
FT                   VRKAFADREAAGRGGGEDRGHWQQQFAVEVPGETEPLTLLVRGTRLVSTAAAPGQPDDP
FT                   QTSGYVVVFDDISDVISAQRSVAWGEVARRLAHEIKNPLTPIQLSAERLQMKLSDKLSQ
FT                   PDADVLKRGATTIVNQVAAMKRMVDDFRDYARTPPAVLVNLQLNDLVSEVLTLYGVGEG
FT                   KSTIVVEQTPLPVIRGDATQLRQVIHNLLQNAQDSVADVEHPRVLLETKTVEYGDPDAN
FT                   GKTRVAVRLTVSDNGPGFPARILTRAFEPYVTTKAKGTGLGLATVKKIVDEHGARIDLR
FT                   NRMHGDVVEGAQVSILFLQLADDTAGAGGGTNGGTAPAKTRATVQTKAA"
FT   gene            59813..60496
FT                   /locus_tag="GBP346_A0070"
FT   CDS_pept        59813..60496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0070"
FT                   /product="putative nitrogen assimilation regulatory protein
FT                   NtrX"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97387"
FT                   /db_xref="GOA:C4KM80"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM80"
FT                   /protein_id="ACQ97387.1"
FT                   /translation="MATILVVDDEMGIRELLSEILSDEGHVVDVAENAQAARDYRLRQA
FT                   PDLVLLDIWMPDTDGVTLLKEWASQGQLTMPVIMMSGHATIDTAVEATKIGALDFLEKP
FT                   ITLQKLLKSVEHGLARGAAPLPASAAAKPAAGAAVASAAALPTLGDDPAVALAGQTTAA
FT                   IPFDIPLREARDAFERAYFEYHLARENGSMTRVAEKTGLERTHLYRKLKQLGVELGKKP
FT                   AEGAA"
FT   gene            60556..60633
FT                   /locus_tag="GBP346_A0071"
FT   tRNA            60556..60633
FT                   /locus_tag="GBP346_A0071"
FT                   /product="tRNA-Phe"
FT   gene            60762..60983
FT                   /locus_tag="GBP346_A0072"
FT   CDS_pept        60762..60983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97438"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM81"
FT                   /protein_id="ACQ97438.1"
FT                   /translation="MRPKAPQVLFRFGGSCMRESVRRPRGAMSGISAAPFRAARTCLYW
FT                   VGRRSRRASNHRRARSSFTEYHGDSDRR"
FT   gene            60964..61698
FT                   /locus_tag="GBP346_A0073"
FT   CDS_pept        60964..61698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0073"
FT                   /product="ExsB protein"
FT                   /note="identified by match to protein family HMM PF06508;
FT                   match to protein family HMM TIGR00364"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98811"
FT                   /db_xref="GOA:C4KM82"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM82"
FT                   /protein_id="ACQ98811.1"
FT                   /translation="MIRTDAKDGALVLFSGGQDSATCVAWALERYQTVETLGFDYGQRH
FT                   RVELECREGVRDALKRRFPQWSHKLGDDHLIDLSVLGSISDTAMTRAIEIETASNGLPN
FT                   TFVPGRNLLFMTIAAAIAYRRGLRALVGGMCETDFSGYPDCRDDTMKALQVALNLGMDT
FT                   RFVLETPLMWLDKADTWRLAEQLGGAPLVELIRVETHTCYVGERSELHDWGFGCGECPA
FT                   CKLRKRGYDAYLRGESVTEAPA"
FT   gene            61792..62424
FT                   /locus_tag="GBP346_A0074"
FT   CDS_pept        61792..62424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0074"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98640"
FT                   /db_xref="GOA:C4KM83"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR030977"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM83"
FT                   /protein_id="ACQ98640.1"
FT                   /translation="MTYTVKEIFYTLQGEGANAGRPAVFCRFAGCNLWTGREADRDGAV
FT                   CRFCDTDFVGTDGENGGKFKDAASLAARIASLWPAGEAYRFVVCTGGEPMLQLDQPLVD
FT                   ALHAAGFTIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQRLADYA
FT                   KLDFEHFLVQPMDGPSRELNTRLAIDWCKRHPRWRLSMQTHKYLNIP"
FT   gene            62444..62896
FT                   /gene="queD"
FT                   /locus_tag="GBP346_A0075"
FT   CDS_pept        62444..62896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queD"
FT                   /locus_tag="GBP346_A0075"
FT                   /product="queuosine biosynthesis protein QueD"
FT                   /note="identified by match to protein family HMM PF01242;
FT                   match to protein family HMM TIGR03367"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95796"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM84"
FT                   /protein_id="ACQ95796.1"
FT                   /translation="MLITRKLEFDAGHRIPDHRSQCRNLHGHRYVLEITLRGDLVETEG
FT                   APDRGMVMDFADVKALAMEHLVSKWDHAFLVYARDEIVRSFLEKMADHKTVVLDRIPTV
FT                   ENLAAIAFDILANVYDAHYGVNLRLERVRLYETPNCWADVERDPRV"
FT   gene            62928..63080
FT                   /locus_tag="GBP346_A0076"
FT   CDS_pept        62928..63080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96357"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM85"
FT                   /protein_id="ACQ96357.1"
FT                   /translation="MRPRMRFHARFHIRFPHTFRLRYEVRLRGCLDVRFRRPRGSRAMR
FT                   VTFSP"
FT   gene            63145..63285
FT                   /locus_tag="GBP346_A0077"
FT   CDS_pept        63145..63285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0077"
FT                   /product="HpcH/HpaI aldolase family protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98087"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM86"
FT                   /protein_id="ACQ98087.1"
FT                   /translation="MFSESARGRDHGMIESWIVCRDERVARACYRAALPPGGLAAPLSE
FT                   S"
FT   gene            63319..64104
FT                   /locus_tag="GBP346_A0078"
FT   CDS_pept        63319..64104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0078"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="identified by match to protein family HMM PF03328"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97521"
FT                   /db_xref="GOA:C4KM87"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM87"
FT                   /protein_id="ACQ97521.1"
FT                   /translation="MSTLTHSLKARLRDGDEPLFGLWLTLASEAATEALAHAGFDWLCI
FT                   DMEHAPNDSRDVAAQLRALAAAHLPSEPVVRVPAREPWFVKRALDAGARTLMFPGVETA
FT                   DEAAHAVRLTRFQAPDAPDGLRGVAGIVRAAAYGMRRDYVQTANAQIATIVQIESARGV
FT                   DEAERIAATPGVDCVFVGPADLSASLGHLGDTTHPDVAAALEHVLAAGRRAGVPVGIFA
FT                   ADTAGARQSLEAGFRVVALSADVVWLLRATRQALQEVRG"
FT   gene            64101..64877
FT                   /locus_tag="GBP346_A0079"
FT   CDS_pept        64101..64877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0079"
FT                   /product="Sel1 repeat protein"
FT                   /note="identified by match to protein family HMM PF08238"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97180"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM88"
FT                   /protein_id="ACQ97180.1"
FT                   /translation="MSGKRRGAPLSTRTPRVLRGAVIGSLAAAALGAAAGGALAQAPGA
FT                   PSRPDPQRETEAAVADYNAGNLRAALVQFHDAAARGNRLAAFDYAMMLINGEGVTANVP
FT                   EGLRWLRRAADAGMTQAQYVYGRMLDDGEFVARDPAAAHDWFLKAAQQGHVQAELALAN
FT                   QFLDGRGTPRDNRQAFAWYKRAADAGEPVSQYVTASFYERGGDGVARNLDIARAYYAAA
FT                   AAQGDDAAALKYRELTAAQKAGPGGASAPKATGPSY"
FT   gene            complement(65143..66291)
FT                   /gene="mrdB"
FT                   /locus_tag="GBP346_A0080"
FT   CDS_pept        complement(65143..66291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="GBP346_A0080"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98902"
FT                   /db_xref="GOA:C4KM89"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM89"
FT                   /protein_id="ACQ98902.1"
FT                   /translation="MQFDKRASLDKIKQMFAGFDRPLALIVFLLLCVGIVTLYSASVDV
FT                   PGRVEDQLRNIMLTFVLMWVIANIPPQTLMRFAVPLYSFGVALLVAVALFGMTKKGAKR
FT                   WLNVGVVIQPSEILKIATPLMLAWYYQRRESSLRWYDFVVAFAILMVPVGLIAKQPDLG
FT                   TAVLVFAAGLFVIYLAGLSFKLIVPVLVAGVLAVGSIAVFEERICQPEVVWPLMHDYQK
FT                   HRVCTLLDPTSDPLGKGFHTIQAVIAIGSGGPLGKGYLKGTQAHLEFIPEKHTDFIFAV
FT                   FSEEFGLVGGLVLLTLYMALIARGLYIAAQGATLFGRLLAGSLTLAFFVYAFVNIGMVS
FT                   GVLPVVGVPLPFMSYGGTALTTLGIAVGLIMSVGRQKRLMKS"
FT   gene            complement(66303..68714)
FT                   /gene="mrdA"
FT                   /locus_tag="GBP346_A0081"
FT   CDS_pept        complement(66303..68714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="GBP346_A0081"
FT                   /product="penicillin-binding protein 2"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717; match to protein
FT                   family HMM TIGR03423"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98197"
FT                   /db_xref="GOA:C4KM90"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM90"
FT                   /protein_id="ACQ98197.1"
FT                   /translation="MTEFKDTQQQLSKFRLRVAAAGVFVFVCFGLLATRFFYLQVWQHG
FT                   KYALQAEENRISVAPIVPNRGIITDRNGVVLAKNYSAYTLEITPSKLADTLDNTINALA
FT                   EVVQIDARDRRRFKKLQEDSKNFESLPIRTRLTDDEVARFTAQRWRFPGVDVRARLFRQ
FT                   YPLGPTAAHVIGYIGRISKRDQDRIDAMSDENDSDPETYDPRRDANNYKGTDYIGKVGV
FT                   EQSYETELHGITGFEEVEVTAGGRPVRTLSRTQATPGSNLVLSLDIGLQQVAEQAFAGK
FT                   RGALVAIEPKTGDVLAFVSSPSFDPNSFVDGIDQQTWDELNNSPDKPLLNRPLHGTYPP
FT                   GSTYKPFMALAGLALGKRTPGWGFQDPGYFTFGGHTFRNDVRSGQGWVDMNKAIMVSND
FT                   TYFYMLARDLGVTAIANFMKPFGFGQLTGIDIQGEARGILPSPEWKKKTFKKAAQQKWF
FT                   DGETISLGIGQGYNSFTILQLAHATATLANDGVIMKPHLVKEVENPISRARHLTVPKES
FT                   GVIPLKQSDLDVVKRGMENVVESPSGTAFKVFRGAPYLAAGKTGTAQVFSLQGGNYRGH
FT                   LLAEHLRDHALFIAYAPVDHPQIALALIVENGGWGAQSAGPIARRVLDFYLLERKNPST
FT                   EAAAVAAAASATEPVNAPVIGDATKPVGIAAGFKALPQPVPPASASGADGASGASGAGG
FT                   EPTEHANAGGNPAGGGIAGGAAGTANNGSGAAAPGGMPGANGAATGAPPASRRLPPRKP
FT                   RRTPASDAAISAAASRDDPRKPSSGAPKTPAQDDNHAVSAARPAAGGIDE"
FT   gene            complement(68719..68871)
FT                   /locus_tag="GBP346_A0082"
FT   CDS_pept        complement(68719..68871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0082"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97780"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM91"
FT                   /protein_id="ACQ97780.1"
FT                   /translation="MNARRPSTRPTARGRRDATAALAARPAGATHAPRPGASPPARRRK
FT                   RALHP"
FT   gene            complement(68898..69410)
FT                   /gene="mreD"
FT                   /locus_tag="GBP346_A0083"
FT   CDS_pept        complement(68898..69410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="GBP346_A0083"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="identified by match to protein family HMM PF04093;
FT                   match to protein family HMM TIGR03426"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97338"
FT                   /db_xref="GOA:C4KM92"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM92"
FT                   /protein_id="ACQ97338.1"
FT                   /translation="MSRPQYILQPVNPYFIVFSLAAAFLLNLMPWGRVPGVPDCVALVL
FT                   LFWNIHQPRKVGMGVAFALGILMDVHDAGLLGEHALAYTLLSYGAITIHRRVLWLPLGV
FT                   QIFYVAPLLVIAQLVPFVIRLLMGAAFPGWSYLVDGFVEAALWPVASHLLLMPQRRPVD
FT                   PDDTRPI"
FT   gene            complement(69407..70480)
FT                   /gene="mreC"
FT                   /locus_tag="GBP346_A0084"
FT   CDS_pept        complement(69407..70480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="GBP346_A0084"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="identified by match to protein family HMM PF04085;
FT                   match to protein family HMM TIGR00219"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98706"
FT                   /db_xref="GOA:C4KM93"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM93"
FT                   /protein_id="ACQ98706.1"
FT                   /translation="MEYSPPPLFKQGPSALARLIFFVVLAIALLVSDARFNTLEIVRGV
FT                   LGTVLYPLQRAALVPRDLIVGAAELATSSTALRHENQQLRDRNLKLSLQANQAGQLAAD
FT                   NAHLRAVLELRQQIAAQATPVEIQYDTGDPFSQKIIIGHGSQAGIQDGAPVVNEDGVIG
FT                   QVTRVFPLQSEVTLVTDRDLAIPVQVLRTGLRSVIYGTPKGDALDLRFVPTSADLLAGD
FT                   ELVTSGLDGVYPPGLPVAKVVRVDKLADTAFAHVVCAPIAAVRGAREMLVLHYRNDIPP
FT                   PPVTDDAASDAKAAKGKKATKGADKSAKAADKGADKDKGAKPAAAPPVPARSRPAGPAQ
FT                   PAAPLKPATAPSPGAPR"
FT   gene            complement(70600..71643)
FT                   /locus_tag="GBP346_A0085"
FT   CDS_pept        complement(70600..71643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0085"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="identified by match to protein family HMM PF06723;
FT                   match to protein family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95638"
FT                   /db_xref="GOA:C4KM94"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM94"
FT                   /protein_id="ACQ95638.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEG
FT                   GPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRM
FT                   FSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
FT   gene            72009..72308
FT                   /locus_tag="GBP346_A0086"
FT   CDS_pept        72009..72308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0086"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C (Asp/Glu-ADT subunit C)"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95625"
FT                   /db_xref="GOA:C4KM95"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM95"
FT                   /protein_id="ACQ95625.1"
FT                   /translation="MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVD
FT                   TTGIAPLAHPIEQILEVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE"
FT   gene            72421..73911
FT                   /locus_tag="GBP346_A0087"
FT   CDS_pept        72421..73911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0087"
FT                   /product="glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95041"
FT                   /db_xref="GOA:C4KM96"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM96"
FT                   /protein_id="ACQ95041.1"
FT                   /translation="MHAKSLTELRAALDAKECSAVELAQHYLKRIDAARDLNAFVHVDA
FT                   ELTLAQAKAADAALANGEAGPLAGLPIAHKDVFVTRGWRSTAGSKMLANYASPFDATVV
FT                   ARLSAAGMVTLGKTNMDEFAMGSSNENSAFGPVKNPWDTSAVPGGSSGGSSAAVAARLA
FT                   PAATGTDTGGSIRQPASFAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMARSAADCALL
FT                   LNAMAGFDERDSTSLERADEDYTRHLGKAWAAGGDAGKPLAGLRIGLPAEYFGAGLADD
FT                   VRAAIDAALKTYEALGATLVPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRAA
FT                   EYRDLLDMYKKSRAEGFGPEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEAF
FT                   KSCDVIMGPASPTVAWDIGAKGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAK
FT                   RPVGLQIIGNYFDEARMLQVADAFQRATDWHVQEPAGV"
FT   gene            73914..75386
FT                   /locus_tag="GBP346_A0088"
FT   CDS_pept        73914..75386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0088"
FT                   /product="glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96853"
FT                   /db_xref="GOA:C4KM97"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM97"
FT                   /protein_id="ACQ96853.1"
FT                   /translation="MTQWEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLAL
FT                   PGVLPVLNRGAVERAIRFGLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGG
FT                   QITIQVPANEKAGKQAYSKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIV
FT                   TEPEMRSAAEAVAYAKALHGLVMWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEI
FT                   KNLNSFRFLEDAINYEVRRQIELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYF
FT                   PDPDLMPLVIGADWIARVKGEMPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAEYFEA
FT                   LVAKAGAANAKLAANWLMGDVSSQLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIA
FT                   KEIFVTIWDEKAADEGAADRIIEAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKD
FT                   KAFNALVGQAMKATKGKANPQQVNELLKKKLG"
FT   gene            75513..76352
FT                   /locus_tag="GBP346_A0089"
FT   CDS_pept        75513..76352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0089"
FT                   /product="polyphosphate:AMP phosphotransferase"
FT                   /note="identified by match to protein family HMM PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97961"
FT                   /db_xref="GOA:C4KM98"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM98"
FT                   /protein_id="ACQ97961.1"
FT                   /translation="MAKQPSLDDYRVPYHTREKEAAAFTFDAFDPAAKPFSSGSKETDR
FT                   ERLSAVALQLDTLQERLHTQRHKRMLLVLQGMDSSGKDGTVRAVFHEVDPLGLRIVSFK
FT                   APTPVERSHDFLWRVHAQAPAAGELTIFNRSHYEDVLVPRVTAEIDKAECERRYRQIRQ
FT                   FEEMLAESGTRLVKCFLHISKDEQRARLQARIDDPNKHWKFDISDLEARKHWDAYQAAY
FT                   RDALAATSAEHAPWYVIPADSKTHRNVMIAELLLRELTAMKLEYPPAKPELAGIQIQ"
FT   gene            76385..77155
FT                   /gene="xth_1"
FT                   /locus_tag="GBP346_A0090"
FT   CDS_pept        76385..77155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth_1"
FT                   /locus_tag="GBP346_A0090"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR00195; match to protein
FT                   family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99141"
FT                   /db_xref="GOA:C4KM99"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C4KM99"
FT                   /protein_id="ACQ99141.1"
FT                   /translation="MLRVITANLNGIRSAAKKGFFEWLGEQNADCVCVQEIKVSADDLP
FT                   AEFVEPHGLRSYFHHAQKKGYSGAGLYSRREPDDVIIGYGSSEFDAEGRYVEARFGKLS
FT                   VVSVYVPSGSSGDERQQAKYRFMDEFMPHLAELKAKREVILCGDVNIVHKEIDIKNWKS
FT                   NQKNSGCLPEERAWLTKLFDDVGYVDVFRTLDPRPEQYTWWSNRGQAYAKNVGWRIDYQ
FT                   IATPGVAGTAKNTSIFRDIKFSDHAPLTVDYDYK"
FT   gene            complement(77436..78500)
FT                   /locus_tag="GBP346_A0091"
FT   CDS_pept        complement(77436..78500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0091"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98584"
FT                   /db_xref="GOA:C4KMA0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMA0"
FT                   /protein_id="ACQ98584.1"
FT                   /translation="MSTTYAYAATSATTPLAPFEFARRALRDLDVQIEILYCGVCHSDL
FT                   HQARNEWKNTTYPVVPGHEIVGRVTAVGAQVTRFEAGELVGVGCLVDSCRTCPSCAQGL
FT                   EQYCENGFVGTYNGRDRATGDITYGGYSTQIVVDEAFVLRVPDTLDPAGAAPLLCAGIT
FT                   TYSPLRQWGAGPGKKVGIVGLGGLGHMGVKLARAMGAHVVLFTTSPSKIEDGKRLGAHE
FT                   VVISKDEAQMNAHLNSFDFILNTVAAQHDLNPFIGLLKLDGTMTLVGAPEHDHPSPRVF
FT                   NLIYKRRRLAGSLIGGIAETQEMLDFCAQHGITSDIEVIPMSQINAAYERMLTSDVKYR
FT                   FVIDIGSIRPQRAA"
FT   gene            78710..79654
FT                   /locus_tag="GBP346_A0092"
FT   CDS_pept        78710..79654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0092"
FT                   /product="AraC-type transcriptional regulator N-terminus
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF06719"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97936"
FT                   /db_xref="GOA:C4KMA1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMA1"
FT                   /protein_id="ACQ97936.1"
FT                   /translation="MSFEPLFADGGARLQRRILALFGQLAPNEGYTHAALDGVRFIRSN
FT                   RPVPRMPVLYDPSIVVVCQGRKRGYVGERSFVYDAQQYLVLSVPLPFECETFATPDEPF
FT                   LAISIRIDLAVIAELAILLDETHGASVSEPRGIYSTPLDAPLADAVLRLLEALASPADT
FT                   RVLGPAIMREIGYRVLTGAQGDAIRAALAQQHHFGRVARALRRIHADLSGELDVETLAS
FT                   EAGMSLAVFHAQFKSVTATSPMQYVKATRLHHARLMMVQDGLNAGAAAARVGYASASQF
FT                   SREFKRLFGRSPSDEVRWVQAGGRQPVALEAGE"
FT   gene            complement(80028..81080)
FT                   /locus_tag="GBP346_A0093"
FT   CDS_pept        complement(80028..81080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0093"
FT                   /product="peptidase, M48 family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96192"
FT                   /db_xref="GOA:C4KMA2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMA2"
FT                   /protein_id="ACQ96192.1"
FT                   /translation="MQAKLRVARAALTFVGGVALGVAGPALGFELCMAEPMLVADNGAP
FT                   PVPSAPAVATPAAPAAAPAAGNPQPYALGDQQVRYGNAIVFRSLIPSPLLEQLTDNEYR
FT                   QTVQDAAQRKRLLPPNNARVKRLRTIVMRLAPYAVKWSERVKGWNWEIEVLRSRSIRAF
FT                   CLPGGKVLVDSGLLERLRLTDDELGVLFAHEIAHALREHARSSLGEQQAASLGTGATPL
FT                   PPLFGLSEPLPAPLGVVERFASVRYDPTDETEADVIGGDIAARAGFDPRAAITLWDKLA
FT                   VATRADKDNGFIHAHPYDTRRRNDLRKRLADLMPLYRKALVKNADARANAAGAGAAAGA
FT                   KQRGAAAANR"
FT   gene            complement(81070..82383)
FT                   /locus_tag="GBP346_A0094"
FT   CDS_pept        complement(81070..82383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0094"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96639"
FT                   /db_xref="GOA:C4KMA3"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMA3"
FT                   /protein_id="ACQ96639.1"
FT                   /translation="MTKPPHDAPALNAHEDHPGWRAFLNTHMLICVFLGFTSGLPLFTL
FT                   VYLVQAWLRSEGVNLKEIGLFALIQFPYTWKFLWAPLMDRFIPRLPGWRPGRRRGWMFV
FT                   TQLLVAGAIAALGFVSPRESIWTVAALTTLVAFFGASADIVIDAYRRELLRDTEQGLGN
FT                   AVHVNAYKVAALIPGSLSLILSDHLPWDAVFALTAAFMLPGILMTLVVREPDVHGAPPK
FT                   NLSEAVIMPFREFIGRDGWRGALLVLGFIFLYKLGDTMATTLSTSFFLDLGFNKTQIGV
FT                   IAKTTAFWASLAGGIIGGVWLVKIGIARGLWIFGVLQIVSTLGFAWLAKAGPDPVLMAA
FT                   IYGFETFSTGLTLAAFTAYIASTTDPRYTATQFALFTSLASVPRTLASASSGFIVAQIG
FT                   WFDYFLVCAALGIPGMLLLFKIAPWNGSMSGNEAARAG"
FT   gene            complement(82395..83009)
FT                   /gene="metW"
FT                   /locus_tag="GBP346_A0095"
FT   CDS_pept        complement(82395..83009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="GBP346_A0095"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="identified by match to protein family HMM PF07021;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM TIGR02081"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95213"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMA4"
FT                   /protein_id="ACQ95213.1"
FT                   /translation="MNQQALNTLSARADFRAIARWVEPRSTVLDLGCGDGSLLSLLTEE
FT                   LEVSGYGVEINDAGVLASVKNGVNVIQQNLEDGLRLFEDHSFDFAILSQTLQTIHQTAA
FT                   ILRETARVGRECIVSFPNFGYWAHRLSVLRGRMPVSKSLPYQWHNTPNVRVLTIKDFEA
FT                   LAPEVGVAILDRVVLHEGQPIRWGVNWRGSLAVYRVKRRQP"
FT   gene            complement(83006..84151)
FT                   /gene="metX"
FT                   /locus_tag="GBP346_A0096"
FT   CDS_pept        complement(83006..84151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="GBP346_A0096"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95122"
FT                   /db_xref="GOA:C4KMA5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMA5"
FT                   /protein_id="ACQ95122.1"
FT                   /translation="MESIGVVAPHTMHFAEPLRLQSGSVLGNYQLVVETYGELNAARSN
FT                   AVLVCHALNASHHVAGVYADDPRSTGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTG
FT                   PMSIDPATGTPYGARFPVVTVEDWVHAQARVADAFGIERFAAVMGGSLGGMQALAWSLL
FT                   YPERVAHCIDIASTPKLSAQNIAFNEVARSAILSDPDFHGGDYYAHGVKPRRGLRVARM
FT                   IGHITYLSDDDMAEKFGRALRRADGALDAYNFNFDVEFEVESYLRYQGDKFADYFDANT
FT                   YLLITRALDYFDPAKAFNGDLSAALAHTKAKYLIASFMTDWRFAPARSREIVKALLDNR
FT                   RSVSYAEIDAPHGHDAFLLDDARYHNLVRAYYERIAEEVGA"
FT   gene            complement(84500..85192)
FT                   /locus_tag="GBP346_A0097"
FT   CDS_pept        complement(84500..85192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0097"
FT                   /product="nucleoid occlusion protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95744"
FT                   /db_xref="GOA:C4KMA6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMA6"
FT                   /protein_id="ACQ95744.1"
FT                   /translation="MQPTHPHDPAVTAAAENERSAATASRTRPKPGERRVHILQTLASM
FT                   LEAPKSEKITTAALAARLDVSEAALYRHFSSKAQMFEGLIEFIEETFFGLVNQIAANEP
FT                   NGVLQARSIALMLLNFSAKNPGMTRVLTGEALVGEHERLAERVNQMLERVEASIKQCLR
FT                   VALLEAQAHAAGGGAPPPVPLPDDYDPALRASLVISYVLGRWHRYAKSGFTKAPGEHAD
FT                   AQLRLILQ"
FT   gene            complement(85159..85962)
FT                   /locus_tag="GBP346_A0098"
FT   CDS_pept        complement(85159..85962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0098"
FT                   /product="HAD-superfamily hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509; match to protein
FT                   family HMM TIGR01993"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99175"
FT                   /db_xref="GOA:C4KMA7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMA7"
FT                   /protein_id="ACQ99175.1"
FT                   /translation="MSARRQPRRPASPAASEQAPERPRRRRARPQAGGPVWLFDLDNTL
FT                   HHASHAIFPAINRAMTQYIIDTLKVERAHADHLRTHYTRRYGAALLGLARHHPIDPHDF
FT                   LKVVHTFADLPSMVRAERGLARLVAALPGRKIVLTNAPETYARAVLRELKIDRLFERVI
FT                   AIEQMRDRRAWRAKPDATMLRRAMRAAHARLPDAILVEDTRGHLKRYKRLGIRTVWITG
FT                   HLPGHLPSYGRPHYVDRRIGSLKSLRLGTRSGRRKCSRLTRMTRQ"
FT   gene            complement(85959..87014)
FT                   /locus_tag="GBP346_A0099"
FT   CDS_pept        complement(85959..87014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0099"
FT                   /product="acetylglutamate kinase (NAG kinase) (AGK)
FT                   (N-acetyl-L-glutamate 5-phosphotransferase)"
FT                   /EC_number="2.7.2.8"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97564"
FT                   /db_xref="GOA:C4KMA8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMA8"
FT                   /protein_id="ACQ97564.1"
FT                   /translation="MRIAQENLTFPAAAPDFDTPAAHRPNGQKPHAALRHSCTIPPVST
FT                   FRTRAAAMSEPIDLSQISPALKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGF
FT                   ARDVILLKLVGINPVIVHGGGPQIDQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGE
FT                   VQQDIVTLINHFGGHAVGLTGKDGGLIHARKLMMPDRDNPGEYVDIGQVGEVEAINPAV
FT                   VKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLATVLNAEKLVMMTNIPGVMDKEG
FT                   NLLTDLSAREIDALFEDGTISGGMLPKISSALDAAKSGVKSVHIVDGRIEHSVLLEILT
FT                   EQPFGTMIRSH"
FT   gene            complement(87035..87157)
FT                   /locus_tag="GBP346_A0100"
FT   CDS_pept        complement(87035..87157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0100"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96320"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMA9"
FT                   /protein_id="ACQ96320.1"
FT                   /translation="MWAKRSRNEHRRRPQRPIRRRDAAARSSLAAGSRAATCQA"
FT   gene            87183..87434
FT                   /locus_tag="GBP346_A0101"
FT   CDS_pept        87183..87434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96733"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMB0"
FT                   /protein_id="ACQ96733.1"
FT                   /translation="MTEPAATPGLISKRCPRCGSAFDCGARTRPFTCWCAAMPAMPAGA
FT                   QPATGARCLCPACLADEIARRVAASTAGEGPARPERED"
FT   gene            87452..88732
FT                   /locus_tag="GBP346_A0102"
FT   CDS_pept        87452..88732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0102"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95418"
FT                   /db_xref="GOA:C4KMB1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMB1"
FT                   /protein_id="ACQ95418.1"
FT                   /translation="MQRITTTGRVNLSHLFWLRNLAIIGQLVTIAVVQTYFGVHLPLPA
FT                   MLMVIALEIVFNALTWVRVLRARPETNFELLGQLWVDLGALSALLFLSGGTTNPFVSLY
FT                   LPSLAIAAAVLPWHLMIWLAAFAVACYLALGFDSVPLNLDNPANLFDYFRAGMWVNFMV
FT                   SVGLIAWFVARMSSALRQRDAALGEAQQALLRDERAVALGVQAATVAHEMGTPLSTIAM
FT                   LTEELREAARTDAGLARYDADLKVLEEQMSQCTSALARLRSRASERPSREPVGEWLDTF
FT                   VEHWRLRHPHVLFEQRGPQPVGVALDDTVAVGQILTILLDNAARASRDRVTLAATIAHD
FT                   GARDEIEFEVCDNGPGIPAALRDTLGAAPVDSTQGGHGVGLYLAFSAAARLGGSIELAD
FT                   AQPRGTRAILRLPVARQVAAEMANENG"
FT   gene            88752..89294
FT                   /locus_tag="GBP346_A0103"
FT   CDS_pept        88752..89294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0103"
FT                   /product="photosynthetic apparatus regulatory protein RegA"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96844"
FT                   /db_xref="GOA:C4KMB2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMB2"
FT                   /protein_id="ACQ96844.1"
FT                   /translation="MSDKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGA
FT                   EKFEFITVDLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAK
FT                   PANVESILAALQTNASEVQAEEALENPVVLSVDRLEWEHIQRVLAENNNNISATARALN
FT                   MHRRTLQRKLAKKPVRQ"
FT   gene            complement(89728..91071)
FT                   /gene="hslU"
FT                   /locus_tag="GBP346_A0104"
FT   CDS_pept        complement(89728..91071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="GBP346_A0104"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="identified by match to protein family HMM PF07724;
FT                   match to protein family HMM TIGR00390"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96361"
FT                   /db_xref="GOA:C4KMB3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMB3"
FT                   /protein_id="ACQ96361.1"
FT                   /translation="MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLR
FT                   QEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLI
FT                   EISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASAEHANDDNNATRQTFR
FT                   KRLREGQLDDKEIELDIEQPAVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIK
FT                   EALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGV
FT                   QRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLS
FT                   VKDFEAILVATDASLVKQYQALLATEDVKLEFADDGIRRLAEIAYAVNEKTENIGARRL
FT                   YTVIEKLLEEVSFAAGNHAGQSVTIDSAYVDHALGEVSKDEDLSRYVL"
FT   gene            complement(91081..91716)
FT                   /gene="hslV"
FT                   /locus_tag="GBP346_A0105"
FT   CDS_pept        complement(91081..91716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="GBP346_A0105"
FT                   /product="heat shock protein HslVU, ATP-dependent protease
FT                   subunit HslV"
FT                   /EC_number="3.4.25.-"
FT                   /note="identified by match to protein family HMM PF00227;
FT                   match to protein family HMM TIGR03692"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96022"
FT                   /db_xref="GOA:C4KMB4"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMB4"
FT                   /protein_id="ACQ96022.1"
FT                   /translation="MRVEPAGQARSRAPQHAAAPRAPRLSRLSRGIQMEQFHGTTILSV
FT                   RRGDKVALGGDGQVTLGNIVMKGGARKVRRIYNNQVLVGFAGGTADAFSLLDRFEAKLE
FT                   KHQGNLTRAAVELAKDWRTDRLLRRLEAMLIAADATTTLVITGNGDVLDPEGGICAIGS
FT                   GGSYAQAAARALAENTDLSPREIVEKALGIAGDMCIYTNHNRIIETIE"
FT   gene            complement(91872..92288)
FT                   /gene="dksA"
FT                   /locus_tag="GBP346_A0106"
FT   CDS_pept        complement(91872..92288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="GBP346_A0106"
FT                   /product="RNA polymerase-binding protein DksA"
FT                   /note="identified by match to protein family HMM PF01258;
FT                   match to protein family HMM TIGR02420"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95559"
FT                   /db_xref="GOA:C4KMB5"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMB5"
FT                   /protein_id="ACQ95559.1"
FT                   /translation="MTKKLLTEAEILKMSDKDYMNEDQLAFFKNRLEQLQAEILRNAGQ
FT                   TTENLRETVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSLARIESGDYGWCEET
FT                   GEPIGIPRLLARPTATLSLEAQERRELRQKLFGD"
FT   gene            complement(92827..93903)
FT                   /locus_tag="GBP346_A0107"
FT   CDS_pept        complement(92827..93903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0107"
FT                   /product="cobalamin synthesis protein/P47K family protein"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM PF07683"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96987"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMB6"
FT                   /protein_id="ACQ96987.1"
FT                   /translation="MAIPVTILTGFLGSGKTTLLKRILNEQHGMKIAVIENEFGEENID
FT                   NEILVQDSTEQIIQMSNGCICCTIRGDLARALADLAAKKRDGTFDFDRVVIETTGLANP
FT                   GPVAQTFFIDSEIADEFLLDAVITLVDAKHANAQLDEHEVVQRQVGFADRLFITKADLV
FT                   DDEAVSELKHRLLHMNPKAAIKVVNFGDADIKEIFDLRGFNLNAKLEIDPDFLAEDDHA
FT                   HAHHDDHDHDHAHCDHDHGHCEHDHGHGHHDHHHAHHDDKIKSFVYRNDRPFDPNKLED
FT                   FLGGILQIYGERMLRYKGVLYMKGVDRKVVFQGVHQMMGSDLAAKWLPAEKKTNKMVFI
FT                   GVDLPRDLITDGLDACLA"
FT   gene            complement(94081..95358)
FT                   /locus_tag="GBP346_A0108"
FT   CDS_pept        complement(94081..95358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0108"
FT                   /product="PUA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96532"
FT                   /db_xref="GOA:C4KMB7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMB7"
FT                   /protein_id="ACQ96532.1"
FT                   /translation="MHTVTLKPSKDKSLLRRHPWVYANAIDRVDGKPAPGATVIVRAHD
FT                   GRFLTRAAYSPHSQIRLRVWSFDENEPIDHAFFKRRVQRALAHRRAMISGTDAVRLVFG
FT                   EADGLPGLIVDYYVAARGAAHTGDAAARAAEGGAAAAVAPGDGEGRGQLVCQFMAAGVE
FT                   HWKGAIVAALVAATGCPNVYERSDVSIREKEGLEQTTGVLAGDAPPDTLIANENGVLYH
FT                   VDVRNGHKTGFYVDQRENRALVAQYARDRDVLNCFCYTGGFSLAALKGGAKRVVSIDSS
FT                   GDALALAQRNVAANGFDAARAQWLDADAFKTLRRLVDEGERFDLIVLDPPKFAPTRDSV
FT                   DRAARAYKDINLSGLKLLRPGGLLFTYSCSGAIDMDLFQKIVADAAADAKVDARILKRL
FT                   GAGVDHPLLTAFPEGEYLKGLLLQIA"
FT   gene            complement(95447..96379)
FT                   /gene="xerC"
FT                   /locus_tag="GBP346_A0109"
FT   CDS_pept        complement(95447..96379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="GBP346_A0109"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899; match to protein
FT                   family HMM TIGR02224"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98341"
FT                   /db_xref="GOA:C4KMB8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMB8"
FT                   /protein_id="ACQ98341.1"
FT                   /translation="MTAKPIADPIVDYLSNLRHVRKLSDHTLRAYAHELDELKRLANGR
FT                   PLDSLTAVDMRSAVARAHAGGLSARSISHRLSAWRAFYRWFSQHVEMNANPVAAVRAPK
FT                   RAKTLPKALSVDDTAALMDAPTAGTAESLRDHAILELFYSSGLRLAELIGLDIEYVKDG
FT                   AYRSAGWLDLAEAEVTVRGKGDKERKVPVGRKALDALHAWLAVRGEFVKHDPRPLFLSV
FT                   RGNRMSPGVVRERVKRAALAAGIPANVHPHVLRHSFATHVLQSSGDLRAVQELLGHASI
FT                   SATQVYTSLDFQHLAKIYDSAHPRAKKRD"
FT   gene            complement(96410..97123)
FT                   /locus_tag="GBP346_A0110"
FT   CDS_pept        complement(96410..97123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04340"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97974"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMB9"
FT                   /protein_id="ACQ97974.1"
FT                   /translation="MNDREVADYLLANPEFFAQHAELLATIKLANPHGKAAVSLQERQM
FT                   EMLREKNKHLERRLAELLRYGHENDGLAAKFNRWTARVIAERDPYALPRAIAGGLADVF
FT                   DVPQTALRLWDVAETYAQADFARNVGEEVRLFTNSLATPYCGANTGFEAAQWLTPVAAP
FT                   PAADDGEAPAASGAAESVALIALRASAEGEGAGAFGLLVLGSPDPRRFHDGMGTDFLTQ
FT                   IGTLASAALTRLLPH"
FT   gene            complement(97171..98040)
FT                   /gene="dapF"
FT                   /locus_tag="GBP346_A0111"
FT   CDS_pept        complement(97171..98040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="GBP346_A0111"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="identified by match to protein family HMM PF01678;
FT                   match to protein family HMM TIGR00652"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ94988"
FT                   /db_xref="GOA:C4KMC0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMC0"
FT                   /protein_id="ACQ94988.1"
FT                   /translation="MKLSFTKMHGAGNDFVVLDGYTRALPPLTGAQVRALADRHFGIGA
FT                   DQLLLVEKPTVDGADFKYRIFNCDGGEVEHCGNGARCFVKFVRDHGLTGKASVRVEVKH
FT                   GVITLTMQDNGEVVVDMGAPVFEPARVPFDASGLDGRREGADTLWPLPVNGVTRWISVV
FT                   SMGNPHAVQIVDDAEAFAVRVDGPAIERDPRFPQRVNAGFMQIVSRHEVNLRVYERGAG
FT                   ETLACGTGACAAVAAGIRRGRLDSPVTVHTHGGTLTISWNGACDERAPLMMAGPATTVF
FT                   EGVIELPA"
FT   gene            complement(98081..98965)
FT                   /locus_tag="GBP346_A0112"
FT   CDS_pept        complement(98081..98965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0112"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /note="identified by match to protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97994"
FT                   /db_xref="GOA:C4KMC1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMC1"
FT                   /protein_id="ACQ97994.1"
FT                   /translation="MLGRLGTRLAVAFLKFLAVLPYGLTARLGDGLGWLLYRIPSRRKR
FT                   IVHINLQLCFPDWSDARREEIAGRHFRHAIRSYVERSVQWFGSAKKLEKLIQVDSAIDL
FT                   TDPNLPPTLFLGLHFVGIEAGSIWLNRSLQRRCGSLYQPFSNPTLEAIAKAARGRFDAE
FT                   MVGRADSARVVLRWLRDRKPVMLGADMDYGLRNSTFVPFFGVPACTLTAVGRLARTGHA
FT                   QVVPFIGEVLPDYQGYRLKVFKPWENYPTGDDDLDARRMNAFLEEQIPLMPEQYYWVHK
FT                   RFKTRPPGEPGVY"
FT   gene            99231..100418
FT                   /gene="metK"
FT                   /locus_tag="GBP346_A0113"
FT   CDS_pept        99231..100418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="GBP346_A0113"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96149"
FT                   /db_xref="GOA:C4KMC2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMC2"
FT                   /protein_id="ACQ96149.1"
FT                   /translation="MANDYLFTSESVSEGHPDKVADQISDAILDAILAQDKYSRVAAET
FT                   LCNTGLVVLAGEITTTANIDYIQIARDTIKRIGYDNTDYGIDYRGCAVLVAYDKQSPDI
FT                   AQGVDRAHDNNLDQGAGDQGLMFGYACDETPELMPLPIHLSHRLVERQANLRRDGRLPW
FT                   LRPDAKSQVTVRYVDGKPHSIDTVVLSTQHAPEIDLPALREAVIEEVIKPTLPADLIKG
FT                   DIKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYA
FT                   GRYVAKNIVAAGLASRALIQVSYAIGVAEPTSVMVNTFGTGRVSDETITKLVREHFDLR
FT                   PKGIIQMLDLLRPIYEKTAAYGHFGREEPEFSWEAADKALALAEAAGVEPAVQVA"
FT   gene            complement(100585..100938)
FT                   /locus_tag="GBP346_A0114"
FT   CDS_pept        complement(100585..100938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96623"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMC3"
FT                   /protein_id="ACQ96623.1"
FT                   /translation="MPFRLTSRLHRTPKSAPSAPHRIMRALRHHSARSSVLAERARQHQ
FT                   PRLDGLRAWLHAFLSLMSAHAAARRTALRSLLQKPALRLRAPSLHRASVAPRRINRPRR
FT                   LATSTGWFVFAAR"
FT   gene            101155..102075
FT                   /locus_tag="GBP346_A0115"
FT   CDS_pept        101155..102075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0115"
FT                   /product="phytanoyl-CoA dioxygenase"
FT                   /note="identified by match to protein family HMM PF05721"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97739"
FT                   /db_xref="GOA:C4KMC4"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMC4"
FT                   /protein_id="ACQ97739.1"
FT                   /translation="MAGARPTVPLRYIKFAATIARRFSLRGMVASMSRTSVLQSFIDNN
FT                   DADHPMSSLHPELIHTQVQTLRERGFVVAPGLVAPERCAQLKTIAERQLREAAQPLEFE
FT                   ADLRYPGAPESRHAPGGHTVRRLLDAYARDAAFAERATAPEIGAWMRAYFDETPVLSRA
FT                   HHNCVMTKHPAYGSLTGWHRDVRYWSFERPDLVSVWLALGPETDDNGALWLVPGSHGAE
FT                   FGPERFDEAKFFRGDVPANRRLIEQAVCPALAAGDVVFFHCNTLHSAGQNRSDQVKFSL
FT                   VFTYHGDSNRPVPGSRSASKPEVRF"
FT   gene            complement(102347..102553)
FT                   /locus_tag="GBP346_A0116"
FT   CDS_pept        complement(102347..102553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97422"
FT                   /db_xref="GOA:C4KMC5"
FT                   /db_xref="InterPro:IPR021521"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMC5"
FT                   /protein_id="ACQ97422.1"
FT                   /translation="MTRAISVALIVGGVVLLYFGGQSFHSINDGVARFFTGSPSTKTIM
FT                   LIAGGVVATLVGLIGLSMPSGKR"
FT   gene            102728..103771
FT                   /locus_tag="GBP346_A0117"
FT   CDS_pept        102728..103771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0117"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96612"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMC6"
FT                   /protein_id="ACQ96612.1"
FT                   /translation="MAYEAASERYADMQYRVSGKSGLKLPALSLGLWHNFGDTTPISTQ
FT                   REILRTAFDLGITHFDLANNYGPPYGSAETNFGRLLREDFKPYRDELLISTKAGWDMWP
FT                   GPYGSGGGSRKYVLASLDQSLRRMGLDYVDIFYSHRFDAHTPLEETASALASAVQQGKA
FT                   LYVGVSSYSAASTREIAKLLAEYKVPLLIHQPAYNMLNRWIERELLDALDETGSGCIAF
FT                   TPLAQGLLTSKYLNGVPADARINKPGGGSLKEAHLSAENLEHVRKLNEIAQRRGQSLAQ
FT                   MALAWVLRDSRVTSALIGASRAEQVRENVAALAHLAFSDDEIAEIDRYATEGGINLWEK
FT                   PSTDQAI"
FT   gene            complement(103814..103999)
FT                   /locus_tag="GBP346_A0118"
FT   CDS_pept        complement(103814..103999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96273"
FT                   /db_xref="GOA:C4KMC7"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMC7"
FT                   /protein_id="ACQ96273.1"
FT                   /translation="MSTYFTIADFILLIPMALAGALFLGAVPCATEFRHNVLRVLGAML
FT                   GVAVAVLLVEGLPALI"
FT   gene            complement(104267..105130)
FT                   /locus_tag="GBP346_A0119"
FT   CDS_pept        complement(104267..105130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0119"
FT                   /product="permease of the drug/metabolite transporter"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95401"
FT                   /db_xref="GOA:C4KMC8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMC8"
FT                   /protein_id="ACQ95401.1"
FT                   /translation="MASVRPALAAHGATSLFVLLWSSGAIFAELGLRHASAFAFLIARF
FT                   ALASLVLLVLSLARRRWLPPRGARRATLATGLLLTGGYSILYLLALERGLAPGILATIL
FT                   GVQPILTLAVLERRASPARLAGLALALTGLSLVVYRSVAGGAAPAAGTACALGALLAIT
FT                   AGALLQKRVRAAPIDVLPLQNALGLALCALIAPFEPISFEASWAFALPLAWLGIVISVF
FT                   AQLLFYRLMQRGDLVNVTSLFYLVPVVTALMDAAWLGNRLAPLEIAGMIAILAGLALAF
FT                   RRAARD"
FT   gene            complement(105252..105488)
FT                   /locus_tag="GBP346_A0120"
FT   CDS_pept        complement(105252..105488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95080"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMC9"
FT                   /protein_id="ACQ95080.1"
FT                   /translation="MIARRLRGRRGCRIAHRCVTFDVPALSFALFAPFAMKPSLPARAV
FT                   SKPPIARLPRACAHRPPAAPPPVGAPPPPAARG"
FT   gene            complement(105485..106774)
FT                   /locus_tag="GBP346_A0121"
FT   CDS_pept        complement(105485..106774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0121"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98456"
FT                   /db_xref="GOA:C4KMD0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMD0"
FT                   /protein_id="ACQ98456.1"
FT                   /translation="MTVPPGAPRPAAAGRANSAHAAQGASPVGAAPYLERGSRGYWHAS
FT                   VALLFAGYATFSLLYYVQPLLPEFSKAFGVSPAQSSLALSFATAALAAAVFVAGFVSEA
FT                   LSRHRLMTASLTASSLLTLAAAFAPHWHQLLILRALTGLALGGVPAVAMAYLAEEVHPD
FT                   GLGLAMGLYVGGTAIGGMAGRVITGILTDLFSWRIAVGAIGVLGLASMLAFRMLLPPSR
FT                   HFVPRRGLNLAHHRTSLAHHLRGQRELPVLFAMAFVLMGSFVTLYNYIGYRLLAPPYSM
FT                   GQATIGAIFVVYLVGVVASPLSGRLADTLGRGRVLIASLAVMLGGVALTLLHPVAAIVA
FT                   GVACVTFGFFAGHAVASGWVGRLAQHGKGQAAALYLLAYYLGSSVVGSLGGRFWSTLGW
FT                   PGVAALVGALLALGVVAAAWLRARERGGAA"
FT   gene            106786..106917
FT                   /locus_tag="GBP346_A0122"
FT   CDS_pept        106786..106917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96750"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMD1"
FT                   /protein_id="ACQ96750.1"
FT                   /translation="MRGKPQRYAGCPFGVVSSDDALAFGRISECRMNHRMAAARVGV"
FT   gene            complement(106998..107129)
FT                   /locus_tag="GBP346_A0123"
FT   CDS_pept        complement(106998..107129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMD2"
FT                   /protein_id="ACQ95058.1"
FT                   /translation="MMFPRFQSRPRAARPEIPELRIHDATKRTHSIVHRSWNRESAS"
FT   gene            107128..107340
FT                   /locus_tag="GBP346_A0124"
FT   CDS_pept        107128..107340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95442"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMD3"
FT                   /protein_id="ACQ95442.1"
FT                   /translation="MHVGSIVCTTHIAVPKGARGIVQRILGDMAMVTWYAGVPGESKEL
FT                   NTEPFFLEDLIDTGESVLPAGAALH"
FT   gene            107381..108412
FT                   /locus_tag="GBP346_A0125"
FT   CDS_pept        107381..108412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0125"
FT                   /product="phosphotransferase family protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98596"
FT                   /db_xref="GOA:C4KMD4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMD4"
FT                   /protein_id="ACQ98596.1"
FT                   /translation="MNDATSESNAAGACAGLPFAGLTPERVLDALDSVLIPAGSRTDGR
FT                   LLALNSYENRVYQAGIEDGAPIVAKFYRPQRWSNDAILEEHTFVAELAAREIPAVPPLA
FT                   FDGRTLHEFDGFRFAIFERRGGRAPELDRRDTLEWLGRFIGRIHAVGATKPYAARPTLD
FT                   LRTFGYEPRDFLMSHDFVPGDVRPAYEAAVALALEGVERAYERAGDVRMLRAHGDCHPS
FT                   NVLWTDAGPHFVDFDDSRMAPAVQDLWLLLPGDRPGASRALTDLLAGYEDFCEFDPREL
FT                   HLIEALRTLRLIHYAAWLARRWDDPAFPAAFPWFNTHRYWEARVLELREQIGAMQEGPL
FT                   WPV"
FT   gene            complement(108683..108931)
FT                   /locus_tag="GBP346_A0126"
FT   CDS_pept        complement(108683..108931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99055"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMD5"
FT                   /protein_id="ACQ99055.1"
FT                   /translation="MLGRRARRRARPGVGQPAGGADEGAAASGRASMLHVEGVVYRSVC
FT                   ATPARSVELTLAYRQDNDNPLFGAPKDVPRKSLTASR"
FT   gene            complement(109065..110483)
FT                   /locus_tag="GBP346_A0127"
FT   CDS_pept        complement(109065..110483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0127"
FT                   /product="coniferyl aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.68"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97414"
FT                   /db_xref="GOA:C4KMD6"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMD6"
FT                   /protein_id="ACQ97414.1"
FT                   /translation="MKNDLPGLATLDALLRDQRAAYLRAPYPSWATRADHLRALRKMLL
FT                   ENRDALAAAINADFGHRAKEEVLMSEIWLAKEEIDEALKHGKRWIKPKSRTMNKWLRPA
FT                   RAKVMPQPLGVVGIVVPWNYPVLLAAGPLICALAAGNRAIVKMSELTPRTSQLFEELIS
FT                   KTFARDHVAVVNGDAQIGAAFSGLPFDHLLFTGSTNVGRHVMRAAAEHLTPVTLELGGK
FT                   SPVIVGPRARFDAAVDAVITGKTLNAGQTCIAPDYVLVPRGKEAEFVARARARMARLYP
FT                   NLSTNPDYTSIISERHFARLQRLASEAQQAGAQLHPLTDAAPDPALRRLPPVLVTQAPD
FT                   ASQLMQEEIFGPLLPIVPYDTLDDAIAYVNARPRPLALYLFDEDRTTIERVMRDTISGG
FT                   VTVNDTLMHIACGTLPFGGVGASGMGAYHGYDGFVTFSKMKPVLTQPRLNTRAMIAPPY
FT                   GKRFAAILKLMLKF"
FT   gene            complement(110518..112197)
FT                   /locus_tag="GBP346_A0128"
FT   CDS_pept        complement(110518..112197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0128"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97877"
FT                   /db_xref="GOA:C4KMD7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMD7"
FT                   /protein_id="ACQ97877.1"
FT                   /translation="MQQDLMTATHRVTNQAPPLSDYNAFETDAALVEAVRQYGASWRQT
FT                   ALSHDGAALTTPDVLALAELANRHAPELATHSPRGERIDALEFHPSWHQLLARLRAEGL
FT                   HALPFSDPRPGAMAARCAGYFLHAQLESGSLCPLTMTFASIPVLQREPALFATLRDKLY
FT                   AREHDARDAPLPQKRSMMVGMGMTEKQGGSDVRSNETHAYPLGAGGRGQAYRLVGHKWF
FT                   FSAPQCDAHLVLARTAEQAGISCFYVPRFSPDGSKNAVHVQRLKDKLGNRSNASSEVEF
FT                   LNAYGVMIGDEGRGVPTIIEMANYTRLDCVIGSAALMRAALVQAIHHARHRSAFGRLLA
FT                   DQPLMRNVLADLALESEAATVLFMRLAHAFEEDAAARSPQARGWRRIVTPAAKFWVCKR
FT                   TLEFTGEAMEVWGGNGYVETGPMARFYREAPVNSIWEGSGNVMCIDVLRAIEREPDAAA
FT                   ALFDEWRDAARHSAPLAGALAELTRLLSLEPEPREACARRIAQRIALVAQASLLLRDGP
FT                   YAVAQAFVATRFGHDSSETGRVFGTLPATIDHAALVERAFPA"
FT   gene            complement(112276..112401)
FT                   /locus_tag="GBP346_A0129"
FT   CDS_pept        complement(112276..112401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0129"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95605"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMD8"
FT                   /protein_id="ACQ95605.1"
FT                   /translation="MAAETAIEAAGSGLSCSRILGTQNEPGHPDSRAIPLNVGVN"
FT   gene            112431..114074
FT                   /locus_tag="GBP346_A0130"
FT   CDS_pept        112431..114074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0130"
FT                   /product="alcohol dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.-"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96054"
FT                   /db_xref="GOA:C4KMD9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMD9"
FT                   /protein_id="ACQ96054.1"
FT                   /translation="MQYDYIIVGGGSGGASLAGRLADACPDATIALIEAGGHTERNLLV
FT                   NMPVGIAALVPFKLGTNYGYETVPQPGLGGRRGYQPRGRGLGGSSAINAMIYTRGHPLD
FT                   YDEWEQLGCTGWGWRDVLPYFRRAEGNARGANEWHGADGPLTVSDLRFRNPFSERFIAA
FT                   AHEAGYPLNDDFNGEHQEGVGFYQVTHRDGSRCSVARAYVYGRTRPNLHVIVDATVLRV
FT                   VFDGKRATGVEFARAGRTEQLAARAEVILSAGAFNTPQLLMCSGVGPAAQLRRHGVALV
FT                   HDAPDVGENLIDHIDFIINKRVNSSELVGICMRGIAKMTPALFSYLSGRRGMMTSNVAE
FT                   AGGFIKSEPGLDRPDLQLHFCTALVDDHNRNMHWGFGYSLHVCALRPKSRGNVALASGD
FT                   ARVAPLIDPRFFSDERDLDLLVTGAKAMRRILCAAPLASQGGRELYTDPGDTDAQLRAA
FT                   IVAHADTIYHPVGTCRMGTDARAVVDPQLRVKGVDGLRVVDASVMPTLIGGNTNAPTVM
FT                   IAERAADFIVAARNGQAAPTRERVAATHGG"
FT   gene            complement(114114..115490)
FT                   /locus_tag="GBP346_A0131"
FT   CDS_pept        complement(114114..115490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0131"
FT                   /product="flagellar hook-length control protein FliK"
FT                   /note="identified by match to protein family HMM PF02120"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98592"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:C4KME0"
FT                   /protein_id="ACQ98592.1"
FT                   /translation="MLLGAASTMIKSSAGAPGASSGDASSAAPFAQALKQSVQTQRQTG
FT                   ANADAPNAGHAANAATADTAAASSPASGAGDRTTASAGDTKASGKPDDQDDDKHAAQPA
FT                   SADAAALAAAASLQAQLQARPDAQAAQAAAGAAAAQAGAGDAAHPPATPAASAAAGDTD
FT                   ASAPAGAQQPIGDALNAALSKLTGAGRTGTAAVQGAQPAGRNGDASAPLAANGAAFDKL
FT                   LAGAKAPAAQAAPTGASGANPATALANAAANAAPPDVSGALAALQDAADSARATLAASS
FT                   APAALQQAAPAALAANASAAAASAAPSLAPPVGTPDWTDALSQKVVFLSNAHQQSAELT
FT                   LNPPDLGPLQVVLRVADNHAHALFVSQHAQVRDAVEAALPKLREAMEAGGLGLGSASVS
FT                   DGGFASAQQQQTPQRQSSDGSATRRAFGASTADASLDELAAASSSGAARRTVGMVDTFA
FT                   "
FT   gene            complement(115547..115999)
FT                   /gene="fliJ"
FT                   /locus_tag="GBP346_A0132"
FT   CDS_pept        complement(115547..115999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /locus_tag="GBP346_A0132"
FT                   /product="flagellar export protein FliJ"
FT                   /note="identified by match to protein family HMM PF02050;
FT                   match to protein family HMM TIGR02473"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95132"
FT                   /db_xref="GOA:C4KME1"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="InterPro:IPR018006"
FT                   /db_xref="UniProtKB/TrEMBL:C4KME1"
FT                   /protein_id="ACQ95132.1"
FT                   /translation="MAQSFPLQLLLERAQDDLDTAAKQLGRAQRERTDAQAQLDALMRY
FT                   RDEYRVRFAESAQSGMPAGNWRNFQAFLDTLDAAIEQQRRVLAAAQTRIDAARPEWQAK
FT                   KRTLGSYEILQARGARQDAQRAAKREQRDADEHAAKVLRMRADAAK"
FT   gene            complement(116005..117576)
FT                   /gene="fliI"
FT                   /locus_tag="GBP346_A0133"
FT   CDS_pept        complement(116005..117576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="GBP346_A0133"
FT                   /product="flagellar protein export ATPase FliI"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM TIGR01026; match to protein
FT                   family HMM TIGR03496"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97788"
FT                   /db_xref="GOA:C4KME2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR020005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:C4KME2"
FT                   /protein_id="ACQ97788.1"
FT                   /translation="MVSDVCGGALGRDELDALERELALASRGPEHEDAAAHGDGFGAHH
FT                   HAPPRPLAMGAPSSRATLANPHLAHWRAHLDGIRERNARALPLRPCGRLTRAAGLVLEA
FT                   IGLRLSVGAECTIELPAGSALPYAQAEVVGFAGERLFLMPTTAVAGVLPGARVWPLESA
FT                   PVADPLAGAKRLPVGWEMLGRVVDASGRPLDNLGPLASKVDAPLTAPSINPLDREPIHH
FT                   VLDVGVRAINGLLTVGRGQRMGLFAGSGVGKSVLLGTMARYTSAEVIVIGLIGERGREV
FT                   KEFIEQILGEDGLARSVVVAAPADVSPLLRMQGAAYATTLAEYFRDQGKHVLLLMDSLT
FT                   RYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERTGNGPEGGGSITAFYTVLTEGDD
FT                   QQDPIADSARAILDGHVVLSRSLAEAGHYPAIDIEASISRAMTALIDDAHLDRVRQFKQ
FT                   MLSRYQRNRDLIAVGAYAPGRDAQLDRAIALYPRIESFLQQGFRECAPYAPSLAALDAL
FT                   FESEGG"
FT   gene            complement(117570..118250)
FT                   /locus_tag="GBP346_A0134"
FT   CDS_pept        complement(117570..118250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0134"
FT                   /product="flagellar assembly protein H"
FT                   /note="identified by match to protein family HMM PF02108"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98938"
FT                   /db_xref="GOA:C4KME3"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:C4KME3"
FT                   /protein_id="ACQ98938.1"
FT                   /translation="MSDRASASDKPVTAYQRWEMASFDPPPPPPPDDGGAAAAALAAEL
FT                   QRVRDAAHAEGLAAGHVEGQALGYQAGYEQGRAKGFDEGQAEAHTHAAQLAALAASFRD
FT                   ALAGVERDLADDIATLALEIAQQVVRQHVQHDPAALIAAAREVLAAEPALAGAPHLIVN
FT                   PADLPVVEAYLKDELDTLGWSVRTDTSIERGGCRAHASTGEIDATLATRWERVAAALGK
FT                   VSAW"
FT   gene            complement(118243..119238)
FT                   /gene="fliG"
FT                   /locus_tag="GBP346_A0135"
FT   CDS_pept        complement(118243..119238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="GBP346_A0135"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="identified by match to protein family HMM PF01706;
FT                   match to protein family HMM TIGR00207"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96877"
FT                   /db_xref="GOA:C4KMS9"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMS9"
FT                   /protein_id="ACQ96877.1"
FT                   /translation="MNAEGLNKSALLLMSIGEEEAAQVFKFLAPREVQKIGAAMAALKN
FT                   VTREQVEDVLNDFVQEAEKHTALSLDSSEYIRTVLTKALGEDKAGVLIDRILQGSDTSG
FT                   IEGLKWMDSAAVAELIKNEHPQIIATILVHLDRDQASEIASCFTERLRNDVLLRIATLD
FT                   GIQPTALRELDDVLTGLLSGSDNLKRAPMGGIRTAAEILNFMTSVHEEAVIENVKQYDP
FT                   DLAQKIIDQMFVFENLLDLEDRAIQLLLKEVESEALIIALKGAPPALRQKFLSNMSQRA
FT                   AELLAEDLDARGPVRVSEVETQQRKILQVVRNLAESGQIVIGGKAEDAYV"
FT   gene            complement(119228..121024)
FT                   /gene="fliF"
FT                   /locus_tag="GBP346_A0136"
FT   CDS_pept        complement(119228..121024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="GBP346_A0136"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="identified by match to protein family HMM PF01514;
FT                   match to protein family HMM PF08345; match to protein
FT                   family HMM TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97565"
FT                   /db_xref="GOA:C4KMT0"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMT0"
FT                   /protein_id="ACQ97565.1"
FT                   /translation="MDSQANSLINPDARSSLAGASPQAAAAAGALPGAAAGGADFGLGG
FT                   FAERIPGLSRMKTNPRLPFLIGAALAIAAIVALVLWSRAPDYRVLYSNLSDRDGGAIIA
FT                   ALQQANVPYKFADAGGAILVPANQVHETRLKLAAMGLPKGGSVGFELMDNQKFGISQFA
FT                   EQVNYQRALEGELQRTVESINAVRAARVHLAIPKPSVFVRDREAPSASVLVDLYPGRVL
FT                   DEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQTASATGLDASQLKYVQQIERNTQ
FT                   KRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYGPNGTPQQSAIRSQQTSSSTELA
FT                   QSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPVSDRKDSTTNYELDKTVRHVEQ
FT                   SMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAADKLAQVQQLVKDAMGYDEKRGDSVNV
FT                   VNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAAAALYFMFVRPALRRAFPPP
FT                   AEPAAAAVPALDGPDDVLALDGLPSPDKNQLAEEDEEHPALLAFENERNRYERNLDYAR
FT                   TIARQDPKIVATVVKNWVSDER"
FT   gene            121272..121613
FT                   /gene="fliE"
FT                   /locus_tag="GBP346_A0137"
FT   CDS_pept        121272..121613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="GBP346_A0137"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="identified by match to protein family HMM PF02049;
FT                   match to protein family HMM TIGR00205"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95949"
FT                   /db_xref="GOA:C4KMT1"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMT1"
FT                   /protein_id="ACQ95949.1"
FT                   /translation="MVAPVNGIASALQQMQAMAAQAAGGTSPATSLAGSGAASAGSFAS
FT                   AMKASLDKISGDQQKALGEAHAFEIGAQNVSLNDVMVDMQKANIGFQFGLQVRNKLVSA
FT                   YNEIMQMSV"
FT   gene            121681..122169
FT                   /gene="fliS"
FT                   /locus_tag="GBP346_A0138"
FT   CDS_pept        121681..122169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="GBP346_A0138"
FT                   /product="flagellar protein FliS"
FT                   /note="identified by match to protein family HMM PF02561;
FT                   match to protein family HMM TIGR00208"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96176"
FT                   /db_xref="GOA:C4KMT2"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMT2"
FT                   /protein_id="ACQ96176.1"
FT                   /translation="MPRTVRCIDSNAPKRRNAMFTPGHAGASAYARVGVETGVMGASPH
FT                   RLIAMLYQGARQAIAHARLHLQQGNVAARGEAIGKAIRIVESGLQQALNLEVGGDIASR
FT                   LDSLYTYMCRRLLQANVDASEPMLIEVDGLLATLEDAWTGIAPEVARMNAQAVTEQAR"
FT   gene            122166..122492
FT                   /locus_tag="GBP346_A0139"
FT   CDS_pept        122166..122492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98223"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMT3"
FT                   /protein_id="ACQ98223.1"
FT                   /translation="MNRKDEYFARYEAIAAVSGRMLVAARDAAWHAMGGLQEEYLRLVD
FT                   GLKEAEQGVLLDDAERTRKFELIRRILADDAAIRDLASPEVARLSAFFHAGRSTLKDLY
FT                   RARG"
FT   gene            122602..124155
FT                   /locus_tag="GBP346_A0140"
FT   CDS_pept        122602..124155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98685"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMT4"
FT                   /protein_id="ACQ98685.1"
FT                   /translation="MTGIDTAAAAILASRIDSLLDAIQPAAGGAAAPQVGTSGAPPASA
FT                   APRPAASGPPPASAQTALSEVGLTLDAISRYGGAATPAVVGAAPLLPAAPTAVAVAAQA
FT                   ASLDPLLATPDAAGNPAAAMAPGAQAAQAAPQAALPASPAAALSLALVQAVAQSGLFYE
FT                   SHLAQWLAGQRTTAELAREPQARLASGAEPDAQAGAQPGQMGDALADALADALADLLAV
FT                   RLPLPQGGRDAPAQGAARPPGQPGQPAGGADEGAAASGRAPTNAAAPARSVDAYAALAD
FT                   ADGKPGAPSAQTALARAGMPPTGADTPASIAASLHAATLPIVRQQLDLLATDQFRWIGE
FT                   AWPGARLDWTIEPDEQHGRERSAPDADFPDARGWRTRLTLALPSLGTIDAELVLNGEQL
FT                   AARLRASEAGAARLAPHGEALRARLQALGLQVSGLSIRAIDGVPDSFDAAAARAAASAY
FT                   ARAAAGGEAAAKERFGGAAGATGEAGGAGVEHRASSSSSSSSSSSSSPVETDDDWEFAQ
FT                   "
FT   gene            124152..124469
FT                   /locus_tag="GBP346_A0141"
FT   CDS_pept        124152..124469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0141"
FT                   /product="flagellar biosynthetic protein FlhB domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97946"
FT                   /db_xref="GOA:C4KMT5"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMT5"
FT                   /protein_id="ACQ97946.1"
FT                   /translation="MSGPPRKRAAVLAYDAKGGDTAPRVVAKGYGLVAERIIERARDAG
FT                   LYVHTAPEMVSLLMQVDLDARIPPQLYQAVAELLAWLYALERDAGDGGGAQPAFPPLPK
FT                   R"
FT   gene            124687..125406
FT                   /locus_tag="GBP346_A0142"
FT   CDS_pept        124687..125406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0142"
FT                   /product="PepSY-associated TM helix family protein"
FT                   /note="identified by match to protein family HMM PF03929"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96829"
FT                   /db_xref="GOA:C4KMT6"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMT6"
FT                   /protein_id="ACQ96829.1"
FT                   /translation="MNAPESIEKHSGVVVPYPGSPRKLDAFELAERRRRSRRATFIKWL
FT                   RKVHGWVGLWGAALGLLFGVTGVLLNHRAPPLKISSGEPQVSQLQLALPSPAPATPHAM
FT                   AAWIRRELAFDGRLGRVRKEPAQPVAWGGRRVEQPEHWQFGLFGPRSNVQVEYWKGNGY
FT                   VSVKRTDNAFLTALNNLHRGVGMNLFWVLLMDTIAGSMVLLSLTGVLLWTELNKRRTVG
FT                   VVLVAGSVAAALAAGLT"
FT   gene            complement(125494..126519)
FT                   /locus_tag="GBP346_A0143"
FT   CDS_pept        complement(125494..126519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0143"
FT                   /product="carbon monoxide dehydrogenase accessory protein;
FT                   may be involved in the anchoring of CO dehydrogenase to the
FT                   cytoplasmic membrane"
FT                   /note="identified by match to protein family HMM PF02625"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95045"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMT7"
FT                   /protein_id="ACQ95045.1"
FT                   /translation="MESVDLEVLRTSARWLDEGRRALLVTVVRTWGSSPRPEGAMLAVR
FT                   DDGLVVGSVSGGCIEDDLIARVQASGVARWTRPEAVKYGVTAEEAHRFGLPCGGTIELV
FT                   LEPLTPASGIAALCDAVEHGRLVTRTLALATGEATLASASATDGLHFDGARLVTVHGPR
FT                   YRMLVIGAGQLSRYLCQIAAGLDYQVTVCDPREAYTDAWDVPGTRIVRTMPDDTVLDMR
FT                   LDRRSAVIALTHDPKLDDLALMEALKTPAFYVGALGSRRNSQARRERLREFDLSAAELA
FT                   RLHGPAGIYIGSRTPPEIAVSILAEVTAAKNGVSLPTILQVEGAKAAREIEANSGVACG
FT                   M"
FT   gene            complement(126718..128121)
FT                   /locus_tag="GBP346_A0144"
FT   CDS_pept        complement(126718..128121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0144"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95627"
FT                   /db_xref="GOA:C4KMT8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMT8"
FT                   /protein_id="ACQ95627.1"
FT                   /translation="MSLFRKKNVDRMIAGAQAAGLKKALGAVDLTFLGIGAIIGTGIFV
FT                   LTGTGAVQAGPALMLSFVIAAIACGLAALSYAEFASTIPVAGSIYTYSYATLGELVAWI
FT                   IGWDLMLEYGLAASAVSVGWSGYLQSLLQGFGVSLPTALTAAPGALPGVVTYFNLPAFV
FT                   VMLVITTLLSIGIRESTRVNNIMVFIKVAVVLLVIAVGVFHVTPVNWKPFMPHGWNGVF
FT                   GAAAVMFFAFIGFDAVSSAAEEVKNPKRDLPVGIIASLGVCAFLYVAVAAIATGIVPWA
FT                   QYANVSHPISYALQVAGEKWVAGFIDLGAVIGMLTVILVMSYGQTRIIFAMSRDGLLPA
FT                   ALSRVHPRFATPFLTTWLVGLFFGLIAALIPLNVLAELINIGTLAAFSMVSIAVLVLRR
FT                   THPDLPRAFRCPGVPLVPILAVAACLFLMLNLQPVTWIAFLTWLVIGLFVYFAYSRSRS
FT                   KLAHGAQQH"
FT   gene            complement(128363..129019)
FT                   /locus_tag="GBP346_A0145"
FT   CDS_pept        complement(128363..129019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0145"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96073"
FT                   /db_xref="GOA:C4KMT9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMT9"
FT                   /protein_id="ACQ96073.1"
FT                   /translation="MSLQILLVDDHAIVRQGIRQLLIDRGIAREVKEAECGGDALVIAE
FT                   KSEFDVILLDISLPDMNGIEVLKRLKRRLPSTPVLMFSMYREDQFAVRALKAGAAGYLS
FT                   KTVNAAQMVSAISQVAAGRKYVSPAMAEALAEYVSFENEPLPHEKLSDREYQTLCMIAS
FT                   GKRLTDIAHALSLSVKTVSVYRTRLLEKMKLSNNAELTFYVMSNRLVDMNPAIGA"
FT   gene            complement(129016..129864)
FT                   /locus_tag="GBP346_A0146"
FT   CDS_pept        complement(129016..129864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0146"
FT                   /product="sensor kinase protein"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96793"
FT                   /db_xref="GOA:C4KMU0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMU0"
FT                   /protein_id="ACQ96793.1"
FT                   /translation="MDTPSVAPSIASAPASSSSGLAPEVGIPFVSRCASRAPTAERLGA
FT                   RVAQLSAELVAADESARRHLAGELHDGLGADLTAARFALANVETWLPDDAPDAARRALA
FT                   LAQQALDAATAANRRLIDGLRTPALEAGLVGTLAAWIGAHGARTGLRTSFVCAADARVT
FT                   QLSADGALAVFRVAQEALANVAKHAHASAADVRIDVDDTHLSLVVTDDGVGVGAAAARR
FT                   RGGYGLGSMRARCEALGGTLELASPRAGGAGTALRARFAWHALIAARTPAAARKVRKEA
FT                   R"
FT   gene            complement(130278..131048)
FT                   /gene="fpr_1"
FT                   /locus_tag="GBP346_A0147"
FT   CDS_pept        complement(130278..131048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr_1"
FT                   /locus_tag="GBP346_A0147"
FT                   /product="ferredoxin--NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="identified by match to protein family HMM PF00175;
FT                   match to protein family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95396"
FT                   /db_xref="GOA:C4KMU1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMU1"
FT                   /protein_id="ACQ95396.1"
FT                   /translation="MSKFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVD
FT                   GKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNL
FT                   LPGKTLWLLSTGTGLAPFMSIIRDPDIYERFEKVVLTHTCRLKGELAYMDYIKHDLPGH
FT                   EYLGDVIREKLVYYPTVTREEFENEGRITDLIASGKLFTDLDVPPFSPERDRVMLCGST
FT                   AMLKDTTELLKKAGLVEGKNSAPGHYVIERAFVD"
FT   gene            complement(131261..131914)
FT                   /locus_tag="GBP346_A0148"
FT   CDS_pept        complement(131261..131914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0148"
FT                   /product="LysE type translocator"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95547"
FT                   /db_xref="GOA:C4KMU2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMU2"
FT                   /protein_id="ACQ95547.1"
FT                   /translation="MNLLPILLQIAAVYLVALVTPGPNIFMISQLSLSGRRGLGAVSAL
FT                   GVGTASLTWATLAMLGVAAVLHQLAWLYEAIRIGGAVYLAYFGIKLLRASAQRDPAPAA
FT                   GLADDAGALPSPPATRDYLRAYRTGLFTCLTNPKSCVFWTSVFAAMMPAHVPLWFSGAT
FT                   LLTIGAMSGGWYCGVAYLFANPRAQRGYRRVRRPLDALCGAALVGLGAKLAADR"
FT   gene            complement(131980..132792)
FT                   /locus_tag="GBP346_A0149"
FT   CDS_pept        complement(131980..132792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0149"
FT                   /product="endonuclease/exonuclease/phosphatase"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98418"
FT                   /db_xref="GOA:C4KMU3"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMU3"
FT                   /protein_id="ACQ98418.1"
FT                   /translation="MHVPQTAPLAEPLPVADEITAVSWNLHKGRSPLGFTAWEAMRSWV
FT                   ASTHADVYFLQEAMARRMPRPVLAAGFGAPMAEPVDDIWHCQATEIARALDWQIALGPN
FT                   VFKPSWRHGNAILSPHPLDLGGRWDISAHRFERRGLLVARATLAGGAPVTLLCAHLALT
FT                   RAARLRQMHWIAHWIERNARTGPLVLAGDFNDWRNDSIPLFGEIGLSEVATLLGESGRT
FT                   FPAFSPALALDKMFVRGMTPLEWRAPGDETAWLSDHLPYVARLRLDPA"
FT   gene            complement(132799..133362)
FT                   /locus_tag="GBP346_A0150"
FT   CDS_pept        complement(132799..133362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99101"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMU4"
FT                   /protein_id="ACQ99101.1"
FT                   /translation="MIPFKRKMFASPASRPARAGKFVLEACFAGALAGAAHAQGAPQPV
FT                   VDWEIQVVRDGQTIDAFEQKTTVGQARSDTHSFPVAPAAGCAATSAAASAADAPGSGLS
FT                   RTITVAPLYVEDGAVALAIDAQETLADEGATPPAGAPCTFALPRRIVASHPGLNARAAQ
FT                   WTDWTLAERNPQLVYRVRARVVED"
FT   gene            complement(133459..133581)
FT                   /locus_tag="GBP346_A0151"
FT   CDS_pept        complement(133459..133581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0151"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98813"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMU5"
FT                   /protein_id="ACQ98813.1"
FT                   /translation="MIMSSRRALRAAIRGPPPCAAPPHRPPAPSPRPFAAPPDA"
FT   gene            133723..134703
FT                   /locus_tag="GBP346_A0152"
FT   CDS_pept        133723..134703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0152"
FT                   /product="ATP-dependent protease domain protein"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98063"
FT                   /db_xref="GOA:C4KMU6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMU6"
FT                   /protein_id="ACQ98063.1"
FT                   /translation="MTTAMVKQELAVASFSTVYDIERIETALNDLNEGASDALRATYEK
FT                   MLKTGNLRFCVKPTRMPAFDSLAQALPNFAEPLDDVRKQVALCLETDDRLELMPILLLG
FT                   EPGIGKTHFAKALAKMLGTAYHYVPMSSLTAGWVLSGASSQWKNAKPGKVFDALVNGCY
FT                   SNPVIAIDEIDKAGSDAQYDPLGALYALLEHDTASAFVDEFAEVPIDAGNVIWIATAND
FT                   ASAIPEPIMNRMNVYEIEPPDASGARRIAQTIYGEIRNAHAWGQRFPAALGDDALDVLA
FT                   AMPPRTMRRVLLHAFGAARLDGRDAVAPRDIRTDESAGRRRPIGF"
FT   gene            134775..135896
FT                   /locus_tag="GBP346_A0153"
FT   CDS_pept        134775..135896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0153"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96680"
FT                   /db_xref="GOA:C4KMU7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMU7"
FT                   /protein_id="ACQ96680.1"
FT                   /translation="MTIERIDCVVIGAGVVGLAIARELAARGRETLILEAADAIGTGMS
FT                   SRNSEVIHAGLYYPRGSLKASLCLHGRDLLYDFCETHGVPHRRCGKLVVATSPAQAKQL
FT                   KAIAARAEENGVLDLLTLSRDEVQALEPELECLEALFSPSTGIIDSHQLMLALLGDAER
FT                   DGASCALRSPVESIDAAGGRFVVRTGGEAPAAIAAACVINSAGLDAQALAKRIRGLDSR
FT                   WVPPLYLARGNYFSLSGRAPFAHLVYPVPDRAGLGVHLTLDLAGDARFGPDVEWIDALR
FT                   YDVDPRRAESFYTSIRAYWPGLPEGSLQPAYAGIRAKVSGPGEPAADFVIQGTAQHGVR
FT                   GLVNLFGIESPGLTAALAIAQRVGDMAARTRHT"
FT   gene            136031..136345
FT                   /gene="hip"
FT                   /locus_tag="GBP346_A0154"
FT   CDS_pept        136031..136345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hip"
FT                   /locus_tag="GBP346_A0154"
FT                   /product="high-potential iron-sulfur protein"
FT                   /note="identified by match to protein family HMM PF01355"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95030"
FT                   /db_xref="GOA:C4KMU8"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMU8"
FT                   /protein_id="ACQ95030.1"
FT                   /translation="MKTSRRSFLITSVGAVSALALTREAFSADLPMLSETDPTAVALGY
FT                   KADATKVDKAKFPKYAAGEACAGCMLYQGKKGSASGPCGAFPGKQVAAKGWCNAFTKMA
FT                   "
FT   gene            136576..137868
FT                   /locus_tag="GBP346_A0155"
FT   CDS_pept        136576..137868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0155"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96341"
FT                   /db_xref="GOA:C4KMU9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMU9"
FT                   /protein_id="ACQ96341.1"
FT                   /translation="MASIAASTKTAGQVLNRRAVVAAVIGNALEWYDFTVFSFMTVVIA
FT                   QLFFPTSSEYSSLLLTTATFGVAFFMRPIGGIVLGLYADRAGRKAALSLVILLMTFGIF
FT                   LIAVAPPYAAIGIGGPLLIVLGRLLQGFSAGGEFGSATALLIEAAPLSRRGYYGSWQMA
FT                   SQAAALLFGSLVGAAVTRGLSTEALHAWGWRVPFLIGLVIGPVGFYVRRHLVDSEAFLQ
FT                   ARERGEHVTLGEVFARHGRAVVCGLGAVIALTVTVYVLISYLPTFAVKQLKLPYAQSFY
FT                   AVIIGNLLLTALSPVAGAWSDRIGRKGLSLWALGLTLVMIYPLFAWLDASPSIARLIAV
FT                   QAMLSVTLAGYYGPFGAMIAELFPANVRSTGLSLAYNVAVMVFGGFGQFIVTWLIKTTG
FT                   TPLAPTYYVMAGLALSLVALAFVPTERDALD"
FT   gene            137914..138093
FT                   /locus_tag="GBP346_A0157"
FT   CDS_pept        137914..138093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97863"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMV0"
FT                   /protein_id="ACQ97863.1"
FT                   /translation="MRAARRPSVSLPMSDAGRPMSDADARSIARGNTSRNPQQWRPESV
FT                   RSPQTFTKTRRYQG"
FT   gene            complement(138084..138236)
FT                   /locus_tag="GBP346_A0156"
FT   CDS_pept        complement(138084..138236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98074"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMV1"
FT                   /protein_id="ACQ98074.1"
FT                   /translation="MSFRKRNKLEKKPSVMHSQSSMMWRYTALTDETRAMTSRFGATRR
FT                   DQRYP"
FT   gene            138293..139921
FT                   /locus_tag="GBP346_A0158"
FT   CDS_pept        138293..139921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0158"
FT                   /product="periplasmic dipeptide transport protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97288"
FT                   /db_xref="GOA:C4KMV2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMV2"
FT                   /protein_id="ACQ97288.1"
FT                   /translation="MEHNRLLRALRATAIAGVAAASFGIAGSAFAQIPNKTLVYCSEGS
FT                   PAGFDSAQFTTGVDFTASTFPIYNRLVEFERGGTKVEPGLAEKWDISADGKVYTFHLRH
FT                   GVKFHTTDFFKPTREFNADDVAFTFERMLDPNQAFRKAYPVSFPYFTDMGLDKLIVKIE
FT                   KLDPYTVRFTLKEPNAPFIQNLAMEFASILSAEYADQLMKAGKAADINQKPIGTGPFIF
FT                   RSYTKDATIRFDGNPDYWKKGAVKISKLIFSITPDPGVRVQKIKRNECQVMSYPRPADI
FT                   ATLKADSNVDMPSLPGFNLGYLAYNVQHKPVDKLEVRQALDMAINKKAILESVYQGAGQ
FT                   AASAPMPPTQWSYDKNLKAAAYDPAKAKALLAKAGYPNGFPITLWAMPVQRPYNPNAKL
FT                   MAEMIQADWAKIGVQAKIVTYEWGEYIKRAHAGEHDTMLIGWNGDNGDPDNWLGTLLGC
FT                   EAVKGNNFSEWCYKPFDELIQKGRVTTSQDGRTKIYMQAQQIFAQQLPFSPIANSTVYQ
FT                   PVRKNIVDMRIEPLGYARFDGVSVK"
FT   gene            140033..141043
FT                   /locus_tag="GBP346_A0159"
FT   CDS_pept        140033..141043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0159"
FT                   /product="probable D,D-dipeptide transport system permease
FT                   protein DdpB"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98136"
FT                   /db_xref="GOA:C4KMV3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMV3"
FT                   /protein_id="ACQ98136.1"
FT                   /translation="MFRFVLRRVGMVIPTFIGITVLAFALIHLIPGDPIEVMMGERGVD
FT                   PTMHAQALHRLGLDEPLPMQYLHYVGRALHGDLGTSIITNTSVMGEFLARFPATVELSL
FT                   CALAFALALGLPAGVFAALRRGTIVDHGVMGTALTGYSMPIFWWGLILIMVFSATLGWT
FT                   PVSGRIAVEYEIPHTTGFMLIDTLLSGEEGAFASAVSHLILPAIVLGTIPLAVIARMTR
FT                   SSMLEVLREDYIRTARAKGLSPARIVVVHALRNALIPVVTVIGLQVGTLLAGAVLTETL
FT                   FSWPGVGKWLIDAIGRRDYPVVQGGILMIATLVIVVNLVVDLLYGVLNPRIRHTR"
FT   gene            141118..142059
FT                   /locus_tag="GBP346_A0160"
FT   CDS_pept        141118..142059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0160"
FT                   /product="dipeptide ABC transporter, permease protein DppC"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95734"
FT                   /db_xref="GOA:C4KMV4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMV4"
FT                   /protein_id="ACQ95734.1"
FT                   /translation="MRGRAGGTMSNMQNAMPSQAAPASGRVLALREFWANFSRNRGAVG
FT                   AGIVVLALVAVALLAPVLAPHSPIEQYRDYVKIPPAWLAGGNWQFVLGTDEAGRDILSR
FT                   LMYGARMSFWIGFVSVVLALIPGVVLGLVAAFFQKWADTPVMRVMDVLLALPSLLLAVA
FT                   VVAIIGPGLTNTMFAIAIVALPAYVRLTRASALGELQKEYVTASRVAGAGTPRLMFSQV
FT                   LPNCTAPLIVQATLGFSSAILDAAALGFLGLGVQPPTAEWGAMLASARDYIDNAWWIVT
FT                   MPGLSILISVLAINLLGDGLRDALDPKLKRMA"
FT   gene            142061..143053
FT                   /locus_tag="GBP346_A0161"
FT   CDS_pept        142061..143053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0161"
FT                   /product="oligopeptide transport ATP-binding protein OppD"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95494"
FT                   /db_xref="GOA:C4KMV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMV5"
FT                   /protein_id="ACQ95494.1"
FT                   /translation="MSDLLTIRNLAVNFSGLPAVDRINLSIARGEVVGVVGESGSGKSV
FT                   TMMALMGLIDAPGIVTADEVTFDGVDLLKASAKARRRIIGKDVAMVFQDALTSLNPSYT
FT                   VGYQIKEVLKLHEGLRGDALNKRALELLDQVGIPDARNRIGTFPHQMSGGMNQRVMIAM
FT                   AVACNPKLLIADEPTTALDVTIQAQIMDLLVTLQKERGMALVLISHDLAVVSEVAQRVA
FT                   VMYAGEIIETNRVPDIFAHPHHPYTEALLAAIPEHNAGAKRLAALPGMVPGRDDRPSGC
FT                   LFAPRCKYVVDDCMKARPTLAELAPGTGMRARCIKPLNLEAPHTQGGAR"
FT   gene            143050..144066
FT                   /locus_tag="GBP346_A0162"
FT   CDS_pept        143050..144066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0162"
FT                   /product="dipeptide transport ATP-binding protein DppF"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95391"
FT                   /db_xref="GOA:C4KMV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMV6"
FT                   /protein_id="ACQ95391.1"
FT                   /translation="MNAVHETRESAARNDVVLVADQLAKHYAVRRGMFGHGTVKALNGV
FT                   SFSLARGKTLAVVGESGCGKSTLARQLTMIEPPSAGHLSIDGRDVAGADRETVAALRRR
FT                   VQMVFQNPFASLNPRKTVEQTLAEPLAINTRLTAAERAQRIAQIMRTVGLRPEHAKRYP
FT                   HMFSGGQRQRVAIARAMILDPQIVVADEPVSALDVSIQAQILNLFMDLQEQFKTSYVFI
FT                   SHNLSVVEHIADDVMVMYFGSVAELGDKKTIYARPRHPYTRALMSATPAIFEADRKIQI
FT                   KLQGEMPSPLNPPSGCAFHQRCPYAVERCRVEEPKLRDVDGRLVACHRAEEVGEANA"
FT   gene            144071..145207
FT                   /locus_tag="GBP346_A0163"
FT   CDS_pept        144071..145207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0163"
FT                   /product="GumN family protein"
FT                   /note="identified by match to protein family HMM PF07446"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96931"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMV7"
FT                   /protein_id="ACQ96931.1"
FT                   /translation="MAAREAARRSRNGVRRAATHAARAHRRWRARSLASAVLAGACATG
FT                   GLAWPPAGALAAGSVAAAPLPQAPIPAPSMSLPGFHAPPPSTSNGTVASGAVRTQPARM
FT                   PFYVATKGKVTIYVLGTLHVGDPADYPANQPFRRPILAALAASPTLALELSPDDLLESQ
FT                   DDVSKYGVCNYACLPRLLPPPLWQKLANRLRGNPAALAGIRNMRPWLASLVVETYDSLS
FT                   AGLQTEYGTEAQLQNVFLRKKGGKVVGLETLAEQMRAFTGLTLAQQREMLAQDMVQTPA
FT                   QNAADVRALHRLWRIGDADAIAAWANAKTERLARARSIADSIDNKIVYERNRRFVARMT
FT                   AIAAPNRPLFVAIGSLHLGGPKGVLELLRQQGYRVDAG"
FT   gene            complement(145696..146652)
FT                   /locus_tag="GBP346_A0164"
FT   CDS_pept        complement(145696..146652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0164"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF06166"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96367"
FT                   /db_xref="GOA:C4KMV8"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMV8"
FT                   /protein_id="ACQ96367.1"
FT                   /translation="MTLTIGYLFWLVGLVLLAVGATIVTDRAHPRRFTAGGFWLLYALV
FT                   FLVGDKLPVELVGALVIVMALIAGFGGVTAARPKLPSDDARRASAARIGNRLFVPALTI
FT                   PFVTVAITLAASHLHVGGAPLVDPKNVTLIGFGIGCVIALGFACWITRDSVGQSLQEAR
FT                   RLIDALSWAAVLPQMLGMLGLVFSDAGVGKAVAHVTTAYVNLDYRLIAVAVYCIGMALF
FT                   TMVMGNGFAAFPVMTGGVGVPILVDVFHGDPAVMVAIGMFSGYCGTLMTPMAANFNMVP
FT                   AALLELPDKNGVIKVQIPTALALLATNIVLLNVLMFR"
FT   gene            complement(146649..147401)
FT                   /locus_tag="GBP346_A0165"
FT   CDS_pept        complement(146649..147401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0165"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF06149"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97850"
FT                   /db_xref="GOA:C4KMV9"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMV9"
FT                   /protein_id="ACQ97850.1"
FT                   /translation="MQGTVSLWPLIGVAVIVVGFALRFNPMLIVATAAIVTAASAHFPP
FT                   ERILAAIGAGFLKTRNIPLIILLPLAVIGLLERHGLRERAQAWIASIRAATAGRLLILY
FT                   LLVRELTAAVGLTGLGGHPQMVRPLIAPMAEGATENRFGPLPDAIRHRLRAYAAATDNV
FT                   GLFFGEDIFVAFGAIVLMVTFLKEAGIAVEPMRVALWGIPTAVSAFVIHGARLWLLDRR
FT                   LERELRASAAPHAASNGANAAADNGGRA"
FT   gene            147612..148007
FT                   /locus_tag="GBP346_A0166"
FT   CDS_pept        147612..148007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97248"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMW0"
FT                   /protein_id="ACQ97248.1"
FT                   /translation="MSANRSCGGHGSPRARCHRVRAARGRAPGGVHMFRGLCGLCEFSR
FT                   RTGARTRAGRMPARVARRRAACVAAARTRATGSRSAGRAPFGAIRASAIAAAPPGAAGL
FT                   LARGRVAEKTSAAGRAGESRACRPNSA"
FT   gene            complement(148024..148788)
FT                   /locus_tag="GBP346_A0167"
FT   CDS_pept        complement(148024..148788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0167"
FT                   /product="LamB/YcsF family protein"
FT                   /note="identified by match to protein family HMM PF03746"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98731"
FT                   /db_xref="GOA:C4KMW1"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMW1"
FT                   /protein_id="ACQ98731.1"
FT                   /translation="MEIDLNADLGEGCGSDEALLDLVTSANIACGWHAGGAQAMRDCVR
FT                   WAVEKGVSIGAHPSFHDPENFGRKEMDLPASEIYAGVLYQLGALSAIAQAEGGRIAHVK
FT                   PHGALYNQAAREPEIADAVVSAIHDFDPSLAVFGLAKSGFVDAARQAGLVAVEEVFADR
FT                   GYRADGSLVPRSQPGALVDDENEMLARTLEMVRGQRVRAVTGEWVPLNAQTVCLHGDGP
FT                   HALAFAKRIRDALEAAGIDVHAPGALHAGERA"
FT   gene            complement(148847..149926)
FT                   /locus_tag="GBP346_A0168"
FT   CDS_pept        complement(148847..149926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0168"
FT                   /product="allophanate hydrolase, subunit 2"
FT                   /note="identified by match to protein family HMM PF02626;
FT                   match to protein family HMM TIGR00724"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95994"
FT                   /db_xref="GOA:C4KMW2"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMW2"
FT                   /protein_id="ACQ95994.1"
FT                   /translation="MNSRQATGGIEVLRAGPLSTIQDLGRRGYRHLGVAQSGALDSLAL
FT                   EVGNRLVGNRPDAAAIEITLGPASFRFPRATRIAITGTEFGATLDGAPIYSWWSVPVAA
FT                   GQTLSLPVAKRGMRGYLCIAGGIDVLPMLGSRSTDLASRFGGLGGRVLRDGDRLPTGAP
FT                   PAGAPACVAPDAPEFGVKAPAWCAFARVDEAPRRHKHAHAVWAMPVRVLPGPQYASFTA
FT                   AAKHAFWDEEWIVTPNSNRMGYRLAGVKLERAESADLLSHAVLPGTIQVPGNGQPIVLM
FT                   NDAQTTGGYPRIGAVIRADLWKLAQARLNLPIRFVRVTDKAARDALAAERAYLRQIDIA
FT                   IEMREEALQRALAARAAAA"
FT   gene            complement(149923..150693)
FT                   /locus_tag="GBP346_A0169"
FT   CDS_pept        complement(149923..150693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02682;
FT                   match to protein family HMM TIGR00370"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95407"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMW3"
FT                   /protein_id="ACQ95407.1"
FT                   /translation="MYAKVVRATPRQIFLARSYRHFIDNVFFTRLNAVCFPSMTTPRIY
FT                   PLGDTALVCEAPPPATLECQRRVWAVASAAAGWPHVVDVVPGMNNLTIVFDPLETTADT
FT                   LAPLMKAAWRDAEGVAESGREIEIPVEYGGAFGPDLDAVARHTGLARDEVVRRHAAGTY
FT                   VVFFLGFQPGFTYMGGLDGSLHTPRRAAPRLEVPAGSVGIGGEQTGIYPAAAPGGWQLI
FT                   GRTPLALFDPARTPPTLLQPGDRVRFIVAGVHAG"
FT   gene            150729..151241
FT                   /locus_tag="GBP346_A0170"
FT   CDS_pept        150729..151241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0170"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96889"
FT                   /db_xref="GOA:C4KMW4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMW4"
FT                   /protein_id="ACQ96889.1"
FT                   /translation="MQRHPTKIVSSEHLVSETSAELSELEYALIMAGNAFNRWMVRCMA
FT                   AAGAKDMTAVEVSLLHHVSHRDRKKKLADICFVLNIEDTHVATYALRKLVARGYVKSEK
FT                   TGKEVFFDATDAGRALCLRYRDVRERCLIETLKDSGLTNEQIGDAAQLLRHASGLYDTA
FT                   ARAAASL"
FT   gene            complement(151481..152077)
FT                   /locus_tag="GBP346_A0171"
FT   CDS_pept        complement(151481..152077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0171"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="identified by match to protein family HMM PF01812;
FT                   match to protein family HMM TIGR02727"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96307"
FT                   /db_xref="GOA:C4KMW5"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMW5"
FT                   /protein_id="ACQ96307.1"
FT                   /translation="MSESIARAPAPNPKRTLRETLARRRLDAQRAPRAHDALAQRVLAI
FT                   LAQCAPRTVGFYWPLPGEFDARDAIASWLAGDASRQAALPVIGKPRTPLEFHAWTPDAP
FT                   MREGRHRIAEPAAGARLVPELLLIPCVGFDHGCFRLGYGGGYYDRTLAAWPGATPPVTV
FT                   GVAYDACGVRELPREAHDLPLDWIVTETRLYRSDD"
FT   gene            152099..154054
FT                   /locus_tag="GBP346_A0172"
FT   CDS_pept        152099..154054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0172"
FT                   /product="transglycosylase, SLT family"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96150"
FT                   /db_xref="GOA:C4KMW6"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMW6"
FT                   /protein_id="ACQ96150.1"
FT                   /translation="MSTSLFRVYRAVAAPLVAVALAAVTAACAAQTADEASSNDDRVFV
FT                   QLREAARRNDPVRAAQLAALIPNYPAPSYLEYFQIKPQLFDSAGHARLDAPDAPVLSFL
FT                   SRYDGQAIADRMRNDYLLVLGARHDWRAFDEQYKRFVLDDDTQVKCYALESRASRGENV
FT                   ADMARELLVEPKYYGDACVDLITALATNKQFSSDDVWAQVRLAYEQNYTTLGGKIADAL
FT                   GPRPVGFDQVTSAPPLFLARGVGSDATSRQLALVAITRMARNDPEAAAGQLASLASTLS
FT                   AAEQAIGWGEIGYQATVKRLPQAASWYRKSMDAPLSNPAYEWRVRAALLAGDWPMVRRS
FT                   IEQMPERLRDDAAWIYWRGRALKESGDTLKANQEFERIAGQFNFYGQLAGEELGQKTTI
FT                   PPRTKVTDAEIDAMSKVPGFALAQRFYALNLRLEGNREWNWPLRGMTDRQLLAAAEYGK
FT                   RVDLLDRTVNTADRTTAEHDFSLRYPSPYRDIVERYARTNGLDVEWAYGLIRQESRFIT
FT                   NARSTVGAGGLMQLMPATAQLVAKKLGLGTVSRAQMHDIDTNVQLGTWYLSDIYQKFDD
FT                   SAVLATAGYNAGPGRPAQWRQVLTRPVEGAIFAETIPFNETREYVKNVLSNETYYAALF
FT                   EKKPQSLKARLGFIAP"
FT   gene            154176..155135
FT                   /locus_tag="GBP346_A0173"
FT   CDS_pept        154176..155135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0173"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF05368;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97710"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMW7"
FT                   /protein_id="ACQ97710.1"
FT                   /translation="MQGQTIAMLGGTGFIGSRLVNVLVGAGAHVRIGARRREHARHLAT
FT                   LPVDIVELSAFDVRELARFVAGAQAAVNLVGVLRGGHGKPYGEGFERLHVALPAALAAA
FT                   CIEARVPRMLHVSALGADPHAPSMYLRSKGDGEIALRAQAAAGALDVTIFRPSIVFGPG
FT                   DAFVNTFARLQRIFPVLPLAMPDALMQPVHVGDVAQAIANACVRDATRGRTYELGGPRT
FT                   YRLEEIVRYAGRLIGRPARIVRLPDALARLQARVFEMLPGEPLVSRDNLASLSVPSVMT
FT                   GPIAPELGIAPASLEHIAPTYVGDAALRSRFSDRRARR"
FT   gene            155199..155846
FT                   /locus_tag="GBP346_A0174"
FT   CDS_pept        155199..155846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0174"
FT                   /product="glutathione S-transferase domain protein"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97312"
FT                   /db_xref="GOA:C4KMW8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMW8"
FT                   /protein_id="ACQ97312.1"
FT                   /translation="MKLVIGDKNYSSWSMRPWVLMKHFGIPFDEVMIGLRLDDTAERIR
FT                   AHSPSGKVPCLVDDEGGSVWDSLAIVETLAERFPQHALWPRDPAARAHARSVSAEMHAG
FT                   FPALRSEMPLNVRESHPGRGATPAALADVARIDELWRTCVAASGGPFLFGAFSIADAMY
FT                   APVVLRFKTYAPPLSPEASAYAARVAELPAVREWIDGARGETRVIDIYGPSR"
FT   gene            155843..157084
FT                   /locus_tag="GBP346_A0175"
FT   CDS_pept        155843..157084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0175"
FT                   /product="multifunctional CCA protein"
FT                   /EC_number="2.7.7.25"
FT                   /EC_number="2.7.7.21"
FT                   /EC_number="3.1.3.-"
FT                   /EC_number="3.1.4.-"
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98790"
FT                   /db_xref="GOA:C4KMW9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMW9"
FT                   /protein_id="ACQ98790.1"
FT                   /translation="MKIYAVGGAIRDALLGLPVRDRDYVVVGATPEQMAAQRFRPVGKD
FT                   FPVFLHPDTHEEYALARTERKTAAGYHGFQFYYAPDVTLEQDLVRRDLTINAMAREVSP
FT                   DGALVGPVVDPFGGQADLRAKLFRHVGDAFVEDPVRILRVARFAARFAEFAVAPDTAAL
FT                   MRAMVDAGEVDALVPERVWQELARGLMEAKPSRMFAVLRECGALARILPEIDALFGVPQ
FT                   RAGYHPEVDTGVHVMMVIDHAAKQGYSLAVRFAALTHDLGKATTPADVLPRHIGHEGRS
FT                   VDLLKPLCERLRVPNECRDLALVVAREHGNLHRVMEMGAAALVRLLERADALRKPARFA
FT                   EALQASEADARGRLGLETKPYPQAERLRQALVAARAVDAGAIAQGLAGEPAKIKDAVHR
FT                   ARVRAVAQAVGVAD"
FT   gene            complement(157279..157527)
FT                   /locus_tag="GBP346_A0176"
FT   CDS_pept        complement(157279..157527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0176"
FT                   /product="putative brain expressed, associated with Nedd4
FT                   isoform 1"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99018"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMX0"
FT                   /protein_id="ACQ99018.1"
FT                   /translation="MRRIETATGRVSSPRGAGRFIAEPAGVIPPNDDARPRGPQRAVAL
FT                   RKRADYVQRDRAIKCRALTRRGGHADSGGRSHSRSAA"
FT   gene            complement(157746..157967)
FT                   /locus_tag="GBP346_A0177"
FT   CDS_pept        complement(157746..157967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0177"
FT                   /product="RebB protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98411"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMX1"
FT                   /protein_id="ACQ98411.1"
FT                   /translation="MAFPTSVNDQITDSVTQANTKVLGDAPAIAMGNLYQATAQALANT
FT                   AHNATNAQQQSYVTALAERRDGGAATTI"
FT   gene            158070..158303
FT                   /locus_tag="GBP346_A0178"
FT   CDS_pept        158070..158303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0178"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95988"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMX2"
FT                   /protein_id="ACQ95988.1"
FT                   /translation="MLPIGAIDGKYGANSAKLDGRPAEPAVAIGGSAVSASVSRRRNRR
FT                   HAEKAPICGEISDAARQESAGRNRPGETFQVL"
FT   gene            complement(158446..158940)
FT                   /locus_tag="GBP346_A0179"
FT   CDS_pept        complement(158446..158940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0179"
FT                   /product="flagellar protein, FlgN family"
FT                   /note="identified by match to protein family HMM PF05130"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95422"
FT                   /db_xref="GOA:C4KMX3"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMX3"
FT                   /protein_id="ACQ95422.1"
FT                   /translation="MHHMAHGRSARRHVERNEMRDELLATVNDEHATVEAFASLLAYEE
FT                   KALTTAAPLDALPGIVERKTELLEKLAQLERRRDTLLASLGLPAGKKGMDLAAENDARL
FT                   ANGWQLLQHSAERARHANAINGMLIRIRMDYNERTLSVLRAAPQRNGFYGPDGRVAAVA
FT                   R"
FT   gene            complement(158966..159310)
FT                   /locus_tag="GBP346_A0180"
FT   CDS_pept        complement(158966..159310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0180"
FT                   /product="anti-sigma-28 factor, FlgM"
FT                   /note="identified by match to protein family HMM PF04316"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96672"
FT                   /db_xref="GOA:C4KMX4"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMX4"
FT                   /protein_id="ACQ96672.1"
FT                   /translation="MKVDSTPTSNARTLSNASAGAARTQAGQPAAAQTPAGAAGAPTGG
FT                   DANVSLSGLSSTLRSLAASGSADIDTAQVDAIRDAIKSGTLSIDTGKIADGILQTARDL
FT                   LKQPSQAGNR"
FT   gene            complement(159414..160943)
FT                   /locus_tag="GBP346_A0181"
FT   CDS_pept        complement(159414..160943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0181"
FT                   /product="flagellar basal body P-ring biosynthesis protein
FT                   FlgA"
FT                   /note="identified by match to protein family HMM PF08666;
FT                   match to protein family HMM TIGR03170"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96109"
FT                   /db_xref="GOA:C4KMX5"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMX5"
FT                   /protein_id="ACQ96109.1"
FT                   /translation="MTTDAGRATRTRFAVALALAGWMGAALAQQAGDGGMIVIPGRGES
FT                   AQTALANANAASARGANGAGAAGPGGADRTASPGGWHAPAAAQAAAAWSGRAGAASGAE
FT                   SAAESGDVRAATEPRTGLIVIEPGPAESNGRIPAAAPSGWHPSAAMPRAESNGGANPVP
FT                   PRTGSNRSAGPASASAGWTAPPGAASQGNPAANVAPAPRVSAASRAPATTDMQRVAPVI
FT                   AQDEGAAPAGRPANARAAAQSWPARDPSVAAGGVIPVSLRAQPAPRTLPVRSAPIRAAA
FT                   TSAAGAQPAAASATAAGAVPAGQQDGESIRRAALAFLQQQAAGLPGKTTVTVAPAFPRG
FT                   LAACTTLEPFLPSGARLWGRTTVGVRCAGERPWTIYLQAKLAVQATYYVAARQIAPGET
FT                   LTAADLVARDGDLTLLPLAVITDAQQAVGATALTRVAAGLPLRQDLLKSAASVSIGQTV
FT                   RVVASGQGFTISAEGSVLNNAAPGQQVRVRMAAGQIVTAIVKDAATVEIPL"
FT   gene            161215..161706
FT                   /gene="flgB"
FT                   /locus_tag="GBP346_A0182"
FT   CDS_pept        161215..161706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="GBP346_A0182"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM TIGR01396"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98705"
FT                   /db_xref="GOA:C4KMX6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMX6"
FT                   /protein_id="ACQ98705.1"
FT                   /translation="MLDKLDAEFAFGRQALDVRAYRQELLSSNIANADTPGYRARDVDF
FT                   SSTLARALKQDGATSAGNAAQLPLAQPAGVASGMSMATTSGAHLAGNVKLIPTGGPSDD
FT                   YGRAQYRIPQQPALDGNTVDLDTERVQFADNAVHYQAGMTVMTQQIKTMIAAITSNSSS
FT                   "
FT   gene            161790..162215
FT                   /gene="flgC"
FT                   /locus_tag="GBP346_A0183"
FT   CDS_pept        161790..162215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="GBP346_A0183"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR01395"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96335"
FT                   /db_xref="GOA:C4KMX7"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMX7"
FT                   /protein_id="ACQ96335.1"
FT                   /translation="MPSLMNIFDVAGSAMSAQSQRLNVTASNLANADSVTGPDGKPYKA
FT                   KQVVFATAPMGRARTASGQGVGGVQVSKVIDDPSPMKTAYDPSNPAADQNGYVTMPNVD
FT                   PVQEMVNMISASRSYQANVETLNTAKQLMLKTLTIGS"
FT   gene            162269..163111
FT                   /locus_tag="GBP346_A0184"
FT   CDS_pept        162269..163111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0184"
FT                   /product="flagellar basal body rod modification protein"
FT                   /note="identified by match to protein family HMM PF03963"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95743"
FT                   /db_xref="GOA:C4KMX8"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMX8"
FT                   /protein_id="ACQ95743.1"
FT                   /translation="MTSSFTTIGGSGTTVNSLPYDTMSSNGQSSGTSGANTTNGTAGTN
FT                   GTSGANSGINVASSLSTTSAADLQTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTV
FT                   SGIAQLNTALTSLSSQLTAGQQTQAAMLIGSNVLAPGNTLPVKSGAASPFGVQLTSAVS
FT                   NLTITVKNASGVVVNTINAGAQSAGTVPFNWTPTDTAGNKLPDGTYTISASYTDTSGKQ
FT                   YAPTTLSSAQVLSVIKQADGTPGLVLSNGSTVGFSQVASIFPNTTKSASTGSSSSSTN"
FT   gene            163139..164380
FT                   /locus_tag="GBP346_A0185"
FT   CDS_pept        163139..164380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0185"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM PF07559; match to protein family HMM TIGR03506"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95645"
FT                   /db_xref="GOA:C4KMX9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMX9"
FT                   /protein_id="ACQ95645.1"
FT                   /translation="MGYQQGLSGLVGASSDLDVIGNNIANANTVGFKGSTAQFSDMYAN
FT                   SVASAVNNPIGIGTMLASVQQQFSQGTITSSTSSLNVAINGNGFFQMSNNGVTTYSRDG
FT                   TFQRDKNGYIVNSQGLNLMGYAANANGVINTAATVPLQAPTTNIAPTATTKITGQFNLN
FT                   SQDAVPATTPFNYTDPTSYNYTTSVQVFDTLGGSQNVNLYFVKSATSGQWEAYAGPAGK
FT                   TPTDLGSVKFSTAGTITGTSTPAGVPTTNVGQFSFSIPTTTGAANPQNLTLDLTGTTQY
FT                   GGKNGINNLAQDGFASGVLTTFSIGADGKVTGNYSNGQTSTLGQIVLANFNNPNGLVNV
FT                   GNNQYVESAASGVPQISAPGSTNHGTLQGSALENSNVDLTSQLVKLITAQRNYQANAQT
FT                   IKTQQTVDQTLINL"
FT   gene            164407..165168
FT                   /gene="flgF"
FT                   /locus_tag="GBP346_A0186"
FT   CDS_pept        164407..165168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="GBP346_A0186"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR02490; match to protein family HMM
FT                   TIGR03506"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95105"
FT                   /db_xref="GOA:C4KMY0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMY0"
FT                   /protein_id="ACQ95105.1"
FT                   /translation="MDRLIYTAMTGATQSLEQQSVVANNLANASTTGFRAQLATFRAVP
FT                   MNFEDGSGNVDPATTRTYTLSSTPGADFAPGPIERTGNPLDVAVQGPGWLSVMLPDGTE
FT                   AYTRAGNLHVDQNGQLVTANNLPVVGNGGPLAVPPNAQLTIGADGTVSALMPGDPPTAV
FT                   AMIDQLKLVNPDPATMKRGDDGLFRTADGNPADADPAVKVVPNSLEGSNVNPVAAMVSM
FT                   IDNARAFELQTKLIQSADQNEQAANQLLNFS"
FT   gene            165202..165990
FT                   /gene="flgG"
FT                   /locus_tag="GBP346_A0187"
FT   CDS_pept        165202..165990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="GBP346_A0187"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR02488; match to protein family HMM
FT                   TIGR03506"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96822"
FT                   /db_xref="GOA:C4KMY1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMY1"
FT                   /protein_id="ACQ96822.1"
FT                   /translation="MNRSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLL
FT                   YQTVRQPGANSTQQTELPSGLQLGTGVQQVATERLYTQGSLQQTGNSKDVAINGQGFFQ
FT                   VLMPDGTNAYTRDGSFQTNAQGQLVTSSGYQVIPAITIPQNANSLTIGSDGVVSVTQPG
FT                   SNNAVQIGALQIATFINPAGLDAKGENLFAETTSSGAPNVSQPGLNGAGTLKQGYVESS
FT                   NVNVVQELVNMIQTQRAYEINSKAVTTSDQMLQTVTQMSR"
FT   gene            166011..166733
FT                   /gene="flgH"
FT                   /locus_tag="GBP346_A0188"
FT   CDS_pept        166011..166733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="GBP346_A0188"
FT                   /product="flagellar L-ring protein FlgH"
FT                   /note="identified by match to protein family HMM PF02107"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96207"
FT                   /db_xref="GOA:C4KMY2"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMY2"
FT                   /protein_id="ACQ96207.1"
FT                   /translation="MKQVRFLPQPARRARAAAARRPGAAALAAAALALAGCAQIPREPI
FT                   TQQPMSAMPPMPPAMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSG
FT                   ANTNRQGNTSFDVPTAGFLGGLFNKANLSAQGANKFAATGGASAANTFNGTITVTVTNV
FT                   LPNGNLVVSGEKQMLINQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYIN
FT                   EAETMGWLQRFFLNIAPW"
FT   gene            166727..167932
FT                   /gene="flgI"
FT                   /locus_tag="GBP346_A0189"
FT   CDS_pept        166727..167932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="GBP346_A0189"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /note="identified by match to protein family HMM PF02119"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97937"
FT                   /db_xref="GOA:C4KMY3"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMY3"
FT                   /protein_id="ACQ97937.1"
FT                   /translation="MVKTMRTLFARVVRPLVAARRRAAACCALAACMLALAFAPAAARA
FT                   ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSA
FT                   NGGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLK
FT                   GADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVL
FT                   QLQLNDMDYGTAQRIVSAVNSSFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV
FT                   SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPFSNGQTVV
FT                   AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLE
FT                   II"
FT   gene            167933..168868
FT                   /gene="flgJ"
FT                   /locus_tag="GBP346_A0190"
FT   CDS_pept        167933..168868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgJ"
FT                   /locus_tag="GBP346_A0190"
FT                   /product="flagellar rod assembly protein/muramidase FlgJ"
FT                   /note="identified by match to protein family HMM PF01832;
FT                   match to protein family HMM TIGR02541"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97404"
FT                   /db_xref="GOA:C4KMY4"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013377"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMY4"
FT                   /protein_id="ACQ97404.1"
FT                   /translation="MTTFTKPNDLSQRFALDVQGFDALRSKATAAAPREGVKMVAGQFD
FT                   AMFTQMMLKSMRDATPSDGLLDSSSSKMYTSMLDQQLAQQMSSKGIGVADALTKQLLRN
FT                   ANVAPDAQGEGGLAAMNALAKAYANSNGAPGNGALAGTRGYSAASALTPPLKGNGNSAQ
FT                   ADAFVEKMALAAQAASATTGIPARFIVGQAALESGWGKREIRGANGESSYNVFGIKATK
FT                   GWTGRTVSAVTTEYVNGKPHRVVAQFRAYDSYEHAMTDYANLLKNNPRYASVLNAGHNA
FT                   EGFAHGMQKAGYATDPHYAKKLISIMQQIG"
FT   gene            169084..169842
FT                   /locus_tag="GBP346_A0191"
FT   CDS_pept        169084..169842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0191"
FT                   /product="YcgR protein superfamily"
FT                   /note="identified by match to protein family HMM PF07238;
FT                   match to protein family HMM PF07317"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99187"
FT                   /db_xref="GOA:C4KMY5"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR023787"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMY5"
FT                   /protein_id="ACQ99187.1"
FT                   /translation="MNTEQSTSPAASAAAHSGHDYGRRNPLEIGVQLRNLVNRGDFLTV
FT                   QYQGGQLVTRILDVDVGARTFVFDWGALADQNAGILAAPRCVFDASPDGVRVEFSTATP
FT                   RETRYENLPAFEADFPDVLYCMQRREYFRVDAPILDPYVCRGRLPDGETFLFEVHNLSL
FT                   GGLGLRTSDDRVASLEPGMTLPDVELNLNGHGMLSLDLQLVSHRASETPSGARRYQLGF
FT                   RFVSLPGSAENTLQRIITQLEMKRRQLARA"
FT   gene            169907..172051
FT                   /gene="flgK"
FT                   /locus_tag="GBP346_A0192"
FT   CDS_pept        169907..172051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="GBP346_A0192"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="identified by match to protein family HMM PF06429;
FT                   match to protein family HMM TIGR02492"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98753"
FT                   /db_xref="GOA:C4KMY6"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMY6"
FT                   /protein_id="ACQ98753.1"
FT                   /translation="MAALARRPRAAFAFFARAVPQFFRRAAVIPGVHATRRPRRGRLLG
FT                   SRMSNTLMNLGVSGLNAALWGLTTTGQNISNAATPGYSVERPVYAEASGQYTSSGYLPQ
FT                   GVSTVTVERQYNQYLSNQLNAAQTQGSSLSTYYTLVAQLNNYVGSPTAGIATAITNYFT
FT                   GLQTVANNAADPSARQTAMSNAQTLASQLVAAGQQYSQLRQSVNSQLTDTVTQINSYTS
FT                   QIAQLNEQIASASSQGQPPNQLLDQRDLAVSKLSQLAGVQVVQSNGNYSVFLSGGQPLV
FT                   VGNASYQLATVASPSDPSELTIVSKGVAGSAQPGPTQYLPDVSLTGGALGGLLAFRSQT
FT                   LDPAQAQLGALAVSFASQVNAQNALGVDMSGNPGGSLFAVGAPAVYANQNNTGSATLSV
FT                   SFVDGTQPTTSDYALSYDGAKYTLTDRATGSVVGTATPSSTPPTMTIGGLKLSLSSTPN
FT                   AGDSFTVLPTRGALDGFSLATANGSAIAAASPVLAAGVATNSGTGVISQGSVSAGYQLP
FT                   SGTTTLAYNAASKTLSGFPVGTTVTIAGTPPTSINITSATTPVPYDPSKGASMTISSTT
FT                   QPAPSGVMNGVSVSLSGTPADGDQFTIGANKGTNDGRNALALSQLVNSKTMNNGTTTLT
FT                   GAYAGYVNAIGNAASQLKASSAAQTALVGQITQAQQSVSGVNQNEEAANLMQYQQLYQA
FT                   NAKVIQTANSVFQTVLGLFN"
FT   gene            172067..173299
FT                   /gene="flgL"
FT                   /locus_tag="GBP346_A0193"
FT   CDS_pept        172067..173299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="GBP346_A0193"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM TIGR02550"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95901"
FT                   /db_xref="GOA:C4KMY7"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMY7"
FT                   /protein_id="ACQ95901.1"
FT                   /translation="MRISSTQLYSLNVDMMNDQQAQIAQLYQQVSSGISLTTPADNPLA
FT                   AAQAVQLSATSATLAQYTQNQTIVQTALQTEDTTLTSVNDVLNAAYQALMHAGDGGLSD
FT                   SDRAALAAQIQGSRDHLLTLANTADGAGNYLFAGFQPTTQPFSNKPGGGVTYAGDYGAR
FT                   AVQIADTRTVSQGDNGANVFMSVPFLGSLPVPAAGASNTGTGTIGAVSITNPSDPTNTH
FT                   QFTITFGGTAAAPTYTVTDNSVTPPTTTAAQAYSSGQGINLGGQTVAVSGKPAVGDTFT
FT                   VTPAPQAGTDVFATLDTVISALKSPVGNSQTASTALTNTMATASTKLMNTMTNVLTVQA
FT                   SVGGRLQEVKAMQAVTTTNTLQTTNSLSNLTDTNLPAAISQFLQLQNSLSAAQKAFVQM
FT                   QNLSLFQYLNP"
FT   gene            173417..173608
FT                   /locus_tag="GBP346_A0194"
FT   CDS_pept        173417..173608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95735"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMY8"
FT                   /protein_id="ACQ95735.1"
FT                   /translation="MAARRRRGPHVTACRGLGLAAAFARPGERFLTPALRLPPARIPSA
FT                   GRFCAPLVSAIPASYTRA"
FT   gene            173667..174974
FT                   /locus_tag="GBP346_A0195"
FT   CDS_pept        173667..174974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0195"
FT                   /product="uracil-xanthine permease"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM TIGR00801"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95765"
FT                   /db_xref="GOA:C4KMY9"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMY9"
FT                   /protein_id="ACQ95765.1"
FT                   /translation="MADSYFPRWRAQPRDDAARVIAPDERLPWPQTFAMGVQHVVAMFG
FT                   STVLAPLLMGFDPNLCILMSGIGTLLFFVLVGGRVPSYLGSSFAFIGLVIAVTGYAGGG
FT                   ANPNVPVALGGIVACGVVYALIGLVVAAVGTRWIETLMPPVVTGAIVAVIGLNLAPIAV
FT                   KGVSASTFDATLALVTVLCVGGVAVFARGMLQRLLILVGVLIAYVIYAVLTNGMGLGKP
FT                   IDFAIVAQAAWFGVPTLHRPVFDPHAMLLIAPVAVILVAENLGHIKAVSAMTGRNLDRY
FT                   VGRAFIGDGLATVVSASMGGTGVTTYAENIGVMAVTRIYSTLVFVAAALIAIALGFSPK
FT                   FGAVIQTIPGPVLGGVSIVVFGLIAVTGARIWVVNRVDFSDNRNLIVAAVTLVLGAGDF
FT                   SLKLGGFALGGIGTATFGAILLYALLRKEKEPGPMV"
FT   gene            174971..175168
FT                   /locus_tag="GBP346_A0196"
FT   CDS_pept        174971..175168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98166"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMZ0"
FT                   /protein_id="ACQ98166.1"
FT                   /translation="MSGWAAARVDRGARGAIARRPLSAIIGARCARGWQHGCAIAIAIA
FT                   IAIDIGARRPLARPRSPMTR"
FT   gene            complement(175184..176065)
FT                   /locus_tag="GBP346_A0197"
FT   CDS_pept        complement(175184..176065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0197"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95260"
FT                   /db_xref="GOA:C4KMZ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMZ1"
FT                   /protein_id="ACQ95260.1"
FT                   /translation="MARDLPPFPALRAFEAAARHESFSAAGEELHVTHGAISRQIAAFE
FT                   AWLGKPVFHRHGKRVKLTDEGRRYLATVEAAFDSIAGATVQLRETGAARVLRINALPTF
FT                   AMKWLLPRLSRFQREAPNVELKLSTSNAPLGSLDGFDVAIRRGPGRWPNCTSGRFLDES
FT                   VIPVCSAALLKRAPIASADDLARHVLLHSDTRPDAWREWFAAAGAPLKGRKKQSFDHFY
FT                   LALQAAVDGLGVALGPLPLIADELASGRLVTPLPGPRIATRSYWWIAPRETANDVLVGR
FT                   FCAWLDAQAQAS"
FT   gene            176163..176762
FT                   /locus_tag="GBP346_A0198"
FT   CDS_pept        176163..176762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0198"
FT                   /product="chromate transporter"
FT                   /note="identified by match to protein family HMM PF02417"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95168"
FT                   /db_xref="GOA:C4KMZ2"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMZ2"
FT                   /protein_id="ACQ95168.1"
FT                   /translation="MQSRFEPGGGDARGVSVADLFAGFLGLGLISFGGALPFARRALVE
FT                   ERRWLSADEFTDLLGLCQFLPGGNVINLSVAVGMRFRGVPGAIAGLLGLVAGPTLVVIA
FT                   LGVLYAKTQQNPAVHHLFGGLAAAAAGLLIAMAVKVAKPLRHMRAGACVAVLAFVAIAV
FT                   LRVPLLPTMLVVTPVSIWLASRAPRGANAGAQGVRR"
FT   gene            176759..177289
FT                   /locus_tag="GBP346_A0199"
FT   CDS_pept        176759..177289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0199"
FT                   /product="chromate transporter family"
FT                   /note="identified by match to protein family HMM PF02417"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96503"
FT                   /db_xref="GOA:C4KMZ3"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMZ3"
FT                   /protein_id="ACQ96503.1"
FT                   /translation="MSDTLAALAVIFGQLSLLAFGGGNTILPEMQRQVVDVHHWMSAQA
FT                   FTALFALAQAAPGPNMMIVPLVGWHVASWPGLLVSSIAKFGPSSIVTMAALHAWERFKD
FT                   KPWRRYVQQGMMPVTAGLVVASAVLISEASNRSALQWGITAAVAALAYRTRVHPLWLLA
FT                   GGALAGLVGGWFA"
FT   gene            177277..177435
FT                   /locus_tag="GBP346_A0200"
FT   CDS_pept        177277..177435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0200"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97094"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMZ4"
FT                   /protein_id="ACQ97094.1"
FT                   /translation="MVRIGACRSGAQRAAAGRGGRAQAVGAARTYQRRAHAAGYAARAC
FT                   VIDAHVR"
FT   gene            complement(177620..177958)
FT                   /locus_tag="GBP346_A0201"
FT   CDS_pept        complement(177620..177958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97161"
FT                   /db_xref="GOA:C4KMZ5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMZ5"
FT                   /protein_id="ACQ97161.1"
FT                   /translation="MTAAKFFLRYTLVPFVAIVLVVVWAFNRESDEIDARQYAALVAAY
FT                   PGFTPDLRDEVNRAMRDGKLAKSDYASIVRDSLNHGYVLDWSSTNVDLNAERGKLLGLV
FT                   KSDAHAPD"
FT   gene            178072..178416
FT                   /locus_tag="GBP346_A0202"
FT   CDS_pept        178072..178416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0202"
FT                   /product="putative alkylphosphonate utilization operon
FT                   protein PhnA"
FT                   /note="identified by match to protein family HMM PF03831;
FT                   match to protein family HMM PF08274; match to protein
FT                   family HMM TIGR00686"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97271"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMZ6"
FT                   /protein_id="ACQ97271.1"
FT                   /translation="MSTLPACPQCAMENTYPDGEHYICADCGHEWPIAGDANAADDDAA
FT                   AVVKDANGNVLADGDAVVLIKDLKVKGSSITLKMGTKVKSIRLVGGDHEVDCKMDAGNF
FT                   MLKACYLKKV"
FT   gene            178434..179174
FT                   /locus_tag="GBP346_A0203"
FT   CDS_pept        178434..179174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0203"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06912"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99029"
FT                   /db_xref="GOA:C4KMZ7"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMZ7"
FT                   /protein_id="ACQ99029.1"
FT                   /translation="MNLDAASRNLTVASLLTLSGGYLDAYTYVGHGHVFANTMTGNVAL
FT                   LGINVSAGDWAQALHHVPPLAGFVIAVFVAHTLGLAAQKGWVRHTAFISLIVEIGFLAF
FT                   ASAGWPAMSSAWLIPGISFVATLQTLSFTHLENLSYTSVMTTGNLRRAAQLLFAGLIPR
FT                   YDALALHDSGLLAVISLCFLMGAVAGGFVTRLVGDGALWGAVLLLAAAFAEIVRRARHD
FT                   SGAGAARAERAARDAPAERAAHER"
FT   gene            complement(179271..179456)
FT                   /locus_tag="GBP346_A0204"
FT   CDS_pept        complement(179271..179456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0204"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96365"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMZ8"
FT                   /protein_id="ACQ96365.1"
FT                   /translation="MARACGPLAAELGGKRIDALERHGNGETRHRDARSDAEPARRATP
FT                   SRQAAYRARNDAPARS"
FT   gene            179413..179571
FT                   /locus_tag="GBP346_A0205"
FT   CDS_pept        179413..179571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain
FT                   one or more premature stops and/or frameshifts"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98021"
FT                   /db_xref="UniProtKB/TrEMBL:C4KMZ9"
FT                   /protein_id="ACQ98021.1"
FT                   /translation="MPPSSAASGPHARANVQRHGRRRAMAIADPFGKRLRFCERDAQSS
FT                   CAPRTVA"
FT   gene            179715..180848
FT                   /locus_tag="GBP346_A0206"
FT   CDS_pept        179715..180848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0206"
FT                   /product="outer membrane porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95373"
FT                   /db_xref="GOA:C4KN00"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN00"
FT                   /protein_id="ACQ95373.1"
FT                   /translation="MKQTTKITGLIGGAVLAIAGQQAMAQSSVTLWGVADVSLRYLSNS
FT                   NVQNDGRFFMTNGAITNSRIGLHGSEDLGGGLKAIFNLESGVNLQDGAFSDSKRIFNRA
FT                   AYVGLTSQYGTVTLGRQKTVLFDLLSDTYDPLTVGNYLENAWLPVALGAGLYADNSVKY
FT                   RGTFGGLTIGAMYSFGTDSTATGAGGFSGQLPGHMGAGNMYGFSLSYVAGPVSVAAGVQ
FT                   QSSDNSNRKQTIYHANVVYAFSKAKIYAGYLHSKDDTGFVDTVLAQQPGLFTSGAPKRT
FT                   GRIDDGPFAGVSWQATPALTLTGAFYYDRMRNATIANGQLDSGNRYTVVGLVEYALSKR
FT                   TEIYGTVDFNKVNGAATVEMPGRSNQTGVAIGLRNIF"
FT   gene            complement(181006..181827)
FT                   /locus_tag="GBP346_A0207"
FT   CDS_pept        complement(181006..181827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96128"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN01"
FT                   /protein_id="ACQ96128.1"
FT                   /translation="MTLMIAGALVALPCTTNLNAAQAATRAPAVAGSPGSAIVFVNGIN
FT                   NTFDDAIASLQVLKTQLNARDANNAYVYGNAYNATQGAFSDLWQVFKQKSVEGTSPADF
FT                   WRAIDGGTVPAGGMDAALQQKYIDILTKSETPELPDHLNQYRAYLQQNRKVVLVGHSQG
FT                   TLYANFEMNLLITGPERAQGRISSVNVGNAARYLLPGSSYLTSSSDTVIGSLGLVQTVM
FT                   PSNFSLGLHLFTDPLGHSFTKIYLNPSFSAARQILTQVSQQANSAAKAAVR"
FT   gene            complement(181887..182450)
FT                   /locus_tag="GBP346_A0208"
FT   CDS_pept        complement(181887..182450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0208"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95520"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN02"
FT                   /protein_id="ACQ95520.1"
FT                   /translation="MRWQYPVAAALAIAAFVWACARIVSTDAAPATAPAGQTASAAPAA
FT                   LASAFTAASSAAPRSAPPPLPPRVTEHIAREYADSAVTREALTQIAYGWNQAVNDVHDP
FT                   GDAKIAGDAIAKGIACALSARVLAKAGIDQQTMLDRIKGTRAVMLDTETDTLAYIRFQS
FT                   LAGGQFFDDPGPASCGFNPTAMPN"
FT   gene            complement(182702..182860)
FT                   /locus_tag="GBP346_A0209"
FT   CDS_pept        complement(182702..182860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95202"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN03"
FT                   /protein_id="ACQ95202.1"
FT                   /translation="MAARGSIGCGQRAVSARRAMRRDSHERRHAIFNFRMHDRLGPNGS
FT                   PRERGPA"
FT   gene            complement(182818..183798)
FT                   /locus_tag="GBP346_A0210"
FT   CDS_pept        complement(182818..183798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0210"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM TIGR03476"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99030"
FT                   /db_xref="GOA:C4KN04"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN04"
FT                   /protein_id="ACQ99030.1"
FT                   /translation="MIKHAGRIAALAGLAISLWLVARDDPHAVLALLRAAGIGLVVAAA
FT                   SHLLPMLANAKDWQTLIAPRCRPSLPAMLRLVWIRESVNGLLPVARIGGEFASFRLLRA
FT                   HGLTAPAAVASLVSDMQLTLISQALFALAGVGYLLVHATSDTARVAGMFAWGLAVLAPL
FT                   LLLFALVQHAKPFERAMHALNRVAGGQLASLVERSAQIDDALKAVWRQRGTVVRYLFFW
FT                   QPLQHLATSLEIWLALHFLGASVSLVDALVIEALIQALSSAAFFVPGGLGVQEGGFVLI
FT                   GGALGLDPATSLGLAGARRIRDLLIFVPGLLAWQHAEASVAASAP"
FT   gene            complement(183795..183914)
FT                   /locus_tag="GBP346_A0211"
FT   CDS_pept        complement(183795..183914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98438"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN05"
FT                   /protein_id="ACQ98438.1"
FT                   /translation="MPRAGKTPECLTGIAHRTRLSSSCKTNPSEREATRTRHD"
FT   gene            complement(183881..185149)
FT                   /gene="hpnI_1"
FT                   /locus_tag="GBP346_A0212"
FT   CDS_pept        complement(183881..185149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpnI_1"
FT                   /locus_tag="GBP346_A0212"
FT                   /product="hopanoid biosynthesis associated glycosyl
FT                   transferase protein HpnI"
FT                   /note="identified by match to protein family HMM TIGR03472"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98238"
FT                   /db_xref="GOA:C4KN06"
FT                   /db_xref="InterPro:IPR017835"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN06"
FT                   /protein_id="ACQ98238.1"
FT                   /translation="MSVEGRAMKALAWLTGAVLALLAAELISFGDIGRFVTLLAALLAA
FT                   PCVLAAAFGCVYTLVAAALTHRFFARAPREPHACPPVTIVKPLHGVERTLFANLASFCE
FT                   QRYDGPIQFLFGVHDRDDPALRAVDALRTAFPRAHVTIVADARLYGPNRKIANLVNMLP
FT                   AAAHDVLIFADSDVSVGPDYVRHIVGELGEPGVGLVTCVYRGRPDPGFWPRVEALVTSH
FT                   QFLPGVVTGLALKLARPCFGQTIAMRRAMLDAIGGLAQFAHHLAEDHAIGEAVRARGAR
FT                   VVVPPFAVEHGCVETRVAQLVEHELRWSRTIRAVDPRGHLGSLLTHPLALALLAGVLSS
FT                   GAAWAWPLVPAALVARVAAKRIVDRATKRPVRDLWLLPLADLIAFGIFVASFSSSRVIW
FT                   RGFSFDVDRDGRLCPAPEKRPNA"
FT   gene            complement(185531..187045)
FT                   /locus_tag="GBP346_A0213"
FT   CDS_pept        complement(185531..187045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0213"
FT                   /product="carbohydrate porin, OprB family"
FT                   /note="identified by match to protein family HMM PF04966"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97871"
FT                   /db_xref="GOA:C4KN07"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN07"
FT                   /protein_id="ACQ97871.1"
FT                   /translation="MKKKTLHQMLVKSGVASGLPLLLSLGIVQPALAQAPSPAAAPAEN
FT                   AAPPAPATRAPDGVPGGNGATAAQTDAAPTGFWDRSNLFGDMGGLRTKLGDHGITLNLQ
FT                   ETSEYLRNLSGGTSRGGAYDGLTQFGFSVDTEKAIGLPGGTFNVSGLQIHGTSLTARNL
FT                   QLLQTASGIEAEATTRLWELWYQQSFANGRADVKVGQQSLDQEFMVSQYASTFINATFG
FT                   WPVLPAVDMPAGGPAYPLSSLGVRLRAKPSDAWTVMAGVFDGNPAAGVGDAQQLNRHGT
FT                   NFNLRNGALFIGELQYALNAPPADPKAPQAGLPGMYKLGVWYNSERFADPRYDTNGVPL
FT                   ADPASNGVAATHRGNYGFYAVADQMVWRPGADSPRSLNVFARVMGAPGDRNAVDFTLNA
FT                   GVTLKAPFAGRDNDTAGLAVSYAKIGSRARGADGDTGVFQTPGYPVRRAETLIEATYQY
FT                   QVTPWWQLQGDFQYAFRPGGGIPNPNEPGSRIGNEAIVGVRTTITF"
FT   gene            complement(187147..187407)
FT                   /locus_tag="GBP346_A0214"
FT   CDS_pept        complement(187147..187407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98178"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN08"
FT                   /protein_id="ACQ98178.1"
FT                   /translation="MLFQFLAVRFVHGPLFARRRRAAAARAPSALAMRPTVRARLPFIP
FT                   RPAGCAIVAATAGAVALGALLSASGQQVGLNQAIRVSWWFS"
FT   gene            complement(187589..187912)
FT                   /locus_tag="GBP346_A0215"
FT   CDS_pept        complement(187589..187912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99015"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN09"
FT                   /protein_id="ACQ99015.1"
FT                   /translation="MTGAKHRENNFRPAHAESFGAMQAARKLTGELARKPNRKESPYFM
FT                   GFSGLIGRARSCASTQRLCHFYLPIFMRPAYNPPQFIKESHVDTSPGSSRPMPVGIGAA
FT                   FAN"
FT   gene            complement(187933..188382)
FT                   /locus_tag="GBP346_A0216"
FT   CDS_pept        complement(187933..188382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0216"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95288"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN10"
FT                   /protein_id="ACQ95288.1"
FT                   /translation="MRAMRLSIEPGALPSMIEIEKIQGAAYGITVTVRHVGSLSKGSRI
FT                   ECTRALARRRRRHAGQAPSERAPRTKARGECRTSARKRSAHAARIKGAREGVLRTAART
FT                   VCLIGWTAANERARTSCRSGEETARKSTTASVQGVCPICGDGRIL"
FT   gene            188440..188580
FT                   /locus_tag="GBP346_A0217"
FT   CDS_pept        188440..188580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95984"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN11"
FT                   /protein_id="ACQ95984.1"
FT                   /translation="MQFGLLLSQLPHVDESRVHYDAMLSLKAAGEPASASFWQRLKALI
FT                   S"
FT   gene            188600..190375
FT                   /locus_tag="GBP346_A0218"
FT   CDS_pept        188600..190375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0218"
FT                   /product="metal ion transporter, metal ion (Mn2+/Fe2+)
FT                   transporter (Nramp) family"
FT                   /note="identified by match to protein family HMM PF01566"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96471"
FT                   /db_xref="GOA:C4KN12"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN12"
FT                   /protein_id="ACQ96471.1"
FT                   /translation="MREASPPRGGARMPGRRFGEHASTITIRPGRKHMSTPTDISPPIA
FT                   LERDAVLDQAHVGDIKGAFGTIAHHDTAPRSGWWARVRTLLAILGPGLIVMVGDNDAGA
FT                   FGTYTQAGQNYGTSLLWTLLLLVPVLFVNQEMVLRLGAVTGVGHARLIFERFGKFWGAF
FT                   SVIDLFILNALTIVTEFIGITFVLDFFGVSKVAGVCIAAALTMAAVSTGDFRRFERFAV
FT                   ALCVLSLLLVPVLVSIHPPVHQMARDLFVPTWPAHAKRSDVMLLVIGIVGTTVAPWQLF
FT                   FQQSYVIDKRITPRFIKYEKADLWIGIVLVMIGAIAMISFSAALYAGRPEAGGFTDAGG
FT                   VIAGLAKYAGPTSATLFAIALLDACIIGAAAVSLATAYAIGDVFRIRHSLHRGVSDAKG
FT                   FYLVYFGIVAAAAALVLMPGSPLGLLTEAVQTLAGVLLPSATVFLLLLCNDRAVLGPWV
FT                   NSARLNLFTGAVVWVLVMLSIILTASVMYPDMSGEAMLEVLAGGTLFAALGLAATFVLR
FT                   RRAGGADRANVAHDARDAHVDRAARDTWRMPPLDALPAPRVTLSTRIWMGVLRGYLVLA
FT                   VGLVIVKVVQMAFFR"
FT   gene            190503..190670
FT                   /locus_tag="GBP346_A0219"
FT   CDS_pept        190503..190670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97185"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN13"
FT                   /protein_id="ACQ97185.1"
FT                   /translation="MPPARGRATTKRAARPTMRPSAPDASASGAGGRVRDVRPGARQNK
FT                   GILRMKAARK"
FT   gene            complement(190708..190896)
FT                   /locus_tag="GBP346_A0220"
FT   CDS_pept        complement(190708..190896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97627"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN14"
FT                   /protein_id="ACQ97627.1"
FT                   /translation="MHGRSCRAAFVTFGSTGYFGATAHEPARTTPTNARRRTTANRNAC
FT                   AAPDRRRSRFDAAREAA"
FT   gene            190850..191158
FT                   /locus_tag="GBP346_A0221"
FT   CDS_pept        190850..191158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN15"
FT                   /protein_id="ACQ97188.1"
FT                   /translation="MLPNVTNAARHERPCNHARSRSTLTVIAMGILNTVGEIAGAVAAV
FT                   EAAEKVDPDAGLLTKAAAAVAGFKGAEALENLVEKKKDDEAADGENTAAPDSDASQA"
FT   gene            191355..192716
FT                   /gene="gor"
FT                   /locus_tag="GBP346_A0222"
FT   CDS_pept        191355..192716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="GBP346_A0222"
FT                   /product="glutathione-disulfide reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR01424"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95723"
FT                   /db_xref="GOA:C4KN16"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006324"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN16"
FT                   /protein_id="ACQ95723.1"
FT                   /translation="MEFDYDLFVIGAGSGGVRLSRVAASYGARVGIAEEERIGGTCVLR
FT                   GCIPKKLLVYASHYSHDVEDAAGYGWTFDIGLFSWPTLIEAKDREIARLSGIYVDLLNK
FT                   SGVEIHTGRATLVGAHTVDVAGRRVTARHIAVATGSRPVLPPIPGIEHAITSREALELP
FT                   ELPQRIAIVGGGYIAVEFAGIFNGLGVDVDLFYRGEQILRGFDDDVRHALHGEMTKQGV
FT                   AIHTRATIEAIERGADGGLTLRLAEGAYGPYDAVLYATGRVANGDGLGLEAVGVARDAN
FT                   GAIEVDAYSATTVPSIHAIGDVTARPQLTPVATRDGMLLAANLFGGKRIAADHRYVPSA
FT                   VFSQPEIATVGLTEAQARAELGELDIYKTSFRALRHTLSGRDEKTFMKLVVARDSQRVV
FT                   GAHMVGRDAAEIIQGIAIAIRAGATKAQFDETVGIHPTAAEEFVTLRQKEPDDA"
FT   gene            complement(193030..193266)
FT                   /locus_tag="GBP346_A0223"
FT   CDS_pept        complement(193030..193266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96199"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN17"
FT                   /protein_id="ACQ96199.1"
FT                   /translation="MRQVSRAAPAGPKWGREGGGRGCGVDGGGVWGGRGGRGSRGSRGG
FT                   QGGRQSRARQARRTSRRDWIKESGARIVGPLGH"
FT   gene            193336..194676
FT                   /gene="argG_1"
FT                   /locus_tag="GBP346_A0224"
FT   CDS_pept        193336..194676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG_1"
FT                   /locus_tag="GBP346_A0224"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764;
FT                   match to protein family HMM TIGR00032"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96711"
FT                   /db_xref="GOA:C4KN18"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN18"
FT                   /protein_id="ACQ96711.1"
FT                   /translation="MTTILENLPAGQKVGIAFSGGLDTSAALHWMRIKGAVPYAYTANL
FT                   GQPDEDDYDAIPKRAIQYGAEGARLIDCRAQLVAEGIAALQCGAFHISTAGVTYFNTTP
FT                   IGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLVNPDLKIYKPWLDQQFI
FT                   DELGGRAEMSEFMRQAGFEYKMSAEKAYSTDSNLLGATHEAKDLESLESGIKIVNPIMG
FT                   VAFWRDDVKIDKEEVTIRFEEGRPVALNGVEYKDAVALLLEANRIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGLALLYIAYERLVTGIHNEDTIEQYRENGRRLGRLLYQGRWFDPQ
FT                   AIMLRETAQRWVARAVTGEVTVELRRGNDYSIIGTRSPNLTYQPERLSMEKVQSMFSPR
FT                   DRIGQLTMRNLDITDTRDKLRIYSQVGLLAAGESSALPKLKEDESGN"
FT   gene            194802..195473
FT                   /locus_tag="GBP346_A0225"
FT   CDS_pept        194802..195473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97721"
FT                   /db_xref="GOA:C4KN19"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN19"
FT                   /protein_id="ACQ97721.1"
FT                   /translation="MQISHKIAGAPRLAARAARAAGAGASAPAVRINRRTAPRSGVRGT
FT                   DNKTRTETEVDMFQMLPSMTFGRRLSVWWSCMWRQTLASAPVWILGVAIVGLSISRTHS
FT                   AAGRPPSGGAAALAVATFFVCLVVCLPIAGYMVRGGFAAHALTAPERLAFRQALMVGLT
FT                   TFGWAVLAALPISVATMPLRHAGYPLAGQAIGWVLNVAAGLYIVLPRQARRLRLLAGEA
FT                   A"
FT   gene            195581..196288
FT                   /locus_tag="GBP346_A0226"
FT   CDS_pept        195581..196288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98322"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN20"
FT                   /protein_id="ACQ98322.1"
FT                   /translation="MRAAVAAAAFSASLPAGAAGPAIDPGRYLYVEGGSAHGVLTVKGN
FT                   AFEIETIGGNCHTCALSGTFDGRVGIARDGENVCRIAVSGGHGDLRLDTSGSDACRDFC
FT                   GMRASFDGEYRRPGAACTDRARDVRTERSHRQYAAHDYDAARTTLKALLAECGGFMGWI
FT                   ELDRAKSDLALTEYHRGDRAQCVAVLSDTIAYRAQQDHSDAFGLPPCDADNYKSTGDAI
FT                   LHNLALCQAPAKR"
FT   gene            196301..196462
FT                   /locus_tag="GBP346_A0227"
FT   CDS_pept        196301..196462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0227"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98909"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN21"
FT                   /protein_id="ACQ98909.1"
FT                   /translation="MRGRLGEAPAAASAGRSLRSGGREAHARRRVSCVVRRSSRSLRTR
FT                   RPRRVIGT"
FT   gene            196523..196858
FT                   /locus_tag="GBP346_A0228"
FT   CDS_pept        196523..196858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0228"
FT                   /product="heavy-metal-associated domain protein"
FT                   /note="identified by match to protein family HMM PF00403"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95802"
FT                   /db_xref="GOA:C4KN22"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN22"
FT                   /protein_id="ACQ95802.1"
FT                   /translation="MGTLAFDASCRAALTAAQPIQPPALDLPTVGRSILQSIHIDWRGN
FT                   MKLEVKDMSCGGCANAITQAIQTADSSARVSVDVASKVVDVGSALGIERVVAIIEAAGF
FT                   HPAVLAA"
FT   gene            197195..197383
FT                   /locus_tag="GBP346_A0229"
FT   CDS_pept        197195..197383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95258"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN23"
FT                   /protein_id="ACQ95258.1"
FT                   /translation="MGDFGEPTGLARGRAVFAAVPPWAARHGGTAADRGGSSMRSIEAI
FT                   NRSDQSKRPIEAADRSG"
FT   gene            complement(197429..199957)
FT                   /locus_tag="GBP346_A0230"
FT   CDS_pept        complement(197429..199957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0230"
FT                   /product="copper-exporting ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM PF04945; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01511; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95891"
FT                   /db_xref="GOA:C4KN24"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN24"
FT                   /protein_id="ACQ95891.1"
FT                   /translation="MTAAMPRRGDPTGGAFRPGSPPKTSTSTDATGALAMHDAHVHHDH
FT                   SGDTNERRDPHRPHETKTPGETAVDPVCGMKVPIDTPRRYDYQGRTYRFCSDKCATAFR
FT                   ASPQRFVGTPKQRAGASAAKPGTVYTCPMHPQIRANAPGACPICGMALEPLTPDAAEDG
FT                   NPELRSMTRRFQLGLVLAVPLVLMTMGAMVLPFDIGAGIDALLARWPRPFGMPASWSQW
FT                   VQAALATPVVLWGGWPFLVRGWKSFVTRRLNMFSLIGLGVCVAYLFSVFALLFPDTLPQ
FT                   AFRSGHEIPLYFEASAVIVTLVLLGQVLELRARSRTSSAIRDLLQLAPHTAVRVNPDGS
FT                   EQTVPLDAVVVGDTLRVKPGSKVPVDGIVVAGHSSVDESMITGEPVPAEKTEGSPVTGA
FT                   TVNQTGTFVMRAQKIGTDTLLARIVQMVAEAGRSRAPIQKLADQVSGGFVLTVIVLAAL
FT                   AFAAWAAFGPAPALANALVVAISVLIIACPCALGLATPVSIIVGVGRGAREGVLIKDAE
FT                   ALELMEKVDTVVVDKTGTLTEGRPRVQTIVALGGQSERALLGDAASLEGASEHPLAQAI
FT                   VEHAARMGAERKPVASFDSVPGKGVKGTLDARTVALGNAHLMADLAIDCTAADADSNRL
FT                   REAGQTVMYVAIDGRLAGYIGVADPIKETTPDAVQLLKASGTRIVMLTGDNPVTANAVA
FT                   RTLSLDGVKAGVLPEDKYRHVQALQQQGHVVAMAGDGVNDAPALAQANVGIAMGTGTDV
FT                   AMNSARIVLVKGDLRGIARARALSVATMKNIRQNLFFAFVYNAVGIPVAAGVLYPWFGI
FT                   TLSPIFASAAMAASSVSVIGNALRLRGAKT"
FT   gene            199964..200206
FT                   /locus_tag="GBP346_A0231"
FT   CDS_pept        199964..200206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96519"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN25"
FT                   /protein_id="ACQ96519.1"
FT                   /translation="MLRACGRLRAPLARDARARSATPLPGALPARPASPPALARGEQYR
FT                   VPARAEAPATAIANRAEAFVSGPEQAARMRMAVSL"
FT   gene            200506..201180
FT                   /locus_tag="GBP346_A0232"
FT   CDS_pept        200506..201180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0232"
FT                   /product="LemA family protein"
FT                   /note="identified by match to protein family HMM PF04011"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97088"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN26"
FT                   /protein_id="ACQ97088.1"
FT                   /translation="MRFHSSAPCPAATWIRLIRAALLAAFALTLSGCGYNAIQVQDEQV
FT                   KASWSEVLNQYQRRADLVPNLVNTVKGYANQERDVLTRVTEARAQVGSIRATPELLSDP
FT                   QAFAKFDAAQGQLTSSLSRLLVVSENYPQLKSDANFRDLQAQLEGTENRITVARNRYIR
FT                   SVQAYNTTIRSFPSNLTAMAFGYKEKPNFSVENEAQIAKPPRVDFGTSSAPAPAPAAGA
FT                   SN"
FT   gene            201177..202025
FT                   /locus_tag="GBP346_A0233"
FT   CDS_pept        201177..202025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0233"
FT                   /product="beta-propeller domains of methanol
FT                   dehydrogenase-type"
FT                   /note="identified by match to protein family HMM PF04536"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97626"
FT                   /db_xref="GOA:C4KN27"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN27"
FT                   /protein_id="ACQ97626.1"
FT                   /translation="MKGFLRAACFAVLTFLSIGGACRAEQPVPPLAARVTDETGTLTAA
FT                   ERATLEQSLKDFETRKGSQIAVLIVPTTQPETIEQYSIRVVEQWKLGRANVDDGALLII
FT                   AKNDRALRIEVGYGLEGVLTDATSRRIIDEIIVPNFRRGDFYGGVSAGVGGMMRVIEGE
FT                   PLPPPRARGGEEGGLGRVLPLLFVMTIVAGGVSRAIFGRLAGSVVTGGVVGFVAWLLSG
FT                   ALLVAIAAAAIALFFTLLGGGMGARVGGPFIGGRGGRGGGNDGFRGGGGGFGGGGASGR
FT                   W"
FT   gene            202025..202522
FT                   /locus_tag="GBP346_A0234"
FT   CDS_pept        202025..202522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04536"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98120"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN28"
FT                   /protein_id="ACQ98120.1"
FT                   /translation="MDIARIARHLSMTRWRVAAAFPRRTLGKIERAIEASHEKHVGQLR
FT                   FAVEGALHASMLLRGITARERAIDVFSELRVWDTEHNNGVLIYLLLADHDVEIVADRGI
FT                   HARVDGDEWERVCRAMEAQFRRGRFEAGSIHGIEAVTALLARHYPSRRAPGGAWPSTPV
FT                   VL"
FT   gene            202556..203032
FT                   /locus_tag="GBP346_A0236"
FT   CDS_pept        202556..203032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0236"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98224"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN29"
FT                   /protein_id="ACQ98224.1"
FT                   /translation="MRAATCNPIASNIARRTANHGYFAALYSCAMKIVRLLLVLLWCAT
FT                   LPLTGLAASGLAGDCPMQQAMSMSEDGAMPSMQDCESMRSSVAGKSGKSGKSGKAANVF
FT                   CKVMVQCQFGSLYHPMPAADVARPASPGRPLVFHYAKSLTVREPGGLWRPPRTA"
FT   gene            complement(203029..203178)
FT                   /locus_tag="GBP346_A0235"
FT   CDS_pept        complement(203029..203178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0235"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98884"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN30"
FT                   /protein_id="ACQ98884.1"
FT                   /translation="MQARTPAVRRAKHRIHVLNPSDGIPNGFRAPNAGRSRRACGEPVG
FT                   RKRG"
FT   gene            203131..204432
FT                   /locus_tag="GBP346_A0237"
FT   CDS_pept        203131..204432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0237"
FT                   /product="outer membrane efflux protein"
FT                   /note="identified by match to protein family HMM PF02321"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98887"
FT                   /db_xref="GOA:C4KN31"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN31"
FT                   /protein_id="ACQ98887.1"
FT                   /translation="MYSMLRAPHGRRARLHARTLVAALTFANAAAAFAQSAPLTLDAAL
FT                   QSAADRSAAMQAAQASVQASAELAVKAGQLPDPMLKAGIDNLPVDGPQRFTIGQESMTM
FT                   RRIGIAQEWVSGDKRRLRTALANEVVGRERAGYLAQLADVRRQTAIAWLDAAYAKKALA
FT                   LQRELADEMNRELAATQAAYRGAKATAADALQARALLAQARDRQANARQAFDTALIGLS
FT                   RWIAAPALDVAGEPPAPVSFVPSLPPDELRRVQPTLIAADEDVDVADADVALAASERRP
FT                   NWTWEIAYQQRGAPYANMVSIGVTIPLPLDRRDRQDRDVAQKRALATRARLMYEDARRQ
FT                   VDADIRTQSATLESGRARLAELGRALLPAADERVRLADAAYRAGAGSLADAFAARRARL
FT                   DARLQVLDLERDVARAWAQLDYQIVPSAMLAAAQ"
FT   gene            204443..206014
FT                   /locus_tag="GBP346_A0238"
FT   CDS_pept        204443..206014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0238"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98287"
FT                   /db_xref="GOA:C4KN32"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN32"
FT                   /protein_id="ACQ98287.1"
FT                   /translation="MNHIRLTRAALAVLAAVALSAAGYFAGARFGAHVDVAHRAHAMNT
FT                   TNAVDGADAKPGRKVLYWRDPMVPNQHFDKPGPSPFMNMPLEPVYADDGGGAPGVRIDP
FT                   GLQQNLGIRYAKVRRRDVDEGFDAVGTTQFDESRTAVVQSRVTGYVDRLYASAPLQRIA
FT                   KGAPIASLFVPDWLAPQEEYLALKRGAMDEALLAASRARMRALSIPDSVIANLDRTGRA
FT                   QTHIVLASPETGVVSELNVRDGAMVTPGQTLAKIAGLSTLWAVIDVPEALASGVRPGMR
FT                   VDATFEGDPQRRVSGAIREILPGVNATTRTLQARLELDNRALALTPGMLMRARVGASHA
FT                   ASRLVVPSDAVIATGKRSVVIVRTADDRLRPADVTVGRDAGDETEVLAGLEEGETVVAS
FT                   GQFLIDSEASLKSVLPRLEADASGALAARATRPPARSSPPAAQAGGAAPVYETTGKVEK
FT                   ITAADITFSHQPVPALGWGAMTMSFDKPAPAAFANVKAGDTVRFAFEANGDGYRLTKVE
FT                   PVGGAR"
FT   gene            206011..209223
FT                   /locus_tag="GBP346_A0239"
FT   CDS_pept        206011..209223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0239"
FT                   /product="cation efflux system protein CusA"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00914"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95875"
FT                   /db_xref="GOA:C4KN33"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN33"
FT                   /protein_id="ACQ95875.1"
FT                   /translation="MIAHVIRWSIRNRLLVLLATALVAAWGVVSLNRTPLDALPDLSDT
FT                   QVIVKASYPGKAPRVVEDQVTYPLTTTLLGVPGAKTIRAYSSFGDAFVYVLFDDRTDQY
FT                   WARSRVLEYLNQVQGRLPQGASVALGPDATGVGWVYEYALVDRSGRRDLGELRALNDWF
FT                   LKFELKAVPDVAEVASVGGMVRQYQVVLDPDRLRAFGITQAAVADALGKANSESGGSVV
FT                   EMAESEYMVRASGYLRSLDDFRNVVLRTSESGTPVLLGDVARVQIGPEMRRGIAELNGE
FT                   GEVAGGVIVMRSGKNALSTIEAVKAKLAELRRSLPAGVELVTTYDRSQLIGRAVDNLKD
FT                   KLIEEFVVVGLVCALFLFHLRSAFVAILSLPLGVLAAFIVMRHQGVNANLMSLGGIAIA
FT                   IGAMIDAAVVMIENAHKHLESHEHAHPGAPLSSAARWELIAASAAEVGPALFFSLLIVT
FT                   LSFVPVFALEGQEGKLFAPLAFTKTYTIAAAAGLSVTLVPVLMGYLIRGRIPHEASNPL
FT                   NRLLVRLYRPLLEATLARPWRAIAIAAAALVLTAIPMSRLGGEFMPPLDEGDLLYMPTA
FT                   LPGISAQKAAELLQQTDRLIKTVPEVATVFGKSGRADTATDPAPLEMFETTIRFRPRGE
FT                   WRPGMTPGRLVDELDRVVKVPGLSNVWVPPIRNRLDMLSTGIKTPVGVKIAGPELAQID
FT                   RIAAQVEAAVKRVPGVTSALAERLNGGRYVDVDIDRRAAARYGLSVGDVQAVVASAIGG
FT                   ENVGEVIAGRERFPINIRYPREVRDSLEKLRALPIVTERGAQILLRDVAAVTIADGPPM
FT                   IRSENARLSGYVYVDIRGVDLKTAVGAMQRAVAQQVALPPGYSIAWSGQFEYLERAAAT
FT                   LRTVIPVTLAVIFVLLFLTFDSAADALLLMTTVPFALVGGLWFVWALGHAVSVATAVGF
FT                   IALAGVAAEFGVVMLLYLKRAYERRIAAGEPPNEATLADAIREGAVLRVRPKAMTVAVV
FT                   LAGLVPIMIGHGSGSEVMQRIAAPMVGGMVTAPLLSMFVIPAAWLLLQRRRMRGAARAA
FT                   SQAPVAGAAGADFSSIHTGESR"
FT   gene            209220..209561
FT                   /locus_tag="GBP346_A0240"
FT   CDS_pept        209220..209561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0240"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95296"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN34"
FT                   /protein_id="ACQ95296.1"
FT                   /translation="MKQWIAALMTLAAAAAPAFAAEAAAVPNTPAPPRDARPPAGDALT
FT                   EAVVRQVDLATGMITLKHGALDNVGMPPMTMTFKAKDIAMAKRVRAGDSVRVRVENVDG
FT                   VMTVVKLEK"
FT   gene            209565..209729
FT                   /locus_tag="GBP346_A0241"
FT   CDS_pept        209565..209729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97100"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN35"
FT                   /protein_id="ACQ97100.1"
FT                   /translation="MHVPARRRRRVRRATPAPRAPRRVTRASRNGCRAGGGAIRGEKSL
FT                   DGACDALLF"
FT   gene            209843..210208
FT                   /locus_tag="GBP346_A0242"
FT   CDS_pept        209843..210208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0242"
FT                   /product="avidin family protein"
FT                   /note="identified by match to protein family HMM PF01382"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96388"
FT                   /db_xref="GOA:C4KN36"
FT                   /db_xref="InterPro:IPR005468"
FT                   /db_xref="InterPro:IPR036896"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN36"
FT                   /protein_id="ACQ96388.1"
FT                   /translation="MLRRVKAGTGAPIDFSGTWKNELGSTMRIEQSGDSVSGTYESAVS
FT                   ENGGATSGQLSGYVDGDLIAFVVHWDQFQAITAWVGQGGPGASSDRINTLWQMTQQVEA
FT                   GEEWASINAGADIFVKT"
FT   gene            complement(210283..212115)
FT                   /gene="glmS_1"
FT                   /locus_tag="GBP346_A0243"
FT   CDS_pept        complement(210283..212115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS_1"
FT                   /locus_tag="GBP346_A0243"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98094"
FT                   /db_xref="GOA:C4KN37"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN37"
FT                   /protein_id="ACQ98094.1"
FT                   /translation="MCGIVGAVAQRNIVPVLIEGLRRLEYRGYDSCGVAVLDAGAPAPG
FT                   TPKRARSVARVADLDAQVRESHLEGETGIAHTRWATHGAPVTHNAHPIFSSDALALVHN
FT                   GIIENFEPLREALRAKGYAFVSQTDTEVIAHLIHSLYRGNLFAAVQQAVKQLHGAYAIA
FT                   VTHKDEPHTVVGARQGSPLVVGFGERENFLASDALALAGSTDRFTFLEEGDVCELTLEG
FT                   VTVVDRDGARAARDVRVVAAYGGAVELGPYRHFMQKEIFEQPRAIADTIAQTDAFDPPL
FT                   FGERASSVFAGIDSLLILACGTSYYSGLTAKYWLESIAKIPTQVEIASEYRYRESVPNP
FT                   RALVVVISQSGETADTLAALKHAQALGHAHTLAICNVATSAMVRQTELQFLTHAGTEIG
FT                   VASTKAFTTQLVALFVLAATLGKLRGHVDAAREADYLKQLRHLPAALNSVLALEPQIIA
FT                   WSDEFARKENALFLGRGLHYPISLEGALKLKEISYIHAEAYPAGELKHGPLALVTEAMP
FT                   VVTVAPNDTLLEKLKSNMQEVRARGGELYVFADADTHIVNDEGLHVIRMPEHYGPLSPI
FT                   LHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE"
FT   gene            complement(212179..213540)
FT                   /gene="glmU"
FT                   /locus_tag="GBP346_A0244"
FT   CDS_pept        complement(212179..213540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="GBP346_A0244"
FT                   /product="UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF00483; match to protein
FT                   family HMM PF01128; match to protein family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97373"
FT                   /db_xref="GOA:C4KN38"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN38"
FT                   /protein_id="ACQ97373.1"
FT                   /translation="MNIVILAAGTGKRMRSALPKVLHPLAGRPLLSHVIDTARALAPSR
FT                   LVVVIGHGAEQVRAAVAAPDVQFAVQEQQLGTGHAVRQALPLLDPSQPTLVLYGDVPLT
FT                   RTATLKRLADAATDARYGVLTVTLDDPTGYGRIVRDQAGCVTRIVEQKDASPDELRIDE
FT                   INTGIVVAPTAQLSMWLGALGNDNAQGEYYLTDVVEQAIEAGFEIVTTQPDDEWETLGV
FT                   NSKAQLAELERIHQRNLADALLAAGVTLADPARIDVRGTLTCGRDVSIDVNCVFEGDVT
FT                   LADGVTIGANCVIRHAAIAAGARVDAFSHLDGATVGANAVVGPYARLRPGAVLAADAHV
FT                   GNFVEVKNATLGQGSKANHLTYLGDADIGARVNVGAGTITCNYDGANKFRTVIEDDVFV
FT                   GSDTQFVAPVRVGRGVTVAAGTTVWKDVAADMLVLNDKTQTAKSGYVRPVKKKS"
FT   gene            complement(213579..213875)
FT                   /locus_tag="GBP346_A0245"
FT   CDS_pept        complement(213579..213875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97664"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN39"
FT                   /protein_id="ACQ97664.1"
FT                   /translation="MRRAWRASHGGPHRRGTRVRPRAARYRAPPATSVSPPPPRRPTSP
FT                   IFPTASGPPVDGLAADSRSRRSCGSNEPRAPARRPPPRPARPAAQPRRTGPAC"
FT   gene            complement(214109..215104)
FT                   /locus_tag="GBP346_A0246"
FT   CDS_pept        complement(214109..215104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0246"
FT                   /product="PP-loop family protein"
FT                   /note="identified by match to protein family HMM PF01171"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97232"
FT                   /db_xref="GOA:C4KN40"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN40"
FT                   /protein_id="ACQ97232.1"
FT                   /translation="MNAPHTPHLNEAEAAAAVEANAAELGRRALTRREQKEAYENNKLF
FT                   KRLVRQVGQAIGDYNMIEHGDKVMVCLSGGKDSYALLDILLRLRERAPIDFDIVAVNLD
FT                   QKQPGFPEHVLPEYLTKIGVPFHIENQDTYSIVKRLVPEGKTTCSLCSRLRRGILYRVA
FT                   GELGATKIALGHHRDDIVQTLLLNMFYGGKLKGMPPKLQSDDGKNIVIRPLAYAKETDL
FT                   EKYAELREFPIIPCNLCGSQPNLKRAEMKALIRDWDKRFPGRVDNMFNALANVVPSHLM
FT                   DARLFPFAGLRATGEADPNGDIAFDENPCGTDASAPGGAKSVSIVQFDDL"
FT   gene            complement(215101..215505)
FT                   /gene="folB_1"
FT                   /locus_tag="GBP346_A0247"
FT   CDS_pept        complement(215101..215505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB_1"
FT                   /locus_tag="GBP346_A0247"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by match to protein family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98849"
FT                   /db_xref="GOA:C4KN41"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN41"
FT                   /protein_id="ACQ98849.1"
FT                   /translation="MFAALLHPRLADCRRLYLRNHEVYMNIGAFEHEKRGEQRVVINVD
FT                   LFVPLALTTPVEDRLREVVDYDLMKQSVAQCVARGHIHLQETLCDAIAASLLAHDAVRA
FT                   VRVSTEKPDAYPDCDAVGVEVFRIKDEERA"
FT   gene            complement(215587..216468)
FT                   /locus_tag="GBP346_A0248"
FT   CDS_pept        complement(215587..216468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0248"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98352"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN42"
FT                   /protein_id="ACQ98352.1"
FT                   /translation="MLITGAVQTGAVPARAAEAARAGARQAIRAGRPGDAQPGASAPAG
FT                   APAHPPRAGEQQAQAPSAPPAARPAPDAAAVGRALAVGFARRGWNVALAAAAGDEARAA
FT                   AALAAEVEALGRRAAVLAADLAIEADVARLVADCGAALGRPACVIAQAAPVADTARDVG
FT                   YASLAGAMARSVAAPLVLARTLADATPDAARDDERERAVVIHLLDETLFHPAPERLSHS
FT                   LAQAALHRATAAQALALAPKVRVVGLVGGRAPRADDIADAACYLADAPGVTGATLTVDG
FT                   GEHLAPPADERN"
FT   gene            216536..217726
FT                   /locus_tag="GBP346_A0249"
FT   CDS_pept        216536..217726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02636"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95327"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN43"
FT                   /protein_id="ACQ95327.1"
FT                   /translation="MNPKAHEPASLPVPGPDALAQSDALAASLRAEIAAAGGWIPFSRY
FT                   MERVLYAPGLGYYSGGAQKFGRRGDDGSDFVTAPELSPLFAQTLARPVAQALAASGTRR
FT                   VMEFGAGTGQLAAGLLNALAALGVELDEYAIVDLSGELRARQRETLDEQASGAAARVRW
FT                   LDALPERFEGVIVGNEVLDAMPVQLVAKHAHGWCERGVSLGDAGAFAFADRPLARAEDA
FT                   ARLAALDADEGYVTETHDAAAAFVGTVCAMLARGAALFIDYGFPRHEYYHRQRAQGTLM
FT                   CHYRHRAHGDPFVYPGLQDITAHVEFSAVYEAGVGAGAELLGYTSQARFLLNAGITDVL
FT                   AEIDPSDAQRFLPAANAVQKLISEAEMGELFKVIAFSRGIDGTLDAFARGDRSHTL"
FT   gene            217744..217938
FT                   /locus_tag="GBP346_A0250"
FT   CDS_pept        217744..217938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96746"
FT                   /db_xref="GOA:C4KN44"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN44"
FT                   /protein_id="ACQ96746.1"
FT                   /translation="MLRWLLTTFIAVMVLTRAWPWLAKLGVGRLPGDVTLRLGSRVYPF
FT                   PFMSTLVIMGIVSVIARLW"
FT   gene            217935..218093
FT                   /locus_tag="GBP346_A0251"
FT   CDS_pept        217935..218093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96542"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN45"
FT                   /protein_id="ACQ96542.1"
FT                   /translation="MTPSLRRTALRDARRALACEAGRRAKCVPAARTRRWGRMPPSVTR
FT                   FGREPLA"
FT   gene            complement(218227..218451)
FT                   /locus_tag="GBP346_A0252"
FT   CDS_pept        complement(218227..218451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96137"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN46"
FT                   /protein_id="ACQ96137.1"
FT                   /translation="MDGGNTYTKGLYTAKAHTRKTDNGRFQGYVILSRDEGGAPENTLY
FT                   EVEATSANEAEAFDEAKALAHRILGDLEL"
FT   gene            complement(218763..219671)
FT                   /locus_tag="GBP346_A0253"
FT   CDS_pept        complement(218763..219671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0253"
FT                   /product="PfkB domain protein"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98188"
FT                   /db_xref="GOA:C4KN47"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN47"
FT                   /protein_id="ACQ98188.1"
FT                   /translation="MSAGFPQFVSAGDILTDMVRTGGAHWTSRPGGAGWNVARAVARLG
FT                   APSACAGAVGRDCFSDELWRESEAAGLDLRFLQRVERAPLLAIVHETQPPAYFFIGENS
FT                   ADLAFDPQRLPDGWREHVKWAHFGCISLVREPLASTLVALAAELREAGVKISFDPNYRN
FT                   LMTDSYRPTLARMAELADLIKVSDEDLRHLFAGDDEASAIARLRALNPRAALLVTRGPD
FT                   TATLYAGGETIDARPPRIEVADTVGAGDATIGGLLFSLMTVPARGWRAHLSFALAAGAA
FT                   ACRHTGAHAPTLDEVVALVAA"
FT   gene            complement(219668..221146)
FT                   /locus_tag="GBP346_A0254"
FT   CDS_pept        complement(219668..221146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0254"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="identified by match to protein family HMM PF07221"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98678"
FT                   /db_xref="GOA:C4KN48"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN48"
FT                   /protein_id="ACQ98678.1"
FT                   /translation="MTTSATPAPRPAPAAPPAAAPYVASFRDPQFLLAHVEDTLRFYAP
FT                   HAFDPTGGFYHFFRDDGSVYDRTTRHLVSSCRFVFNHAMAYRHFGDARDLAYARHGLRF
FT                   LRDAHWDAEHEGYDWEIEWRDGAKRATRDGTRHCYGLAFVLLAAAHAAMAGVEEAKPLI
FT                   AHTFDLMEHRFWDRAAGLYADDATPNWTVSSYRGQNANMHATEALLAAYEATGHLTYLD
FT                   RAEKIATNIVQRQAALSQGLVWEHFHADWSVDWEYNKEDSSNIFRPWGFQPGHQTEWAK
FT                   LLLILERHRPLDWLVPRAIELFDAAFAHAWDSDHGGLCYGFGPDYTVCDHDKYFWVQAE
FT                   SFAAAALLAQRTGSERFWDWYDEIWRYSWAHFVDHRHGAWYRILTCDNRKYSDEKSPAG
FT                   KTDYHTMGACYEVLHALASTRDDSGRGANAGGGKGDDDRAPRAAHDSGRGGDVKGGGKG
FT                   GGTDDHGHRVDKGYKGGEGNAADGAGRRRNGGAR"
FT   gene            complement(221143..222162)
FT                   /locus_tag="GBP346_A0255"
FT   CDS_pept        complement(221143..222162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0255"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99016"
FT                   /db_xref="GOA:C4KN49"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN49"
FT                   /protein_id="ACQ99016.1"
FT                   /translation="MGTTIRDVAQAANVSIGTVSRALKNQPGLSEATRARIVEIAHRMN
FT                   YDPTQLRPRIKRLTFLLHRQHNNFATTPFFSHVLHGVEDACRERGIVPSLLTTGPTDDV
FT                   IRQMRPHAPDAIAVAGFMEPETLEALAATGRPLVLIDIRAPGLRSINVDNAGGAALAMH
FT                   HLFASGRRRVAFIGGSLAHYSIAQRALGYRRAFFDAGMLFDPSLELSIDTSLGPDAGAA
FT                   NAMRQLLDAGGALPDAVFAYNDAAALAAMRVCVERGVRVPEDIAFVGFDDIPAAAHAAP
FT                   PLTTLAIDKEALGRQGVELLLADSPAQAELSLPVQLVARASSAGAARAPRTLTSVLGS"
FT   gene            complement(222333..223892)
FT                   /locus_tag="GBP346_A0256"
FT   CDS_pept        complement(222333..223892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0256"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97874"
FT                   /db_xref="GOA:C4KN50"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN50"
FT                   /protein_id="ACQ97874.1"
FT                   /translation="MNTTRLTVKTRLRILVAIVVLVLAAAGGIGLAGVARVGDALTHVF
FT                   EDRAKTLQRISSVDELVTQARYAVGDAVLDPSAAKTEAVAAAAARDVAAIDRLLADFRA
FT                   TPRAGAEREQAERLAADWATLRDKGIRPAVDLLKANNLSEAQWVVTQTLDPVAQRVKGE
FT                   AAQLRQNQLEAAQRAYDRARGVARLVQWAVAGCVLAGVAAVAILCAAMARALARQLGGE
FT                   PDYAASVANEIASGNLALDLHAADAAAGSVLHAMHAMRARLAATIGTLQRAADAIAHAT
FT                   SDIAHGNHDLSRRTDEHAAGLQQTASSMEQLAATVRTNADHARQASALALAASTQAEQG
FT                   DAAARDAIARMEALSVRSQQIRSISSTIEGIAFQTNLLALNAAVEAARAGQAGRGFAVV
FT                   AQEVRGLAHSSAQAAKEISALIADVTGEVELGADTVKAAGSTIVGMLASVRQVATLVDE
FT                   ISHASDEQRSGIDQVSRAVAQMDEMTQHNALLVQKAAGAAGALADEAAALREAAAIFRV
FT                   VA"
FT   gene            complement(223955..224479)
FT                   /locus_tag="GBP346_A0257"
FT   CDS_pept        complement(223955..224479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96356"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN51"
FT                   /protein_id="ACQ96356.1"
FT                   /translation="MQGEALLRFSASPLLRFSASPLLRFSASPLLRFSASPLLRFSASP
FT                   LLRFSASPRPTFPQPHAPRSSRTASRFPDCVDASNFPAISAETASASRHAATSRHAATR
FT                   SERAALPLIRTARRSPLGRPPASRRRAAAAIARRRARRRPARPARPPAAAAPNRGIASR
FT                   KIHSTTVPQRR"
FT   gene            complement(224536..225576)
FT                   /locus_tag="GBP346_A0258"
FT   CDS_pept        complement(224536..225576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0258"
FT                   /product="sodium/bile acid symporter family protein"
FT                   /note="identified by match to protein family HMM PF01758"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96930"
FT                   /db_xref="GOA:C4KN52"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN52"
FT                   /protein_id="ACQ96930.1"
FT                   /translation="MARSRFVPDNFTLALVGTVVLASFLPCRGEAAHAFNWATDIAVGL
FT                   LFFLHGAKLSREAIVAGATHWRLHALVLLSTFALFPLLGLALKPVLTPLVTPALYAGVL
FT                   FLCTLPSTVQSSIAFTSIAKGNVPAAVCSASASSLLGIFVTPALVGVMVSTQGTGATAS
FT                   PWSTIGAIVMQLLVPFVAGQLLRPVIGRWIERNRGVLRFVDQGSILLVVYVAFSEAVNE
FT                   GLWHQIPPTALAGLAVVNVVLLAIALAVTTVVSKRLGFNRADQITIIFCGSKKSLAAGV
FT                   PMAKVIFAAHAVGAVVLPLMLFHQIQLMTCAALAQRWGARDTSRERLADAPGAGALGSG
FT                   ASAAKR"
FT   gene            225959..226435
FT                   /locus_tag="GBP346_A0260"
FT   CDS_pept        225959..226435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95613"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN53"
FT                   /protein_id="ACQ95613.1"
FT                   /translation="MMTERAIRKIGQWAAGVTCALAAVLVFAQPPHGGGPGFGGGRGGV
FT                   PAMAGGWRGAPGYLQAAPHGGEARIGVNGYRQRWGLRPTPSYGRYAAQSPYRPISAEAR
FT                   PAPHASGPGNVPMRAGSIRADVARYNEERGGRPAPAPRQDDSQRLPFFAPFSRN"
FT   gene            complement(226396..226560)
FT                   /locus_tag="GBP346_A0259"
FT   CDS_pept        complement(226396..226560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95414"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN54"
FT                   /protein_id="ACQ95414.1"
FT                   /translation="MRASSSQRGAKDSVIKEMRGRISRECREFASAGGVRAARPGIQLR
FT                   ENGAKNGRR"
FT   gene            complement(226518..226661)
FT                   /locus_tag="GBP346_A0261"
FT   CDS_pept        complement(226518..226661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95727"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN55"
FT                   /protein_id="ACQ95727.1"
FT                   /translation="MSGVGARLAGVKPANGFPAHARTRAGKDARKTPACARRPRNEARK
FT                   IA"
FT   gene            226825..227901
FT                   /locus_tag="GBP346_A0262"
FT   CDS_pept        226825..227901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0262"
FT                   /product="outer membrane porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96633"
FT                   /db_xref="GOA:C4KN56"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN56"
FT                   /protein_id="ACQ96633.1"
FT                   /translation="MKSSFSRALQTTFACAAVAALAAGASGARAQSSVQLYGQVDEWIG
FT                   AQKFPGGQRAWGVQGGGMSTSYWGLRGTEDLGGGYQAIFTLEDFFRAQNGHYGRFDGDT
FT                   FFGRNAYVGLATPYGTVRAGRLTTQLFISTILFNPFIDSYVFSPMVYHVFLGLGTFPTY
FT                   TTDQGVVGDSGWNNAIDYTSPSFGGLNAAAMYALGNTAGDNRSKKWSGQLNYSSGPFAA
FT                   TAVYQYVNFNGGPGDLGALVSGMKSQGVAQLGLSYDFKLAKIYAQYMYTKNELNTGSWH
FT                   VNTAQGGVSVPLGPGSALASYAYSRDSGGHDQTRRTWALGYDYPLSKRTDVYAAYMNDR
FT                   YSGMSGGDTFGAGIRAKF"
FT   gene            227935..229023
FT                   /locus_tag="GBP346_A0263"
FT   CDS_pept        227935..229023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0263"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98534"
FT                   /db_xref="GOA:C4KN57"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN57"
FT                   /protein_id="ACQ98534.1"
FT                   /translation="MHEKVSGVTFGGAVLPFLTFSIHQLCYSCLRLHNSPRLRAFRMDT
FT                   LVSMNVFRYVVEVGSFVGAAERMEMSAAMASKHVMHLEHQLGARLLHRTTRRVAPTEAG
FT                   REYYERLVQALTELDEAGQAVGAASVVPQGRLRVTSLSAFGLRHVMDAVTSYAERYADV
FT                   TVEITLSDRVVELIDEGYDVAVRAAPAGMKSSSLVARQIATAHILLVASPDYLAKHGTP
FT                   ATIADLQHHSFIRREPNETLLDAAISEVAAASRVPMSGNVIVNHLEGLRVAVLGGAGIA
FT                   LLGTEVVGEDIESGRLVPLLLDALPPRELPIYAVYASRRHVSAKVRSFVDFLADRFAGQ
FT                   SLCPSIDERLRQLAMPRMKRLG"
FT   gene            229129..229440
FT                   /locus_tag="GBP346_A0264"
FT   CDS_pept        229129..229440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0264"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95852"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN58"
FT                   /protein_id="ACQ95852.1"
FT                   /translation="MSFTASCFSHSPAPRLRRFVRLAVAMRGGLARFDSLRFVAASWAA
FT                   RGRFAAAQPQFSRVWAHRPSHAPLAVRAAADRAAAQTQPHQSHTAPTAPPAQTARTPR"
FT   gene            complement(229463..230422)
FT                   /locus_tag="GBP346_A0265"
FT   CDS_pept        complement(229463..230422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0265"
FT                   /product="oxidoreductase, 2-nitropropane dioxygenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97977"
FT                   /db_xref="GOA:C4KN59"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN59"
FT                   /protein_id="ACQ97977.1"
FT                   /translation="MALPAVLQNLALPVIASPMFIVSYPELVLAQCKAGIVGSFPALNA
FT                   RPAELLDEWLTQLQTQLAEHKAANPDAVIGPIAVNQIVHQSNVRLEQDIRVCVEHKVPI
FT                   FITSLRAPAREIVDAVHGYGGIVLHDVINLRHAQKALEAGVDGLILVAAGAGGHAGTTS
FT                   PFALVGEVRRIFDGPIVLSGSIANGGSILAAQAMGADLAYMGTRFIATQEAHAVDAYKR
FT                   AILEAKSADIIYTNLFTGVHGNYIRESIVNAGLDPDALPESDKTKMNFGGDKAKAWKDI
FT                   WGAGQGVGLMDDVPSVAELVARLKREYDDAKARLGIRA"
FT   gene            230459..230623
FT                   /locus_tag="GBP346_A0266"
FT   CDS_pept        230459..230623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97409"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN60"
FT                   /protein_id="ACQ97409.1"
FT                   /translation="MREVRRVAAPSRTRVARSICYGSVVPTARSRRINTNGRAIIGALR
FT                   RTRCGEAVE"
FT   gene            230718..231611
FT                   /locus_tag="GBP346_A0267"
FT   CDS_pept        230718..231611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0267"
FT                   /product="haloacetate dehalogenase H-1"
FT                   /EC_number="3.8.1.3"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96322"
FT                   /db_xref="GOA:C4KN61"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN61"
FT                   /protein_id="ACQ96322.1"
FT                   /translation="MSFEEFAPFRVTAQDVDIFGVKGGAGPPILLLHGHPQTHMIWHRV
FT                   AATLARHFTVIATDLRGYGASGKPPSDARHAPYSKRAMAADQVAVMRHFGFPRFYVCAH
FT                   DRGARVAHRMALDHPDAVERMLLLDIAPTLAMYERTDRAFATAYFHWFFLIQPEPLPET
FT                   LIGGQSDAYVEAVMGNRSAGLAPFSPEALHAYREALRQPGAVHAMCEDYRASATIDLDH
FT                   DRADLERGHKLACPLRVLWGEQGVVARCFEPLDEWRRVARDVSGRALACGHYIPEEAPV
FT                   ALIDEIVSFFEAREAA"
FT   gene            complement(231693..232181)
FT                   /locus_tag="GBP346_A0268"
FT   CDS_pept        complement(231693..232181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0268"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97738"
FT                   /db_xref="GOA:C4KN62"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN62"
FT                   /protein_id="ACQ97738.1"
FT                   /translation="MQKRLSTPLAAANTLDAIDRELLRTLADDARQPVSELARRVGLSA
FT                   PSTADRLRRLEAQGVIARFTVELDPRALGYTLQAIVRVKPLPGQLHLVEELLRRIPEFV
FT                   ECDKVTGDDCFVCRLYLHSIEQLDGILAKVTERAETSTAIVKSTPVARRLPPLAREED"
FT   gene            232293..233207
FT                   /locus_tag="GBP346_A0269"
FT   CDS_pept        232293..233207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0269"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96661"
FT                   /db_xref="GOA:C4KN63"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN63"
FT                   /protein_id="ACQ96661.1"
FT                   /translation="MASNPASSDARRGALEMVVAMLMSGTIGWLVVSSRQHLMNVVFFR
FT                   CLFGGATMLIICAALGLLRRDLLTKRTIAFALLGSVAIVANWVLLFAAYSRASISMATA
FT                   VYNTQPFMLVALGALVFRERLTASAAAWLVLAFGGLALVVRVEPAVLAVSGEYLEGVAL
FT                   ALGAAFLYAVSSIVTKRLKGTPPHLIALFQTGVGVLALAPFVHYDALPATAGQWLDLVA
FT                   LGVVNTGIMYVLLYGAIQKLPTATIGALSFVYPVVAIVVDRFAFGQTLAWSQVGGAALI
FT                   LLAAAGVNLGWRIVPARRVAARG"
FT   gene            complement(233494..233817)
FT                   /locus_tag="GBP346_A0270"
FT   CDS_pept        complement(233494..233817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0270"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF06945"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96154"
FT                   /db_xref="GOA:C4KN64"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN64"
FT                   /protein_id="ACQ96154.1"
FT                   /translation="MTETRGATLAACAPDTAPTPDAATHAPAGACADAGTNANAARSNS
FT                   GTENATPSGGVPSPCTNVCRIDARTGWCEGCRRTRDEIAAWRKLDDDAKRTVLARIATR
FT                   RAA"
FT   gene            complement(233823..234329)
FT                   /locus_tag="GBP346_A0271"
FT   CDS_pept        complement(233823..234329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0271"
FT                   /product="YbaK"
FT                   /note="identified by match to protein family HMM PF04073"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95691"
FT                   /db_xref="GOA:C4KN65"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C4KN65"
FT                   /protein_id="ACQ95691.1"
FT                   /translation="MATPAPIDKLPDSARRVALLLRERGHAKAIVMLEETGKTSAEAAA
FT                   GLGCSIAQIAKSILFRRRADGAPVLVVASGANRVDERKVAAQVGEVGRADAKFVRDNTG
FT                   YAIGGVCPIGHLVEPVVLIDRDLLDLDSLWAAAGHPHAVFNLSPQELVSLTGAPVADVA
FT                   QRSDA"
FT   gene            complement(234385..235320)
FT                   /locus_tag="GBP346_A0272"
FT   CDS_pept        complement(234385..235320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0272"
FT                   /product="hydroxymethylglutaryl-CoA lyase, (HMG-CoA lyase)
FT                   (HL) (3-hydroxy-3-methylglutarate-CoA lyase)"
FT                   /EC_number="4.1.3.4"
FT                   /note="identified by match to protein family HMM PF00682"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95728"
FT                   /db_xref="GOA:C4KNK0"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNK0"
FT                   /protein_id="ACQ95728.1"
FT                   /translation="MTLPQSVKIVEVGPRDGLQNEQTFVPTGVKIELVNRLSQAGFRNV
FT                   EAASFVSPKWVPQMADGADVMAGIARRAGTIYSALTPNLKGVENALAARADEVVIFGAA
FT                   SEAFSRRNINCSIAESIARFEPVARAAKDAGVRLRASVSCALGCPYQGDVPLEAVVDVV
FT                   ERLAALGCDEIDIADTIGVGTPGRTRAVLDAVAKAFPRERLSGHFHDTYGQALANIYAA
FT                   LLEGIAIFHASVAGLGGCPYAKGATGNVATEDVLYMMRGLNIETGVDLDQVVAAGDFIS
FT                   NAIGRANISRAGRALLAKQRAAAEPPSACA"
FT   gene            complement(235406..236347)
FT                   /locus_tag="GBP346_A0273"
FT   CDS_pept        complement(235406..236347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0273"
FT                   /product="putative 2-hydroxyacid dehydrogenase GhrA"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98920"
FT                   /db_xref="GOA:C4KNK1"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNK1"
FT                   /protein_id="ACQ98920.1"
FT                   /translation="MRILLYTPHRDAHDWKRDVERALPGAQLRTWTPGDDAGADYALVW
FT                   RAPREFFAPRAGLKAVFNLGAGVDAILALEREHPGLLPRDVPLVRLEDAGMARQMVEYA
FT                   THAALRYLRRFDEYALLQRERRWQVLAPHARETFVVGVLGLGALGAEVARALAALGLPV
FT                   RGYSRAPKAIDGVTTFAGAAQLDAFLGGAKLLVNLLPSTAATDGILNARTFSKLAHGAY
FT                   LVNLARGAHLVEADLLDALASGRVAAATLDVFATEPLPPDHPFWREPRITITPHCSADT
FT                   LRAEAVEQIAAKIGALERGEPIGGIVDRDRGY"
FT   gene            complement(236352..236789)
FT                   /locus_tag="GBP346_A0274"
FT   CDS_pept        complement(236352..236789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0274"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95316"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNK2"
FT                   /protein_id="ACQ95316.1"
FT                   /translation="MSATPRGALRPFHLAFPVTSLEHARRFYGGLLGCPEGRSSDHWVD
FT                   FDFFGHQLVAHLAPGETGRSAVNPVDGDDVPVRHFGVVLSMDEWHALADTLKAAGTQFV
FT                   IEPHIRFKGEAGEQATMFFVDPCGNALEFKAFADIGQLFAK"
FT   gene            complement(236814..236948)
FT                   /locus_tag="GBP346_A0275"
FT   CDS_pept        complement(236814..236948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0275"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98053"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNK3"
FT                   /protein_id="ACQ98053.1"
FT                   /translation="MSACVPREAASLAPIVACAPRAANQFFVLCISSLCGAARGKTVE"
FT   gene            236939..237568
FT                   /locus_tag="GBP346_A0276"
FT   CDS_pept        236939..237568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0276"
FT                   /product="putative hydrolase"
FT                   /note="identified by match to protein family HMM PF06821"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98608"
FT                   /db_xref="GOA:C4KNK4"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNK4"
FT                   /protein_id="ACQ98608.1"
FT                   /translation="MRSCSKSTWPPRLVTAPGLHGSEGAHWQTWLERQFARALRVEQDD
FT                   WDAPHVERWAQKVRDLLARERGPFVIAAHSFGCLATAHALAQAAQTRAADVVGVLFVAP
FT                   ANPRKFAFAGDFDARRLNVPSIVVGSESDPWMTLADAREFAQRLGSAFVNLGDAGHINT
FT                   AAGYGPWPRAKYFVDTLVHCAAPLRLRDDDAPASGAPARQPLVTAA"
FT   gene            complement(237597..238007)
FT                   /locus_tag="GBP346_A0277"
FT   CDS_pept        complement(237597..238007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0277"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97563"
FT                   /db_xref="GOA:C4KNK5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNK5"
FT                   /protein_id="ACQ97563.1"
FT                   /translation="MQHTEQPRVGCGAAIVRDGRILLIKRKRAPEAGCWGLPGGKVDWL
FT                   EPVERAVCREIEEELGIALERATLLCVVDHIDAANGEHWVAPAYLAHAFSGEPRVVEPD
FT                   RHEALGWFALDDLPQPLTHATRVALEQVTRAA"
FT   gene            238048..238161
FT                   /locus_tag="GBP346_A0279"
FT   CDS_pept        238048..238161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95684"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNK6"
FT                   /protein_id="ACQ95684.1"
FT                   /translation="MPRCVPSKAGGAAGLPVRRPAVQTVAAAAAGAAVFSP"
FT   gene            complement(238151..240268)
FT                   /locus_tag="GBP346_A0278"
FT   CDS_pept        complement(238151..240268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0278"
FT                   /product="phospholipase C, phosphocholine-specific"
FT                   /EC_number="3.1.4.3"
FT                   /note="identified by match to protein family HMM PF04185;
FT                   match to protein family HMM PF05506; match to protein
FT                   family HMM TIGR03396"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98072"
FT                   /db_xref="GOA:C4KNK7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNK7"
FT                   /protein_id="ACQ98072.1"
FT                   /translation="MTSESRRRFLHTIAQSAGAAAALTVFPESIRRALAIPAASRTGTL
FT                   RDVEHIVVFMQENRSFDHYFGHLRGVRGYNDRFPIPLPNGKPVWYQPSKANPGKPVLPF
FT                   RLNTLTTSAQCIGDLDHSWYKTHAAIDGGRYDQWPANKTDMTMGYHVREDIPFHYALAD
FT                   AFTVCDNYFCSLPGPTHPNRSYLMTGTVDPTGRYGGPLLDNSDYVDGDVPPKYDLLTWT
FT                   TYPERLEANGISWQIYQQGTAGADPLNGNYGTNILQNFANFINAKPGSSLYRRAQTART
FT                   LDDLKADVLANKLPQVSWLLPPAAFSEHPRYTPAYGANYTSQILDALTSNPDVWRKTVL
FT                   FIMYDENDGFFDHVVPPQPATTRAQGLSTVTVDGEIHDVVNPGRGGSYTADGLPYGLGP
FT                   RVPMTVVSPWTKGGFVCSQVFDHTSVIRFIAARFGIDEPNITPWRRAVCGDLTSAFDFR
FT                   TPDATLPPLPDTSGYRSIADQLCSTKPAPAVPAAPSPVDPQEPGVRPARALPYELHVNA
FT                   EVHGGARLRIEFANRGEQGAHFYVYASNRSDGPWRYTVGAHRSLHETFDLAATNGAYAF
FT                   AVYGPNGFVRVFEGLAAAGGHGRQAAARPEVKAGYDVANGNLYLKLANHGAQSVQLTLA
FT                   DNAYGAPARRITLRGGDEQIESWALASSHQWYDVTVSDGATGQFVRRFAGHVENGKPSY
FT                   SDPAAIAPVTG"
FT   gene            complement(240315..240611)
FT                   /locus_tag="GBP346_A0280"
FT   CDS_pept        complement(240315..240611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0280"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96091"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNK8"
FT                   /protein_id="ACQ96091.1"
FT                   /translation="MRQRLTAPAVVVVAALCVAPLVAACSDDASHANAGAGTSPAAQPG
FT                   GAANAFNGGATAAGNASASAPLATPVIHYPPEDAADDASGAAAASAQSASHPG"
FT   gene            complement(240849..241307)
FT                   /locus_tag="GBP346_A0281"
FT   CDS_pept        complement(240849..241307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0281"
FT                   /product="leucine-responsive regulatory protein"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95188"
FT                   /db_xref="GOA:C4KNK9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNK9"
FT                   /protein_id="ACQ95188.1"
FT                   /translation="MKLDSIDRRILRALQRDGRQQNVELAKEVGLSPSPCLRRVRLLEE
FT                   AGVIERYVAVLNPAKVGRGLTVFTRVWLKEQDADTVAHFAEAVQHLPQVVECHLMAGDC
FT                   DFLLRVVAADIDDYRQFQMQHLTRIRGVQSVKTEIPLQKVKLTSEVPV"
FT   gene            241432..242160
FT                   /locus_tag="GBP346_A0282"
FT   CDS_pept        241432..242160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0282"
FT                   /product="AzlC family protein"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98055"
FT                   /db_xref="GOA:C4KNL0"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNL0"
FT                   /protein_id="ACQ98055.1"
FT                   /translation="MNSLPTSTVISEASPARSEAWRGLRASLPVMLGFVPFALVLGAQA
FT                   AQKGLGIVEVPLLTGLNFGGGSEFTAIRLWTSPPHILLIVAMSFLVNCRHILMGAAFAP
FT                   YLRHLSRRQTFPALFFMCDESWAMALADARREGRGRVSLPYYLGVAAGLYLTWISCTAL
FT                   GAALGPTIGDVERYGFDMAFTAVFLVLLRGMWKGARASRPWLVSLVVAAATYLLVPGAW
FT                   YVAAGALAGLVAAVVCGEPA"
FT   gene            242157..242459
FT                   /locus_tag="GBP346_A0283"
FT   CDS_pept        242157..242459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0283"
FT                   /product="AzlD family protein"
FT                   /note="identified by match to protein family HMM PF05437"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95663"
FT                   /db_xref="GOA:C4KNL1"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNL1"
FT                   /protein_id="ACQ95663.1"
FT                   /translation="MIDVPTLLTIVLMASSTYLSRILGYVALRNRTLSPRMMSVMENVP
FT                   GCVLVSVIAPAFVSDKPANLLALGITLLAATRLSILPTVIIGIVSTGVLRHLLGQ"
FT   gene            242561..243289
FT                   /locus_tag="GBP346_A0284"
FT   CDS_pept        242561..243289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0284"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95216"
FT                   /db_xref="GOA:C4KNL2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNL2"
FT                   /protein_id="ACQ95216.1"
FT                   /translation="MPDDAPPIVLLHDSLGCVRMWRTFPRTLAACAGRRVIAYDRLGFG
FT                   QSDPRTDALGFDFVRDEARRCFPMLRDAFGFDRFVAFGHSVGGGMAVHCAAEFASACDA
FT                   LITESAQAFVEDRTRAGIVDAREQFKQRDAFERLRAYHGEKARWVLDAWIDTWLSPEFA
FT                   GWSLAAVLPRVTCPTLAIHGGDDEYGSALHPETIARLASGPAQIEILPGVRHVPHRERE
FT                   QWVAQRVAAFIGAGPHGIAE"
FT   gene            complement(243653..244246)
FT                   /locus_tag="GBP346_A0285"
FT   CDS_pept        complement(243653..244246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0285"
FT                   /product="SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96161"
FT                   /db_xref="GOA:C4KNL3"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNL3"
FT                   /protein_id="ACQ96161.1"
FT                   /translation="MMRRKALGALCSLALAGAPVGSRAATPFYSLPLSSKDWHKGFRLT
FT                   DLHGHTKTPQDYRGNVLLLFFGFLSCPSICSTTMLELTQAKERVGAQKDKVKILFVTLD
FT                   PNRDTSPTIARWLASFGDDNIGLRDSEAHVRKAATALNLKYERVEGDVPGAYTIDHGVQ
FT                   TYVFDPQGRLRLIARAGIEPEYVAKDIVQLLSGR"
FT   gene            complement(244274..247117)
FT                   /locus_tag="GBP346_A0286"
FT   CDS_pept        complement(244274..247117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0286"
FT                   /product="kelch domain protein"
FT                   /note="identified by match to protein family HMM PF01344;
FT                   match to protein family HMM PF07646; match to protein
FT                   family HMM PF09118"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95675"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR009880"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015202"
FT                   /db_xref="InterPro:IPR037293"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNL4"
FT                   /protein_id="ACQ95675.1"
FT                   /translation="MTEWIRVRSPAFKRKTKFKRFQWEKARDRSPFRYMKINMKKREEK
FT                   SLSVSHSRRAFLVWVPASLLVTACGGDNGSSAPASIKKAIAALTGPGGATWTGMGKGGI
FT                   LIQSPYSGAGNFELLAGDEYGMLHCLRRTNDNGAQWMVAVGDGMGSKNSVSGYCHTYST
FT                   NYTNIEAAVVDDGAVKTYFRSNSTPWSAHKTIPIGDAQGFPAYLQSNRNGAQQLELVVG
FT                   MRRGGMVHYWRDDKDGFTWKQSSIFGSGQVKGVSVMQGNYIGPDNNANLELVAWVDDRL
FT                   ESWCCEGRAWRKICNIAAGGVGGAPALLRSNYGTKGNFEVLVPLATGGLAHYWRNNDAE
FT                   GIPWSFTGTIGTGAYVAAGLLQSQNGVKGDFEAIGLRASGKADVFRRGDTLVWENSATV
FT                   SPFSEGTAADVGVSSHIVDVNVTGINSVLLKNGSVLMFGYYKGGSTNKTIPACIWNPVN
FT                   DQITAIPSFRNNFCAGQTAMPDGKVLIVGGHIGDTLKDVVVFDPDNHTATLVATMTKGR
FT                   WYPSTATLPDGQVFIISGTETAGWNTSVNDTWQTYANNALTAPEDVISPFSPYYPKSQT
FT                   QIDLYPFLFVLPDGKLLVHARNTTRFFDIGTRSWSATLYKTVSDNSRTYPFMGGTAVLP
FT                   LRPSENYRVKVVVAGGADKSAQIAIGDDSQYDNSVPGMTSCEMLDLGDAAPAWKAIAPL
FT                   NEGRVMCDLVTLPDGKLFIVGGNKTGKADYGRGPTYRPELYDPQTNTWTLLASTRIARG
FT                   YHATALLLPDGRIAITGKDGDYQGSGLQYAETRVEIFSPPYLFKGPRPAIQSAPASINH
FT                   GGSFTLGLSSGTSPEDIGSIVIVACGSATHQINFSHRIVELVFAVSGGALTVNAPPNAN
FT                   IAPPGYYMMFVLSKLGVPSVSSIVHVAAGSAQAASATPEALTRQPRVATVSIEQAGDAP
FT                   RCAPLTVAEKQSINGMG"
FT   gene            247491..247709
FT                   /locus_tag="GBP346_A0287"
FT   CDS_pept        247491..247709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97334"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNL5"
FT                   /protein_id="ACQ97334.1"
FT                   /translation="MTGFFYLTKSYWLEFAATDHDGRTRERSKRAVAVGRAVALGFRAT
FT                   VTDGERAASNRRVDGAPAGRLARCRDA"
FT   gene            247766..248011
FT                   /locus_tag="GBP346_A0288"
FT   CDS_pept        247766..248011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96791"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNL6"
FT                   /protein_id="ACQ96791.1"
FT                   /translation="MDERGWFDIPNRRPLGSAPVSHDASRGRAGERVRSARAAAAFSTP
FT                   ISTVTWGWSLSVAVHAARANRAETTAQSGMSAMNDA"
FT   gene            complement(248072..248968)
FT                   /gene="dapA_1"
FT                   /locus_tag="GBP346_A0289"
FT   CDS_pept        complement(248072..248968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA_1"
FT                   /locus_tag="GBP346_A0289"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /note="identified by match to protein family HMM PF00701;
FT                   match to protein family HMM TIGR00674"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97923"
FT                   /db_xref="GOA:C4KNL7"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNL7"
FT                   /protein_id="ACQ97923.1"
FT                   /translation="MQSRFEGIWLPIVTPFHARETGTVDHAALARLARHYSDEGIAGFV
FT                   AGATTGEGALLNAGEQEAIFATLRDAAPARPIVLGITASATHAAAERARALAALRPDGL
FT                   LVTPPVYVRPTQAGVQRHIEAVVEAADLPVLVYNIPYRTGVNVELDTLKALSRDARVAG
FT                   VKECGGTMERMLRLVHETPLRILSGDDNQNFAALCAGAHGAIASAAHVLPAWHVRVYAL
FT                   LREGRLDDARRIAVALQPLVADLFAEPNPAPVKALLAAQGWCDNALRLPFLPVEEALAA
FT                   RLAAHWESLRQSEAAGA"
FT   gene            complement(249099..249281)
FT                   /locus_tag="GBP346_A0290"
FT   CDS_pept        complement(249099..249281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0290"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97464"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNL8"
FT                   /protein_id="ACQ97464.1"
FT                   /translation="MRRRVATSRHRERDDAKIATQPIFRSAMSIAFHSRSLSLPVALAA
FT                   CSRMAGLNLKKRLPD"
FT   gene            complement(249238..249747)
FT                   /locus_tag="GBP346_A0291"
FT   CDS_pept        complement(249238..249747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0291"
FT                   /product="putative insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99092"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNL9"
FT                   /protein_id="ACQ99092.1"
FT                   /translation="MADSRAASACAEAAPARYPGRKPLDDRAVLTGIPFVLQSGIPWEM
FT                   LPQAIGCASGMSCLRRLRHRQQVGVWGRVHEVFLAKRRAADRIVWSRVVIDSSAIRGMA
FT                   CRRSPPVGERSAALRRGALTMNVDGASRRTKSGSAAIAPCSGTRHTDRRAEHAPPCRNL
FT                   SPSRTR"
FT   gene            complement(250142..250708)
FT                   /locus_tag="GBP346_A0292"
FT   CDS_pept        complement(250142..250708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96193"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNM0"
FT                   /protein_id="ACQ96193.1"
FT                   /translation="MEPSATTTPPRHRVDLLVVIDSDYVKENYPDGSRVPGTPTPVDSR
FT                   ALFVICAGSDIGDIQSGEAICTAAVGDVVSVTCTTIQDNSSDAGILYDIWQAVNGQVFT
FT                   PFKQNFSELTGAVQPDPESESRDGLPPLRKEAHVSNFTADVKSLGNAQLGLAFGIYTLA
FT                   RDGQRQDLLGYYLSPVVLQVRGQRP"
FT   gene            251061..251618
FT                   /locus_tag="GBP346_A0293"
FT   CDS_pept        251061..251618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95614"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNM1"
FT                   /protein_id="ACQ95614.1"
FT                   /translation="MAELVLASSSQEIRVLVVIDTAYIRSLNITPSKDPLQPTGIGHDH
FT                   QYLLCTGSRGIISGQGTGDLEFRANVGDYVAFTGTSIQDNSDDAVIVYDIKHYSGDKVF
FT                   NPFSANIITRKGAVEPNPDTPSRNGLPPRHTPINFATFDSKVARSGREGFGIAFGLYTL
FT                   QSNGQDQDLYGYYWWDPYITVA"
FT   gene            complement(251857..251991)
FT                   /locus_tag="GBP346_A0294"
FT   CDS_pept        complement(251857..251991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95014"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNM2"
FT                   /protein_id="ACQ95014.1"
FT                   /translation="MHGGIGSSIAARPIHARIKTPRFGGQMESGYNCAGVASMRGIAH"
FT   gene            252088..252744
FT                   /locus_tag="GBP346_A0295"
FT   CDS_pept        252088..252744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0295"
FT                   /product="Fis family regulatory protein"
FT                   /note="identified by match to protein family HMM PF00158"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96911"
FT                   /db_xref="GOA:C4KNM3"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNM3"
FT                   /protein_id="ACQ96911.1"
FT                   /translation="MTIGASSAEPWLCPPSLLSRSASARRRGKPLDTRERIAASGIDSR
FT                   VSRGARMLTHRDLKNAIAKGMFRMDLFHRIAVTAASIPDLRERIEDLPSLIAYWLARLC
FT                   ERHGLPPRQFDDEAYARRLDCPWSGNVRELRNAIEGLVLLSDGPVITAEKQPAEIGEPA
FT                   SVSAHRAWVASGRRRAARMRRGRVHPPRARSPSRQSHGGGESARHRETHAVREGP"
FT   gene            252793..252978
FT                   /locus_tag="GBP346_A0296"
FT   CDS_pept        252793..252978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96181"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNM4"
FT                   /protein_id="ACQ96181.1"
FT                   /translation="MTRGARRKSPNGPNGEGGAAKPRASPRLRAATARPRSSPHGGDER
FT                   IARAGGRARRPRVRAM"
FT   gene            253213..254226
FT                   /locus_tag="GBP346_A0297"
FT   CDS_pept        253213..254226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0297"
FT                   /product="sulfate-binding protein (Sulfate
FT                   starvation-induced protein2) (SSI2)"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98057"
FT                   /db_xref="GOA:C4KNM5"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNM5"
FT                   /protein_id="ACQ98057.1"
FT                   /translation="MKHNKGIGRRLAAGVAAALLATAAHADTALLNVSYDVTRELYKDI
FT                   NASFVAAYKQKTGETVSVRQSHGASSAQALSVLQGLQADVVTMNQPNDIDLLAERGQLL
FT                   PKNWRTRLPNGSSPYSTTMVFLVRHGNPKQIKDWSDLAKPGVQVIIANPKTSGNGRYAY
FT                   LAAWGYQKLKGATDQQALDFEKAIFRNVPVLDSGGRGATTTFTQRGIGDVLVTFENEVA
FT                   LIDSGAAGASFDAVYPSASILAEPPVAIVDKVVDKKGTRRAAQAYLDYLYSPAAQEIVA
FT                   QHHLRPRDPNVLKQHASEFKPLKTFTVEQIFGNWANAQKTHFADGGTFDKIIVDRK"
FT   gene            254729..256420
FT                   /locus_tag="GBP346_A0298"
FT   CDS_pept        254729..256420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0298"
FT                   /product="serine carboxypeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00450"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97381"
FT                   /db_xref="GOA:C4KNM6"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNM6"
FT                   /protein_id="ACQ97381.1"
FT                   /translation="MHGGYGGLARPRGRMPATAAVAAALLLALGGCGDDLQSTTTPAQL
FT                   NQPYTDTTAYSPKAGDGLPASQVSERAAVMSHQWTANGASVDYLTTTGHLTATDPNGNA
FT                   EATMSYVAYTAPSRDGSPRPVTFFYNGGPGSSSVWLRLGSFAPTRVATPDPLMTNWPNF
FT                   PLVDNPESLIATTDMVFIDPPGTGLSEAIQPNTNQTFWGADADVKVMRDFIRRYLSVNG
FT                   RGGSPIYLYGESYGTPRTDMLALALESAGVPLTGIVLQSSILNYMAAAGDQAVGTFPSY
FT                   AQVAAYFNQVSPSPTNLGTYAQRIENFVTAQYAPIVHYATASSPISPDAGTLAAWSSQT
FT                   GMATASIGAYFQYFYDTEPSPGQTTLVPGYTIGRYDGRVSLPNGDARLASDDDPSDILI
FT                   SKPFTSALASQMPNYLGYTAPNATYQTLNPDIIGVWNFSHAGQPYPDTIPDLLAALQLN
FT                   PKLKVLASNGYHDLATPYFETEKELARLQTVSGLAPNLQVTFYQGGHMIYLDDVARPQM
FT                   QADLVAFYQNRPVANALTLAALPSPWPDESPANTPTAKIARAAAAR"
FT   gene            256493..256897
FT                   /locus_tag="GBP346_A0299"
FT   CDS_pept        256493..256897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98192"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNM7"
FT                   /protein_id="ACQ98192.1"
FT                   /translation="MFKILQSRRVVTAAAFALAAAYSVGVPAETVQAVSSVAPLHGGVD
FT                   GPFFPKAASAVPASASATTGAQLQQQAQSRLAASLGANGALRNGAALTKAQAQASGLGY
FT                   VAQHFDEIDTARTGKVTLKQVQQFIEQRRQ"
FT   gene            complement(256977..257138)
FT                   /locus_tag="GBP346_A0300"
FT   CDS_pept        complement(256977..257138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98560"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNM8"
FT                   /protein_id="ACQ98560.1"
FT                   /translation="MPYAITSRVPDQIRRPPRGGLRAGEAACAKESEECGEKGSTFIAV
FT                   SPESVRRA"
FT   gene            257137..258012
FT                   /locus_tag="GBP346_A0301"
FT   CDS_pept        257137..258012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0301"
FT                   /product="inward rectifier potassium channel"
FT                   /note="identified by match to protein family HMM PF01007;
FT                   match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95163"
FT                   /db_xref="GOA:C4KNM9"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="InterPro:IPR041647"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNM9"
FT                   /protein_id="ACQ95163.1"
FT                   /translation="MPASVWRDLYYWALKVSWPVFFASLAALFVVNNTLFALLYQLGDA
FT                   PIANQSPPGFVGAFFFSVETLATVGYGDMHPQTVYAHAIATLEIFVGMSGIALSTGLVF
FT                   ARFARPRAKIMFARHAIVRPFNGRMTLMVRAANARQNVIAEARAKMRLMRREHSSEGYS
FT                   LMKIHDLKLVRNEHPIFLLGWNMMHVIDESSPLFGETPESLAEGRAMLLVMIEGSDETT
FT                   AQVMQARHAWEHDDIRWHHRYVDLMSDVDGMTHIDYTRFNDTEPVEPPGAAPDAQAFAA
FT                   KPGEGDARPV"
FT   gene            complement(258096..258215)
FT                   /locus_tag="GBP346_A0302"
FT   CDS_pept        complement(258096..258215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98961"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNN0"
FT                   /protein_id="ACQ98961.1"
FT                   /translation="MCWSPLRHRRAPESAPLCFDAQRNELYFFTPIEEFFCLS"
FT   gene            258229..261804
FT                   /locus_tag="GBP346_A0303"
FT   CDS_pept        258229..261804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0303"
FT                   /product="2-oxoacid ferredoxin oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01558"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95817"
FT                   /db_xref="GOA:C4KNN1"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNN1"
FT                   /protein_id="ACQ95817.1"
FT                   /translation="MNARLPIDGPPALADYRLTDNLSATRGRIFLTGTQALVRLLLMQR
FT                   ALDAAQGVNTAGFVSGYRGSPLGMVDQQLWKAKKQLDASGVRFLPAINEELGGTAVLGT
FT                   QRVEADPQRTVDGVFAMWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSS
FT                   SMPHQSDFAMIAWHMPVVNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTV
FT                   DLDALAMRWPAPEGFAPPEGGLHNRWPDLPSLTIEARLAAKLDAVRHFARANSIDKWIA
FT                   KSARANVGIVTCGKAHLDLMEALRRLDLTAADLDAAGVRIYKVGLSFPLEMTRIDTFVE
FT                   GLAEVLVIEEKGPVIEQQIKDHLYNRAAGARPVVLGKHDAAGAPLLSELGELRPSRILP
FT                   VFAEWLARHKPALDRRARVVDLVAPSILSNEADAVRRTPYFCSGCPHNTSTKVPEGSIA
FT                   QAGIGCHFMASWMERDTTGLIQMGGEGVDWAAHAMFTNTRHVFQNLGDGTYFHSGILAI
FT                   RQAVAARANITYKILYNDAVAMTGGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKY
FT                   DGHHDLFPKGTTFHHRRELDAVQRELRETSGVTVLIYDQTCAAEKRRRRKKGEFPDPDR
FT                   RLFINEAVCEGCGDCGVQSNCLSVEPVETALGRKRRIDQSSCNKDFSCANGFCPSFVTV
FT                   EGATLKKAAGVAFDEAALAARVGALPRPATHLADAPYDMLVTGVGGTGVVTVGALVSMA
FT                   AHLEGKSASVLDFMGFAQKGGAVLSFVRIASSDAWLNQVRIDTQQADVLLACDMVVGAS
FT                   ADALQTVRRERTRIVVNTHAIPNAAFVRDPDASLHADALVEKMRHAAGDGFLARCDAQA
FT                   LATKFLGDTIGANILMLGFAWQQGLVPVSLDAMMRAIELNNVAVPMNKLAFSIGRMAAA
FT                   DAAGLDALWDARHPVHAPPLPQTLDAIVADREARLADYGGARYVARYRALVGAARATGD
FT                   ERLARAVATTFYRLLAVKDEYEVARLYTDGAFRTALEAQFEGAAGKDFRVKFNLAPPAT
FT                   AKAGRHGAAPRKQMFGQWLWPVLGVLARVRGLRGTWLDPFGGTVERKMERALADDYETT
FT                   MHRAFAAHSPQTAELVARLAELHAKVRGYGHVKLANVAGVKRSERELAARLSIDAATSD
FT                   AVRHALDEMKGAGALRGIAVVVAKS"
FT   gene            complement(262088..263755)
FT                   /locus_tag="GBP346_A0304"
FT   CDS_pept        complement(262088..263755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0304"
FT                   /product="Na+/H+ antiporter"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM TIGR00831"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96250"
FT                   /db_xref="GOA:C4KNN2"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNN2"
FT                   /protein_id="ACQ96250.1"
FT                   /translation="MAIVFTVLILLLAVALSGVATRVLPLRLPLPLMQIAIGAVLAWPR
FT                   FNLHVTFDPEIFMLLFIPPLLFADGWRIPKRELYLQRRAILMLAFGLVFMTVLAVGYFA
FT                   HGLIPGLPLPIAFALAAVLSPTDAVALAGIAGKGRIPPQLMHILEGEALMNDASGLVAL
FT                   KFAIAAALTGMFSLRDASISFVIVASGGLAAGAALAWLFSALSTRFLNAAQEGDPAPGI
FT                   VMTLLVPFASYLIAEHLGLSGILSAVASGMMMNYTSFSKSSTVAARVRAESTWAMIEFV
FT                   FNGMVFIMLGLQLPHIIGRALVDAHHTSDALVGAMIGYVAAMLAALYAIRFTWVWLLRW
FT                   IASRRAAKQGLAGTMAGLRTIAVMTVGGVRGAITLAGVLSIPVALGDGTPLAGRDTAIF
FT                   VASGVILGSLVVAVIALPLLLRGVRPMRNPHAEEERAARAAAAQAAIRAVDAAHDALAV
FT                   DLDESAAARCADVTARVMDLYRRRLAGLAADGATPREEARQTEKMELALKIAAIRAERA
FT                   VLYRLRGEQKINDETLAKLMREVDFSETALSTRKKGIV"
FT   gene            263809..265356
FT                   /locus_tag="GBP346_A0305"
FT   CDS_pept        263809..265356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0305"
FT                   /product="EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96786"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNN3"
FT                   /protein_id="ACQ96786.1"
FT                   /translation="MRGVKRGASAGALWWCAQSPSACTRGAPRAWRPRPGAGGAAGRHA
FT                   REHGACLRLVDNYDRTTEDHDENPRVACFACRRFRHQEGRRMTIAQQERPVAASPYRFE
FT                   AEMTSGLERVAAHHHDLTLTSVFQPIFSLSHMRAVGYEALLRAHDALDRPVSPLDVFGE
FT                   AARHGEATQVDRLAQALHLENFARFGAEREWLFLNVHPGVLTDPFQAAALFANLRRLDI
FT                   APRRIVLEVLEQRAEDIERLADAVREFREHGFLIALDDFGAGHSNIERIWQLNPDIVKL
FT                   DRIMLSHAQHRAGLTAILHGLVTLLHEAGKLVLIEGIETEHEAQIALACDADFVQGHFF
FT                   GRPAPGLPDSAAASACIGELTERYRQQTEAAERRDAQRLAPYQRAFERAAERLAAGEPL
FT                   DEVCWNFLALDHAARCFLLDERGRQAGRNVVLRADRASHETRFLPLADAQGANWLRRPY
FT                   FRAAIAEPGRVQATRPYLSINEALPCVTLSIAVRVNDALCVLCGDIDWIDADAAAGA"
FT   gene            265670..265813
FT                   /locus_tag="GBP346_A0306"
FT   CDS_pept        265670..265813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97216"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNN4"
FT                   /protein_id="ACQ97216.1"
FT                   /translation="MCRIRAAARACRDGVAFCEREVENALRIAVPGRHRAIRPSAQRGE
FT                   ES"
FT   gene            265810..266190
FT                   /locus_tag="GBP346_A0308"
FT   CDS_pept        265810..266190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98624"
FT                   /db_xref="GOA:C4KNN5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNN5"
FT                   /protein_id="ACQ98624.1"
FT                   /translation="MKRPLSLTVLAWFVIVSNVIGLISMPFSLRDPNAVALLRYSPLPL
FT                   EATVAIAVVSEGLHLVAGTAILKRRIWGRTLYAIVALAGFAISVFTTPFKGMLIIAAAL
FT                   IALFLFILYRPAATAYFRQRAS"
FT   gene            complement(266171..266314)
FT                   /locus_tag="GBP346_A0307"
FT   CDS_pept        complement(266171..266314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98209"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNN6"
FT                   /protein_id="ACQ98209.1"
FT                   /translation="MAFEAGGRRGRATARERRAAGAIATKPPRARTGTAGTSRDSFMTR
FT                   AA"
FT   gene            266486..267925
FT                   /locus_tag="GBP346_A0309"
FT   CDS_pept        266486..267925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0309"
FT                   /product="alkaline phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99091"
FT                   /db_xref="GOA:C4KNN7"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNN7"
FT                   /protein_id="ACQ99091.1"
FT                   /translation="MKRVRLAALLGASVFAAAGCGSDEPKTPGASDNGAQTGAARNVIF
FT                   FLGDGMGMTTLTAARIYALGEDGALTLDTLPETAFVKTYSNDAQVTDSAPSMSAYMTGV
FT                   KTNNEVISMTPDTKAIEPSASLTGNCGANNGKPVPTLLEIAKAKGLATGVVTTTRVTHA
FT                   TPAATYAHVCHRDAENDIAAQLVPGGAGYNAALGGGVDVVLGGGAQFFVPKEAGGKRAD
FT                   GRHLVNELKAKGYAIAQNRDELLAADATKRGKLAGLFASSHMSYDLDRGATKEPSLADM
FT                   ATRALDVLQKNPNGYFLMVEGGRIDHALHDTNAKRALQDTVAFDNAIKATLDKVRQTDP
FT                   ELKNTLVVVTADHDHTLVLNGYAARTGKTEAGKPGVLGVLRNYQTGAVAKDADGAPYTI
FT                   IGFGNGEKRVQGSRAGTSLTDAVTGADDYRQEAVVRMAKGGETHGGTDVFLGAIGRGAD
FT                   GFHGVIENNKVFELVRGAAQL"
FT   gene            267958..269361
FT                   /locus_tag="GBP346_A0310"
FT   CDS_pept        267958..269361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0310"
FT                   /product="alkaline phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95319"
FT                   /db_xref="GOA:C4KNN8"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNN8"
FT                   /protein_id="ACQ95319.1"
FT                   /translation="MSTIKRIAAAAFAAAALSGGFGHAAHAAGQAKNVIFFLGDGMGPA
FT                   TVTASRLYKVGEAGQLTMEKLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSM
FT                   SPDTRAIAPGSDANGNKTVNRCGVGNGTPAATLLELAKARGKAVGAITTTELTHATPAA
FT                   TYSHICHRDAQYDIAAQAVPGGAGYNAALGDGVDVLMGGGRNHWTPYDPLANRRGRADG
FT                   RNLLAELQAKGYAVVATKDQLAQAGAGKLIGLFSTTSHLEYELDRVAGKGEGATQPSLS
FT                   EMTAKAIDVLRKNPNGYFLMVEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLS
FT                   DTLIVVTADHDHTMTINGYSKRGNPVLDISRNYRDGQPNKDADGNPYTTLVFGNGANRP
FT                   NVRVPVDSSTATNDAYLQEVGVRMGSAGSETHGGGDVMLFADGAGAKAFKGTLDNTKVF
FT                   GLVKAAFGF"
FT   gene            269376..270161
FT                   /locus_tag="GBP346_A0312"
FT   CDS_pept        269376..270161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96548"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNN9"
FT                   /protein_id="ACQ96548.1"
FT                   /translation="MRTFAMKLDVVRRACAALAAPPAPDGGRAPDLDAVLLHESMTVSA
FT                   DGVTRTVTYRERMVRRDGHVWIERVPPSGAKRAHAGGAHAHEGLDAARTPPSRGGAHPA
FT                   AAAADAHAGHRHFDFDSAARHVTNDGGRIGVEYVDAAQRTVVAVPPAEYETTGFDGSWD
FT                   NAFYITPPSQLKRLAAQSKPGPAPGTRWYEQTVGAPRAQGTNRVLWSDALQAPLVVEYR
FT                   SADGHASRKLTLTPAPRANALPWRQLQSYTRKAYADYLD"
FT   gene            complement(270149..270337)
FT                   /locus_tag="GBP346_A0311"
FT   CDS_pept        complement(270149..270337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96429"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNP0"
FT                   /protein_id="ACQ96429.1"
FT                   /translation="MPLRMNTPAPPPRRLASHRVAWRSAAGLHRAAHAWRRPARFTSRR
FT                   ARCATLAARNESARQSR"
FT   gene            270538..271251
FT                   /locus_tag="GBP346_A0313"
FT   CDS_pept        270538..271251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0313"
FT                   /product="CutC family protein"
FT                   /note="identified by match to protein family HMM PF03932"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96537"
FT                   /db_xref="GOA:C4KNP1"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNP1"
FT                   /protein_id="ACQ96537.1"
FT                   /translation="MPASSILLEVIATTIGDARAAARAGADRIELVTAISEGGLTPSVG
FT                   VIEAVVAAVPIPVNVIVRPHSRSFSYDASELAAIARDVRAAVAAGANGIVFGMLDAHGD
FT                   IDLDALRRIADAADGRDLTFHRAFDVARDLNAAFDTLLRVPSVTSVLTSGGHPSVLDAR
FT                   DVVARMVRRAAGAACTVLAGAGLTVDALGDFVRATGVRAVHFGSGVRERGEVLAPIDER
FT                   LVAKARAALDAATRG"
FT   gene            complement(271378..272388)
FT                   /gene="bioB"
FT                   /locus_tag="GBP346_A0314"
FT   CDS_pept        complement(271378..272388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="GBP346_A0314"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968; match to protein
FT                   family HMM TIGR00433"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97004"
FT                   /db_xref="GOA:C4KNP2"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNP2"
FT                   /protein_id="ACQ97004.1"
FT                   /translation="MTEAQTACATTETPVAAPAAPRWRVADVIALYELPFNDLLFRAQQ
FT                   THREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLAAARTA
FT                   KENGATRFCMGAAWRNPKDRHIEPIKEMIRGVKDMGLETCVTLGMLEEHQAKALAEAGL
FT                   DYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLI
FT                   AQLANMNPYPESVPINNLVAIEGTPLENAQALDPFEFVRTIAVARITMPKAMVRLSAGR
FT                   EQLDDAMQALCFLAGANSMFYGDVLLTTGNPRAEADRKLLARLGMSASEASQLSA"
FT   gene            complement(272461..273183)
FT                   /gene="bioD"
FT                   /locus_tag="GBP346_A0315"
FT   CDS_pept        complement(272461..273183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="GBP346_A0315"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="identified by match to protein family HMM TIGR00347"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97147"
FT                   /db_xref="GOA:C4KNP3"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNP3"
FT                   /protein_id="ACQ97147.1"
FT                   /translation="MSAPLSLFVTGTDTEIGKTFVSAALLHGFARAGLRAAAMKPVAAG
FT                   AYERDGAWRNEDADQLDAAANVALPAAIRTPFLLKAPAAPHIVAAREGVALDIGTIVDA
FT                   HRRACEMADVIVVEGVGGFRVPLADTRDTADLAVALGLPVVLVVGVRLGCISHALLTAE
FT                   AIAARGLPLAGWVANRIDPAMPFADDNVDTLRAWLEREHRAPLLGALAHMSPPSPDAAS
FT                   HALDVNLLLNALRAAAPR"
FT   gene            complement(273180..274364)
FT                   /gene="bioF"
FT                   /locus_tag="GBP346_A0316"
FT   CDS_pept        complement(273180..274364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="GBP346_A0316"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00202; match to protein
FT                   family HMM TIGR00858"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97865"
FT                   /db_xref="GOA:C4KNP4"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNP4"
FT                   /protein_id="ACQ97865.1"
FT                   /translation="MNPLATLEQGLADIDAQGLRRCRRVADTACGAHMTVDGRAIIGFA
FT                   SNDYLGLAAHPRLVEALAEGARRYGSGSGGSHLLGGHSRAHATLEDELAAFSGGFSDAP
FT                   RALYFSTGYMANLAALTALAGRGATIFSDALNHASLIDGARLSRANVQIYPHGDADALD
FT                   ARLRACDAPTKLIVSDTVFSMDGDVAPLARLVALAETHGAWLVVDDAHGFGVLGPQGRG
FT                   ALAAHGLRSPNLVYVGTLGKAAGVAGAFVVAHETVIEWLVQRARSYIFTTAAPPSVACA
FT                   VSASLAVIASDEGDARRAHLGALIKRTRAILRATHWQPVDSHTAVQPLVIGSNEATLAA
FT                   MAALDAQGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLEAALVTPIGAAA"
FT   gene            complement(274361..275707)
FT                   /gene="bioA"
FT                   /locus_tag="GBP346_A0317"
FT   CDS_pept        complement(274361..275707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="GBP346_A0317"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   transaminase"
FT                   /EC_number="2.6.1.62"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00508"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98851"
FT                   /db_xref="GOA:C4KNP5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNP5"
FT                   /protein_id="ACQ98851.1"
FT                   /translation="MSTHATDDWVARSLRAVWHPCTQMKHHERLPLIPVARGERAWLFD
FT                   RAGNRYLDAISSWWVNLFGHANPRINAALKQQLDTLEHAMLAGCTHESAIELAERLAAR
FT                   TQHTLGHAFFASDGASAVEIALKMSFHAWRNRGRGDKREFVCIANGYHGETIGALGVTD
FT                   VALFKDAYDPLIRAAHVVASPDARGARDGETAADVAARALGDVRRLFAERGEKIAALIV
FT                   EPLVQCAAGFAMHDPSYVRGLRALCDAHDVHLIADEIAVGCGRTGTFFACEQAHVWPDF
FT                   LCLSKGISGGYLPLSLVLARDAIFDAFYDDDVTRGFLHSHSYTGNPLACRAAVATLELF
FT                   DTDDVLAENARKSALMREALAPLASHPHVRHLRERGTIFAFDVALEGDAARTFPRRFFE
FT                   HALARETLLRPIGTTVYLMPPYILDEGEIEWLASRTRATLDATLSEAHA"
FT   gene            275696..275833
FT                   /locus_tag="GBP346_A0318"
FT   CDS_pept        275696..275833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95887"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNP6"
FT                   /protein_id="ACQ95887.1"
FT                   /translation="MCAQDCSGTKTRRGREAPLAHAESTAEKRTIGWRRKTRVQIENRG
FT                   "
FT   gene            complement(276271..277599)
FT                   /locus_tag="GBP346_A0319"
FT   CDS_pept        complement(276271..277599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96529"
FT                   /db_xref="GOA:C4KNP7"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNP7"
FT                   /protein_id="ACQ96529.1"
FT                   /translation="MVQFAWVGSGMAFGKVMTGWIAACVLSAAQADPLPSDAPSAPATA
FT                   PYAPRVSHAPRAAGALANAERFDYGDSGLPPVAANLNETIIRIPVDAAGAITLEATVYK
FT                   PDGPGPFPLVVFNHGKNPGDLRAQPRSRPLSFAREFVRRGYAVVAPNREGFAGSGGTYI
FT                   QEGCDVERNGVAQARDVAATIGYMSKLSYVDARHVVVAGTSHGGLVSLAYGTEAARGVR
FT                   GIINFSGGLRQDLCEGWQKNLVDAFDTYGSRTHVPSLWLYGENDSVWSPALVAQLRDAY
FT                   MSHGASTLFVDFGRYKDDAHRIIVDRDGVPIWWPPVASFLAQLSLPTSVRYAVANPHEP
FT                   KASGYAAIESVDAVPFIDDAGRAAYRRFLAQHPSRAFAVSSEGAWSWAEGGDDPMALAL
FT                   EGCRKQGAGACQLYAVDERVVWRDAGTQTADESTSAAHALASR"
FT   gene            complement(277763..278215)
FT                   /locus_tag="GBP346_A0320"
FT   CDS_pept        complement(277763..278215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97018"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNP8"
FT                   /protein_id="ACQ97018.1"
FT                   /translation="MQPTTNAPERPLDCPCGGAAPGANANARAPRYADCCARLIEGHAT
FT                   AATALELMRSRYSAYVLGATDYLRATWDPSTCPAELDADTGRAHAPRWLGLVIKRHAQL
FT                   DATHAEVEFVARYKIGGRAHRMHETSRFTRDAQGAWRYVDGDVSER"
FT   gene            complement(278247..278468)
FT                   /locus_tag="GBP346_A0321"
FT   CDS_pept        complement(278247..278468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0321"
FT                   /product="short chain dehydrogenase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNP9"
FT                   /protein_id="ACQ97013.1"
FT                   /translation="MNDALRIASLQARHAACIALHPGWVRTDMGGAQAALDPQASVAGM
FT                   RRVIAQAAGDRERANGRFFQYDGVELGW"
FT   gene            complement(278493..278924)
FT                   /locus_tag="GBP346_A0322"
FT   CDS_pept        complement(278493..278924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0322"
FT                   /product="short chain dehydrogenase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98932"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNQ0"
FT                   /protein_id="ACQ98932.1"
FT                   /translation="MKTVLIVGASRGIGREFVGQYLHDGWRVIATARDAAALAALDALG
FT                   ARALALDVAQPDDIAAFDARLGGAALDAAVVVSGVYGPRTAGVEPIGVEDFDAVMHTNV
FT                   LGPMLLMPILLPRVEASRGVLAVLSSKMGSIGEATGTTG"
FT   gene            complement(278955..280148)
FT                   /locus_tag="GBP346_A0323"
FT   CDS_pept        complement(278955..280148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0323"
FT                   /product="acetyl-CoA acetyltransferase, cytosolic 1
FT                   (Cytosolicacetoacetyl-CoA thiolase 1) (Thiolase 1)"
FT                   /EC_number="2.3.1.9"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98760"
FT                   /db_xref="GOA:C4KNQ1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNQ1"
FT                   /protein_id="ACQ98760.1"
FT                   /translation="MTAVDQDPIVIASAARTPIAGFQGEFASLAAPQLGAAAIAAALER
FT                   AGLQPEQIDEAVMGCVLPAGQGQAPARQAALGAKLPLSVGCTTINKMCGSGMRAAMFAH
FT                   DMLVAGSVDVIVAGGMESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLM
FT                   GTFAEECAGEYAFSRDAQDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDAVIARD
FT                   EQPFKANPEKIPTLKPAFSKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVV
FT                   GHSTFAQAPSKFTTAPVGAIRRLFEKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHE
FT                   KVNVNGGACALGHPIGASGARILVTLIGALRARGAKRGVASLCIGGGEATAMGIELI"
FT   gene            complement(280135..280905)
FT                   /locus_tag="GBP346_A0324"
FT   CDS_pept        complement(280135..280905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0324"
FT                   /product="carbonic anhydrase 2 (Carbonate dehydratase 2)"
FT                   /EC_number="4.2.1.1"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97601"
FT                   /db_xref="GOA:C4KNQ2"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNQ2"
FT                   /protein_id="ACQ97601.1"
FT                   /translation="MNKNDHPLSHLFDNNDAWVKRKLADDPQYFSRLADQQAPEYLWIG
FT                   CSDSRVPANQIIGLPPGEVFVHRNIANVVVHTDLNCLSVIQFAVDLLKVKHVMVVGHYG
FT                   CSGVNAALHNRRVGLADNWLHHVQDVREKHAALLEDWPLGEARYRRLIELNAIEQVVNV
FT                   CRTTIVNDAWARGQPLTVHALVYGVHDGRMRNLGMAVSHAEQLDATYRRAVAALSASGA
FT                   HSADNDVVAADAAQLAGAVDLIAQTIKETKHDGC"
FT   gene            complement(280963..282804)
FT                   /gene="aceK"
FT                   /locus_tag="GBP346_A0325"
FT   CDS_pept        complement(280963..282804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceK"
FT                   /locus_tag="GBP346_A0325"
FT                   /product="[isocitrate dehydrogenase (NADP(+))] kinase"
FT                   /EC_number="2.7.11.5"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF06315"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95747"
FT                   /db_xref="GOA:C4KNQ3"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNQ3"
FT                   /protein_id="ACQ95747.1"
FT                   /translation="MSFSPVSPRTMNHFPKLLSSQIGFDVAQTILENFDRHYRIFREAA
FT                   VEAKDLFERADWHGLQRLARERITSYDDRVRECVELLEDEYDAENIDNEVWPQIKLHYI
FT                   GLLTSHRQPECAETFFNSVCCKILHRAYFNNDFIFVRPAISTEYIENDEPAAKPTYRAY
FT                   YPGSEGLAATLERIVTNFQLNPPFEDLERDIACIMQAIHDEFGAFDEAVNFQIHVLSSL
FT                   FYRNKTAYVVGRIINGDRVLPFAVPIRHARAGILALDTVLLRRDQLKIIFSFSHSYFLV
FT                   DMNVPSAYVQFLRSIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHSSDRFIVAPGI
FT                   KGLVMLVFTLPSFPYVFKMIKDHFPPPKDTTREQIMAKYLLVKRHDRLGRMADTLEYSS
FT                   VALPLARLDDALVRELEKEVPSLIEYEGENLVIKHLYIERRMVPLNLYLQNGSDAEIEH
FT                   GVREYGNAVKELMQANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNVRRVPPPRN
FT                   DEDEMSGEPWYTVGPHDIFPETYAPFLLGDPRVREHFLAHHADFFDPQLWQDSKDRLLR
FT                   GELPDFFAYEPALRFCIRYPERFAPGDAADGGKLAAA"
FT   gene            complement(282801..282992)
FT                   /locus_tag="GBP346_A0326"
FT   CDS_pept        complement(282801..282992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0326"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98337"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNQ4"
FT                   /protein_id="ACQ98337.1"
FT                   /translation="MREGAPGRLRAPEKRSGHDPAQTPIVAGRSAECRATSPNRPRPPP
FT                   APNRPALAKAGPRGAKMA"
FT   gene            283063..284142
FT                   /locus_tag="GBP346_A0327"
FT   CDS_pept        283063..284142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0327"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96852"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNQ5"
FT                   /protein_id="ACQ96852.1"
FT                   /translation="MNALEHQLDYPFADALPEPGGFVEVAPGVRWLRMPLPFALDHINL
FT                   WLLRDEIDGQAGWTIVDCGIASEQIKTHWERIFDAHLDGLPVLRVIVTHCHPDHFGLAN
FT                   WLCDGGARARWNVRLWMTLGEYLFGCVMAAGNGSNAGGPAAADHFARHGLADPAALDKL
FT                   RNRRGYYADLVPAVPPRYRRLREGDALAIGAREWRVVTGYGHSPEHCALHCAADGMLIS
FT                   GDMVLPRISTNVSVFDLEPEANPLALYLESLGRYEAMAEGTLVLPSHGLPFRGVRTRVA
FT                   QLRAHHDARLAEVRAACRERPMSAADIVPIMFKRGGLDIHQMTFALGEAIAHLNLLWLA
FT                   GELARETGADGVLRFRHAD"
FT   gene            complement(284429..286075)
FT                   /locus_tag="GBP346_A0328"
FT   CDS_pept        complement(284429..286075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0328"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95816"
FT                   /db_xref="GOA:C4KNQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNQ6"
FT                   /protein_id="ACQ95816.1"
FT                   /translation="MARTAPAGALVALHHVSFRFDDGVTLFDSLDLTFDRAPSAIVGRN
FT                   GAGKSVLARLIACRLAPTAGAIERHASIAFVAQHDADAMHDSRCTAAAVARLDAPLAAL
FT                   ERVARGDARADDFDLLDGRWDLAERWQAALDEAGLPPLDARTPAHALSGGQLARVAMIG
FT                   ALLSGADLLVADEPTNHLDAPGREWLRAALAGWRGGLVVVSHDRALLADVERIVELTPR
FT                   GARVYGGNYAAYRAQRDAEAQAAQAALDHAHAERERERRRLAREHDTIQRHAAATRRYA
FT                   ETANLPSGKRVSLKNSAREIMGRVRRDHRDTKTALGDAVQAAAARIEPDAPVLVSLPGT
FT                   EIAARRRLFTLDAARLPWLPAHARAATVTWSAHGPARIALTGPNGCGKSTLLRMLAGEC
FT                   APRAGRCDTHVPLAYLDQRLALLDPRRSVVEQLAALRTPLGQGELRSRLALLQLDATRA
FT                   TQPSARLSGGERLKAALACALWRETPAQLLLLDEPTNHLDLESVRAFEAALADFPGAIV
FT                   AVSHDAAFIDALAPTHAMRWTSEGWRFEPVA"
FT   gene            complement(286309..287895)
FT                   /locus_tag="GBP346_A0329"
FT   CDS_pept        complement(286309..287895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0329"
FT                   /product="periplasmic dipeptide transport protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96466"
FT                   /db_xref="GOA:C4KNQ7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNQ7"
FT                   /protein_id="ACQ96466.1"
FT                   /translation="MRFTHIAAAALVAAASVAAAKPLTVCTESSPDGFDVVQYNSLVTT
FT                   NASADVVFNTLVSYDEATKKVVPALADKWDVSADGLAYTFHLRPNVAFQTTDSFKPTRA
FT                   LDADDVVFTFGRMLDDANPWHKVAGASGFPHAQSMGLAKLVKAVTKIDESTVKFELNEP
FT                   NATFVPILTMGFASIYSAEYADQLLKAGKQADLNAKPVGTGPFVLKSYTKDAVIRYEAN
FT                   PTYWGPKPKVERLIYAITPDPSVRAQKVKAGECQIALSPKPQDVAAAKADRALRVVETP
FT                   AFMTAFVALNTQKKPLDNDKVREALNLAFDRATYLKVVFDNTATPATNPYPPNTWSYAK
FT                   SIAPYPHDPAKAKQLLAQAGFPNGFSTTIWVRPTGSVLNPNPKAGAELLQADLAKIGVK
FT                   ADVRVIEWGELIKQAKLGQHDLLFMGFAGDNGDPDNILTPQFSCNSVKSGLNFARYCDP
FT                   KLDKLIADAKETADQAKRAKLYEAAQKIIHDEALWIPLGYPTAAAITRPNVAGYRVSPF
FT                   GRQHFDAVSVQ"
FT   gene            complement(287993..288676)
FT                   /locus_tag="GBP346_A0330"
FT   CDS_pept        complement(287993..288676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97067"
FT                   /db_xref="GOA:C4KNQ8"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNQ8"
FT                   /protein_id="ACQ97067.1"
FT                   /translation="MQRIMSAEPIVTLSVARTLSAAIGAAFRRSDRASARRDSRGRRAC
FT                   ASARRASTRRRPAARCAPSAGLGRALARQAAPGAGLSRSVASATVNKVRGSGMRAIRHA
FT                   FDAPANGSADVAAAGGMARSSNGPYRALGVRGGYRSGHAALHDHVAPDGLADAGDRGTS
FT                   MGEFGQRGAPRLHACRSRRVRGRIAAMGAACATGDRADVTPLARGGTAPRQRFRRRGAT
FT                   PSDAD"
FT   gene            complement(288872..289360)
FT                   /locus_tag="GBP346_A0331"
FT   CDS_pept        complement(288872..289360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0331"
FT                   /product="MarR family regulatory protein"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98536"
FT                   /db_xref="GOA:C4KNQ9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNQ9"
FT                   /protein_id="ACQ98536.1"
FT                   /translation="MHFVRHRMLVVDKRFQRLPMSDAPMRLPCHCGTLRQATRAITSLY
FT                   DAHLARHGIRITQFTILAALHGGDALPTGELATRLLLDQTTLSRTLATLQSNQLVRAES
FT                   GDDQRVRLWSLTPKGTALFKAARVDWEAAQNDVSRRIGKRNMQALDAGIFALAKALSN"
FT   gene            complement(289341..289469)
FT                   /locus_tag="GBP346_A0332"
FT   CDS_pept        complement(289341..289469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98107"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNR0"
FT                   /protein_id="ACQ98107.1"
FT                   /translation="MHGSPPNRCGRIDSANGASRTRCYTETPSPAGAKHAYAFCTS"
FT   gene            289560..290291
FT                   /locus_tag="GBP346_A0333"
FT   CDS_pept        289560..290291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0333"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97908"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNR1"
FT                   /protein_id="ACQ97908.1"
FT                   /translation="MLERVEMNLNDAVVLVTGANRGLGLAFVEGLKAAGAKKIYAAARD
FT                   PARVTTPGVQPVRLDVTRAQDIAAAARELRDVNLLVNNAGIFRMGSLLAEADGGGLQAQ
FT                   LDTNFFGPLAMARAFAPVLRENGGGAIINVLSVLSWLGLPNTGAYGISKAAAWAATNAI
FT                   RNELREQRTRVLALHSAYIDTDMVAHAQGVPKNRPEDVVRQTLDALAAGRDEVLVDALT
FT                   RDVKAGLSAEPAVYTQPPTGA"
FT   gene            complement(290444..291223)
FT                   /locus_tag="GBP346_A0334"
FT   CDS_pept        complement(290444..291223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0334"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96396"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNR2"
FT                   /protein_id="ACQ96396.1"
FT                   /translation="MNAPAPLKVFITGASSGLGLALAAEYARHGATLGLVARRADALAE
FT                   FAPRFPKASISIYPADVRDADALALAASRFVAAHGCPDVVIANAGISKGAITGEGDLAA
FT                   FREIMDVNYYGMIATFEPFIAPMTAARRGTLVGIASVAGVRGLPGSGAYSASKAAAIKY
FT                   LEALRVELRPAQVAVVTIAPGYIRTPMTEHNPYPMPFLMDSDRFAKRAALAISQKTAFR
FT                   VIPWQMGIVAKLLHVMPRWLYDRLFEKAPRKPRAKAG"
FT   gene            complement(291240..291878)
FT                   /locus_tag="GBP346_A0335"
FT   CDS_pept        complement(291240..291878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0335"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98964"
FT                   /db_xref="GOA:C4KNR3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNR3"
FT                   /protein_id="ACQ98964.1"
FT                   /translation="MKKLLSSLFLSLSLVAGFAQASPSAPVAGKDFEVMKSPQPVSAPA
FT                   GKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGDKIAFKRVPVAFRDDFVPHSKLFYALAA
FT                   LGVSEKVTPAVFNAIHKEKNYLLTPQAQADFLATQGVDKKKFLDAYNSFSVQGQVKQSA
FT                   ELLKNYNIDGVPTIVVQGKYKTGPAYTNSLEGTAQVLDFLVKQVQDKKL"
FT   gene            complement(291930..292790)
FT                   /locus_tag="GBP346_A0336"
FT   CDS_pept        complement(291930..292790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0336"
FT                   /product="cell division protein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97344"
FT                   /db_xref="GOA:C4KNR4"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNR4"
FT                   /protein_id="ACQ97344.1"
FT                   /translation="MTQAMAKPRRTSKQSKQAGGTFLGIVLGLIVGLAIAVVVALYITR
FT                   APSPFVSKVAPPADNNASQPQQFDPNRALQGKTPGQPVTPQAAQPAPPNTAPGQAANPS
FT                   QPPLLPEPQIVEVPSSNNNGNGSPSASNNAADNGVAVAPKPAEPAPPPAKKPQTAANGS
FT                   SAPHVANNNAQASAAATPPKAAQAPKGASSATTTAAKPTSGADANTGYFLQVGAYKTEA
FT                   DAEQQRARLGFQGFESKVSKRDVSGVTYFRVRIGPFSKFEDMNSARQRLSDAGVDTAVI
FT                   RFTKQ"
FT   gene            complement(292857..294641)
FT                   /gene="argS"
FT                   /locus_tag="GBP346_A0337"
FT   CDS_pept        complement(292857..294641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="GBP346_A0337"
FT                   /product="arginine--tRNA ligase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF03485; match to protein
FT                   family HMM PF05746; match to protein family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95945"
FT                   /db_xref="GOA:C4KNR5"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNR5"
FT                   /protein_id="ACQ95945.1"
FT                   /translation="MLPAQKHTLETLLENSVKQVVQASKGDADAAFVLPAIALERPKVA
FT                   AHGDVACNVALQLAKPLGANPRQLAEQIVAALTAQPEAAGLVDAAEIAGPGFINLRLTP
FT                   ASKQAVIGAVLAQGRAFGASERDHGKRVLLEFVSANPTGPLHVGHGRQAALGDALANVL
FT                   ASQGYAVHREFYYNDAGVQIGNLAISTQARARGLKPGDAGWPEAAYNGEYIADIARDYL
FT                   NGETVAASDGEPVTGKRDVEDLEAIRKFAVTYLRREQDMDLKAFGVKFDQYYLESSLYT
FT                   EGRVEKTVDALIAAGMTYEQEGALWLRTTDEGDDKDRVMRKTDGTYTYFVPDVAYHVTK
FT                   WERGFTKVINIQGSDHHGTIARVRAGLQGLHIGIPKGYPDYVLHKMVTVMRDGQEVKIS
FT                   KRAGSYVTVRDLIEWSGGATPGSEGSPELLDEATITRGRDAVRFFLISRKADTEFVFDI
FT                   DLALKQNDENPVYYVQYAHARICSVINEWKSRYGATDALLPGADLSPLDSKQAMALMQK
FT                   LAEYPDVLAHAAGELAPHAVAFYLRELASEFHSFYNAERVLVDEQAPRTARVALLAATR
FT                   QVLENGLAMLGVSAPSKM"
FT   gene            294621..294740
FT                   /locus_tag="GBP346_A0338"
FT   CDS_pept        294621..294740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0338"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98494"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNR6"
FT                   /protein_id="ACQ98494.1"
FT                   /translation="MFLSRQHAGRGYRWRRPAWPGRRRAAGRAFQGSLNFNRC"
FT   gene            294844..295167
FT                   /locus_tag="GBP346_A0339"
FT   CDS_pept        294844..295167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08895"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95065"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNR7"
FT                   /protein_id="ACQ95065.1"
FT                   /translation="MITFKSKAAQDLDVLKDFAVYVLGLVGKQLGERGVITSDELDGAI
FT                   AKLEDAVSQAKQARAEHAGHFHEDEPDHAHHEVPPSLAQRVAPFLTMLREAKAQNADIH
FT                   WGF"
FT   gene            complement(295411..298128)
FT                   /gene="metH"
FT                   /locus_tag="GBP346_A0340"
FT   CDS_pept        complement(295411..298128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="GBP346_A0340"
FT                   /product="methionine synthase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF00809; match to protein family HMM PF02310; match to
FT                   protein family HMM PF02607; match to protein family HMM
FT                   PF02965; match to protein family HMM TIGR02082"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95529"
FT                   /db_xref="GOA:C4KNR8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNR8"
FT                   /protein_id="ACQ95529.1"
FT                   /translation="MTDHTMRLAGLEPFNVTSGTLFINVGERTNVTGSKAFARMILNGQ
FT                   FDEALAVARQQVENGAQVIDVNMDEAMLDSKAAMVRFLNLIASEPDIARVPIMIDSSKW
FT                   DVIEAGLKCVQGKAIVNSISLKEGKEAFVHHAKLIRRYGAAAVVMAFDEAGQADTLARK
FT                   TEICKRSYDVLVNEVGFAPEDIVFDPNIFAVATGIDEHNNYAVDFIEATRWIKRNLPYA
FT                   KVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGQLGVYAELDAELRER
FT                   VEDVILNRRDDSTDRLLEIADKFKTGAAKKEENLEWRSQPVEKRLAHALVHGITNFIVE
FT                   DTEEARAKIAAAGGRPINVIEGPLMDGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHL
FT                   IPFIEEEKRLLAQAGGDVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMV
FT                   PCNEILAKAKVEGADIVGLSGLITPSLEEMAYVASEMQRDDYFRVKKIPLLIGGATTSR
FT                   VHTAVKIAPHYEGPVVYVPDASRSVSVASNLLSDEGATKYLDELKADYERIRAQHANKK
FT                   ALPLVTLAEARANKTKIDWARYTSVKPKFIGRRMFKNYDLNELANYIDWGPFFQTWDLA
FT                   GPYPAILNDEIVGESARRVFSDAKSMLARLIQGRWLTANGVIALLPANTVGDDDIEIYT
FT                   DDTRAEVLLTWHNLRQQSVRPVVDGVMRPNRSLADFIAPKDSGVADYIGMFAVTAGIGV
FT                   DAKEKQFLADHDDYSAIMLKALADRLAEAFAEAMHARVRRELWGYAATEQLDNDALIAE
FT                   QYAGIRPAPGYPACPDHLVKRAMFEALHTDEIGMSVTDSLAMLPAASVSGFYLAHPDST
FT                   YFSVGKIGQDQLEDFARRTALSKADAERALAPLL"
FT   gene            complement(298174..299253)
FT                   /locus_tag="GBP346_A0341"
FT   CDS_pept        complement(298174..299253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0341"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF02574"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97235"
FT                   /db_xref="GOA:C4KNR9"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNR9"
FT                   /protein_id="ACQ97235.1"
FT                   /translation="MSEPTPIAPFASSAAPAAPYTRGAALPQLLRQRILILDGAMGTMI
FT                   QRYKLDEAAYRGERFKDFPRDVKGNNELLSITQPRIIREIHDQYFAAGADIVETNTFGA
FT                   TAVAQADYGMEALVVEMNVASAALARESAAKYATPEKPRFVAGAIGPTPKTASISPDVN
FT                   DPGARNVTFDELRDAYYQQAKALLDGGVDLFLVETIFDTLNAKAALFALDQLFDDTGER
FT                   LPIMISGTVTDASGRILSGQTVEAFWNSLRHAKPLTFGLNCALGAALMRPYIAELAKLC
FT                   DTYVSCYPNAGLPNPMSDTGFDETPDVTSGLLKEFAQAGLVNLAGGCCGTTPEHIAAIA
FT                   KALAEVKPRRWPSQYSEAA"
FT   gene            complement(299441..299698)
FT                   /locus_tag="GBP346_A0342"
FT   CDS_pept        complement(299441..299698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95842"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNS0"
FT                   /protein_id="ACQ95842.1"
FT                   /translation="MQMIYNSPNYCVVEFPPQDGHHAMNSGGYEIVDKNAQREIFIDGE
FT                   LAARFREHVKQLIQAEPTLDEVDEFLGQFDSLMTQPVVLH"
FT   gene            complement(299881..301188)
FT                   /locus_tag="GBP346_A0343"
FT   CDS_pept        complement(299881..301188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97369"
FT                   /db_xref="GOA:C4KNS1"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNS1"
FT                   /protein_id="ACQ97369.1"
FT                   /translation="MPLSSIVSSNPRGAPRRVRRAACVLALVLALHWLAALWLVRFREP
FT                   FRPVEPDHVPVQVELLKPQPIERAPAPEKPAADRPRAAPKRAARASAPPAHAPRASAPV
FT                   SSAAESSAESPAAASGTEPASAAGGQAAGATSGAAAGASGASAPPGEAAQGMKFALPPS
FT                   ADLQYDTFYNGMQNMPGTIHWRTDGGGYSLYVSMPVPFVGPYTYESRGRVDAFGVAPAR
FT                   YVETRGRRPPDFAIFNRQTKQIVFTGTPNSLALPDGAQDRFSMLMQLAGLVGGDPDAYR
FT                   PGVTREFFVVDRDSGETWPITTIGDETISTGMGSLDARHFMRLPRRAGDTRRIDIWLAP
FT                   SLGWLPVRMVQTEPNGAQIELLLHRRTNANGDADVHSDTSANTDAGANADGGAAPAAAP
FT                   ASAPGAPLNANEPVNSTEKADGSPRPPPADPGEPQP"
FT   gene            complement(301267..302220)
FT                   /locus_tag="GBP346_A0344"
FT   CDS_pept        complement(301267..302220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0344"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99184"
FT                   /db_xref="GOA:C4KNS2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNS2"
FT                   /protein_id="ACQ99184.1"
FT                   /translation="MTMEGIYFTMVNPHGGPRREPPPPHSSRHAVNKSASPSSDAPDDD
FT                   LADDHDTGEEKVRSGIQSIEVGFRLLDVLTGEPRAMMLRDLAQRAAMSPAKAHRYLVSF
FT                   QRLGLVSQDPVSGRYELGGFALQMGLARLARVDGVKLARIALTALRDQLDQTVGIAVWG
FT                   NQGPTIVHWMESSHPAKASLKLGDVMPLLGSATGLVFAAYLPRGKTAAMIERELADTRR
FT                   AAHYTGPRTRAEVDAVLADVRAHRAARVEGMLLPTINAFGMPVFDAVGELALAIIALGH
FT                   EGAFDIRWGGEVDTALRTCAQKLSYELGYSEGARDA"
FT   gene            302240..303232
FT                   /locus_tag="GBP346_A0345"
FT   CDS_pept        302240..303232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0345"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96617"
FT                   /db_xref="GOA:C4KNS3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNS3"
FT                   /protein_id="ACQ96617.1"
FT                   /translation="MKLASLKDGTRDGQLIVVSRDLHTAAIADAIAPTLQRVLDDWAFY
FT                   APQLRDLYDALNHGRARNAFAFEPADCMAPLPRAFQWADGSAYVNHVELVRRARGAEMP
FT                   PEFWTDPLMYQGGSDDFLGPRDDIVCASEAWGIDFEAEVAVITADVPMGAAPDEALKAV
FT                   RLVTLVNDVSLRNLIPAELAKGFGFFQSKPASAFAPVAVTPDELGEHWREGRLHRPMLV
FT                   HWNGKKVGQPDAGVDMVFHFGQLIAHAAKTRNVRAGSIVGSGTVSNKDAKRGYCCIAEK
FT                   RCLETIEHGAPQTEFMCYGDRVKIEMVDEAGKSIFGAIEQAVAPVDAAA"
FT   gene            303229..303360
FT                   /locus_tag="GBP346_A0346"
FT   CDS_pept        303229..303360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96135"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNS4"
FT                   /protein_id="ACQ96135.1"
FT                   /translation="MTRPCERAATRRPCGRARKRAAPPGPDCPPRRRAARRAPGFAG"
FT   gene            303440..304267
FT                   /locus_tag="GBP346_A0347"
FT   CDS_pept        303440..304267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0347"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96814"
FT                   /db_xref="GOA:C4KNS5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNS5"
FT                   /protein_id="ACQ96814.1"
FT                   /translation="MTDLALYAGYEALRIQRRPHGIVEIVMSGEGANRSGLAVASEAMH
FT                   RELADIWRDVDRDPDARVAVIRGEGKGFSAGGDLALVERMADDHAVRERVWREARDLVY
FT                   NVINCSKPIVSAMHGPAVGAGLVAGLLADVSIAAKHARIIDGHTRLGVAAGDHAAIVWP
FT                   LLCGMAKAKYHLLLCEPVSGEEAERIGLVSLALDDHELLPKAYEIAERLAQGSQSAIRW
FT                   TKYALNNWLRLAGPTFDASLALEFMGFSGPDVREGIRSLRERRAPDFTGGAPS"
FT   gene            304357..305148
FT                   /locus_tag="GBP346_A0348"
FT   CDS_pept        304357..305148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96158"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNS6"
FT                   /protein_id="ACQ96158.1"
FT                   /translation="MTDPNGSNPFSGFGGFQPAGFLDKMWDMMRLTPFGAMSALPGASQ
FT                   GLPPSLSAMSDLMAPLASVEELDKRITDLRAVEQWLKLNLGMLQSAIQALEVQRATLAT
FT                   LRAFGALAQTSMAAAEAALSPDDSAPREPASAAASASAAKREANAGEPADAQGARDADG
FT                   ETPPPGADAFDPAGWWNLLQSQFNQLARFAMTQPGMVAAGDASAAGAAAGPKPSAAKKP
FT                   ATRRAAAPRTGGSAADRAPGASSAGGDAKPAAAKKPARRGA"
FT   gene            305185..306429
FT                   /locus_tag="GBP346_A0349"
FT   CDS_pept        305185..306429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0349"
FT                   /product="phospholipase, patatin family"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95844"
FT                   /db_xref="GOA:C4KNS7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNS7"
FT                   /protein_id="ACQ95844.1"
FT                   /translation="MRLALVLMGGGARAAYQAGVLKGLAEIAHDVDPKRRTSPFSVICG
FT                   SSAGAINATSLASHADDFEHGVRRLLEFWEQLRAERVYRTDWLGIAAAGARWLAAMSIG
FT                   WAARRSPRGLLDNAPLAYLLRRELDFHRIELMLEARKLHALSVTALSYSSGRHLTFYQA
FT                   SEPIQAWRRAERTARMVDLSAEHLLASSAIPFVFPAVPLVLDGQIEYFGDGSIRQIAPL
FT                   SPAIHFGSDRIVVVGAADPRPEVPAANGNGRGYPSLAQIGQQVLASVFLDSIGADIERI
FT                   DHVNRMIEHLPAYVEPESGWRHVDVLAIAPSERIELIASKHLKRLPLTVRGLLGAVGGN
FT                   KPAGASFASYLLFEAEFTRELVELGYRDAHGQRERLAQWIASAERRGGPAERGPGAGTD
FT                   ARTGAGAHAARRTTT"
FT   gene            306496..306678
FT                   /locus_tag="GBP346_A0350"
FT   CDS_pept        306496..306678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95237"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNS8"
FT                   /protein_id="ACQ95237.1"
FT                   /translation="MAWQGKARQGKARQGKARQGKARQGGTGRDGTGRREATRDDALSA
FT                   RPAAAFAVSVAFSPR"
FT   gene            complement(306785..306928)
FT                   /locus_tag="GBP346_A0351"
FT   CDS_pept        complement(306785..306928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99137"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNS9"
FT                   /protein_id="ACQ99137.1"
FT                   /translation="MGQAALGAPGVRKPRRACLKGAGAPPASLQGPARACRRGRPRASG
FT                   PM"
FT   gene            307096..307962
FT                   /locus_tag="GBP346_A0352"
FT   CDS_pept        307096..307962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96304"
FT                   /db_xref="GOA:C4KNT0"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNT0"
FT                   /protein_id="ACQ96304.1"
FT                   /translation="MLYPELYKSLEAVRWDMEKDIPWDKFDASLLTDEQAKTIKMNAIT
FT                   EWSALPATEMFLRDNHHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFKPELMPTEEELHA
FT                   VRFEFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHTEPVIKHIYETISRDEARHGGAYL
FT                   RYMKKALNNCGDVARAAFSKIGVLMASARRTEKPLHPTNLHVNQALFPRDTVQSRLPDP
FT                   EWLERWLDEQIRFDGEWEKKVVERILHNLSVLFERTFATAQELNRYRKEVTARLQSESG
FT                   PAAAQPA"
FT   gene            308103..308588
FT                   /gene="rfaE_1"
FT                   /locus_tag="GBP346_A0353"
FT   CDS_pept        308103..308588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE_1"
FT                   /locus_tag="GBP346_A0353"
FT                   /product="bifunctional protein RfaE, domain II"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99056"
FT                   /db_xref="GOA:C4KNT1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNT1"
FT                   /protein_id="ACQ99056.1"
FT                   /translation="MPASFERKLITRDALAAMRASLPAPVVFTNGVFDILHRGHVSYLA
FT                   DAKALGACLIVGVNSDASVRMLGKGDDRPINVQEDRMALLAALECVDWVVGFDEKTPVS
FT                   LIEAVHPDILVKGGDYDMDALPESALVRGWGGRALAIPFEHDRSTTALLKKVRAQSR"
FT   gene            complement(308634..309044)
FT                   /locus_tag="GBP346_A0354"
FT   CDS_pept        complement(308634..309044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98419"
FT                   /db_xref="GOA:C4KNT2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNT2"
FT                   /protein_id="ACQ98419.1"
FT                   /translation="MTMLRWLISILFLANMLAFVVVRGVFGPLPAAGPREPGHALLQVR
FT                   PDALRVTPVSQAADQPIVGGPIVPPALETAPLNAPGAAPAAASDSAPGSPAASAPASMP
FT                   ASVAAPAAPAPSSPPAAQPARAPILPGASAAR"
FT   gene            complement(309148..309918)
FT                   /locus_tag="GBP346_A0355"
FT   CDS_pept        complement(309148..309918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0355"
FT                   /product="type III pantothenate kinase (Pantothenic acid
FT                   kinase)(PanK-III)"
FT                   /EC_number="2.7.1.33"
FT                   /note="identified by match to protein family HMM PF03309;
FT                   match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98084"
FT                   /db_xref="GOA:C4KNT3"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNT3"
FT                   /protein_id="ACQ98084.1"
FT                   /translation="MCLLIDAGNSRIKWALADTARHFVTSGAFEHASDAPDWSTLPAPC
FT                   GAWISNVAGDAAAARIDALIEARWPALPRTVVRASAAQCGVTNGYAEPARLGSDRWAGL
FT                   IGAHAAFADEHLLIATFGTATTLEALRADGHFAGGLIAPGWALMMRSLGMHTAQLPTVS
FT                   IDAATNLLDELAENDAHAPFAIDTPHALSAGCLQAQAGLIERAWRDLEKAWQAPVRLVL
FT                   SGGAADAIVRALTVPHTRHDTLVLTGLALIAHSA"
FT   gene            complement(309924..311003)
FT                   /locus_tag="GBP346_A0356"
FT   CDS_pept        complement(309924..311003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0356"
FT                   /product="biotin-(acetyl-CoA-carboxylase) ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="identified by match to protein family HMM PF02237;
FT                   match to protein family HMM PF03099; match to protein
FT                   family HMM TIGR00121"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97520"
FT                   /db_xref="GOA:C4KNT4"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNT4"
FT                   /protein_id="ACQ97520.1"
FT                   /translation="MGASPTEPRKAAIRPPVKRRARRTLRWQPSISSATIRAMNVATPP
FT                   SMPATGGPLIDRARVDAHLAPAAREWSIEIVDTTGSTNADLGARLKALPRRRDALAAPI
FT                   ARVAYEQTAGRGRQGRPWFAKPGDALLCSVACVLPRPVGALAGLSLAVGAALAEAFAAL
FT                   PAATGDAPRGGADGARRIALKWPNDLLVATERDGETAIVGKLAGVLIETVWNTIDATAV
FT                   VIGFGVNVRTADAAAAAAEVDALRARDATLAGGLPPVALAAVRAGATLTDTFAAALNAL
FT                   AVALPAFAADGLAPFAARWHALHAYAGREVVLLERGAELARGVAVGIDETGQLLLDTPA
FT                   GRQAIAAGDVSLRTPGAAR"
FT   gene            complement(311275..312162)
FT                   /locus_tag="GBP346_A0357"
FT   CDS_pept        complement(311275..312162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0357"
FT                   /product="Sel1 repeat family protein"
FT                   /note="identified by match to protein family HMM PF08238"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98112"
FT                   /db_xref="GOA:C4KNT5"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNT5"
FT                   /protein_id="ACQ98112.1"
FT                   /translation="MMNAIKKLLPTHAAPPPDGARRPTPRRRLLHARLSPVGMLAVAAA
FT                   LAAGVAVTERIERPASGAPAVSRAQLDEWRAMVEQASEPNALGRLRALAQRGSADAQAA
FT                   LGLALAGSRDLALRDEGRRWLETAAHATPPENAPTSAGERDARLALGKAWLLGAGGAAR
FT                   DYPRALAMLRPLAAAGDPNAAYYVGLVYRSGYGTPADATEAARWFELAARHDIPAAQFM
FT                   LANAYRDGSGVRRDEARALALYRQAADHELPEAVQALAIAYRNGELGLPRDADAFHAQW
FT                   IEAAHALKHPALAP"
FT   gene            complement(312236..314296)
FT                   /locus_tag="GBP346_A0358"
FT   CDS_pept        complement(312236..314296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0358"
FT                   /product="putative 2',3'-cyclic-nucleotide
FT                   2'-phosphodiesterase"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97539"
FT                   /db_xref="GOA:C4KNT6"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNT6"
FT                   /protein_id="ACQ97539.1"
FT                   /translation="MPFPLRFRRRRLAAALVACAALVAGCNDDVDSPGAQSGASAPAGT
FT                   KATLAVLETTDLHTNVLSYDYFKLAADKSLGFERVATLIAQARAQYPNTLLLDNGDTIQ
FT                   GTALADYQALVKPVSCGETLAIYKVMNAAKFDGGGIGNHEFNYGLPYLSQVTGNAFAVD
FT                   GLPDPARQKKCAGPNFPQVLANVISAKTNAPLFTPYTILTKNVTATTPDGRTVTAPVKV
FT                   GIIGFTPPAIMSWDKRWLDGKVYTTGLKEAAEKYIPEMRAKGADLVVAISHGGLDNSPY
FT                   SPTMENGSWWLSTVPGIDAMLIGHSHQVFPDATSTVAQFNLPGVDKVKGTVNGVPTVMA
FT                   NYWGKHLGVIKLGLAFDGKTWRVDKSQTTVEARSIQNPDKSYVDADPSVAAAIAAEHQA
FT                   TIDYVKTPIGSTDYRMTSYFADVGDPGAIQLVNEAQADYVANYVQTNLPQYASLPVLSV
FT                   SAPFKSGFGGGTDFTDVAAGALAINNAADLYLYPNTVYAVKVSGADIKNWLETAAKRFN
FT                   TIDPTKATVQKLVSTFPGYNFDMFTSADLRYEIDVTQPVGSRIRNLAYKGAPIDPNAQF
FT                   IVATNNYRASGGGNFPGLDGSKTIFASPDANRDVLIAYIKKRGRITRAADGMQRSWRFT
FT                   KLAGSVAHVQFASAPNLAALASTAGLAGITQVAADDGSGEGLATYEIDLTQ"
FT   gene            314562..315686
FT                   /locus_tag="GBP346_A0359"
FT   CDS_pept        314562..315686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0359"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02405;
FT                   match to protein family HMM TIGR00056"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96717"
FT                   /db_xref="GOA:C4KNT7"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNT7"
FT                   /protein_id="ACQ96717.1"
FT                   /translation="MNFQTPPGLSIDAGSQGRTVRLCGQWTALALARDRGNVARRIARL
FT                   AKEAVGEWDLSGVERLDHVGGQALWRVWGRRLPDGIALTDNQRVVFERIERLDAGRESP
FT                   EPVVRIDPVTRFGQGLFTFGEHLYGGIALLGGLIVDLLAVLRRPRTMPWTEISANVYAA
FT                   GTKALPITALVAFLIGIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAG
FT                   RSGSAITAQIGVMRVTEELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTG
FT                   GALAAKFVLGIDLNFFVRSLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQ
FT                   SLGEGTTTSVVTSITVVILADAVFAILFQNVGLG"
FT   gene            315683..316525
FT                   /locus_tag="GBP346_A0360"
FT   CDS_pept        315683..316525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0360"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96258"
FT                   /db_xref="GOA:C4KNT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNT8"
FT                   /protein_id="ACQ96258.1"
FT                   /translation="MSARDDDFVIEVRDLTKRYGRNVVHEHLDFDVRAGEIVSIVGGSG
FT                   SGKTTLVRQILGLERPSSGTIRVFGEDTSKIDADTARVMRSRSGMLFQHGALFSSLTVF
FT                   DNVAQPLRELGRVPDDLLHDIVMLKLEMVGLPCKHASKMPAALSGGMVKRVGIARAIAL
FT                   EPELLFLDEPTAGLDPGASDEFVELIATLHRTLGLTVVMVTHDLDTMVALSTRVAVIAE
FT                   RKVLVAASVEEAAGVDHPFIREYFLGRRGRRALQALPPERRARLPKAALEPAPSDIEL"
FT   gene            316549..317478
FT                   /locus_tag="GBP346_A0361"
FT   CDS_pept        316549..317478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0361"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02470"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95761"
FT                   /db_xref="GOA:C4KNT9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNT9"
FT                   /protein_id="ACQ95761.1"
FT                   /translation="MENKSHAFWAGLFTIALLGAIVGAVYWFNVDRTVRVPYDLVSRSN
FT                   VTGLFPDAAVRYRGLDVGKVQSINFDRGHPGQIVIRILVDTNAPITRSTFGSLGFQGVT
FT                   GIAFVQLDDTGADLAPLPTSAKAVAQIPMRPSLFDQLQQRGDVLLKQMEIAAKSVNEML
FT                   SPEMRDQLKATAASMQHAADGVTQLSRQVEPALARMPQTMEHVNRALSSANALVAPGGP
FT                   LVANLNRAGQALASMNDTLAELSARVRYDTLPRFNALATNVGDASRTLKDVAGDVGRNP
FT                   RSLLFGSPAAAPGPGETGFVWPSATPAQ"
FT   gene            317497..318135
FT                   /locus_tag="GBP346_A0362"
FT   CDS_pept        317497..318135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95282"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNU0"
FT                   /protein_id="ACQ95282.1"
FT                   /translation="MHAHFMSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYD
FT                   LGPAQPAASSGTGPALKVLDVSAPDALNTDRFVYRLAYSDAQRIAAYRDSKWTAPPAQL
FT                   LTQRLRGALSGRGAVLAADDGVRAPVLKVELSEFEQVFDGRSESHAAVTARATLTQEGK
FT                   VLGQRTFVSRAPASTPDAAGGAQALATASDALVSQLVAWLGVQAYAAAQ"
FT   gene            318167..319378
FT                   /locus_tag="GBP346_A0363"
FT   CDS_pept        318167..319378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0363"
FT                   /product="VanZ like protein"
FT                   /note="identified by match to protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97084"
FT                   /db_xref="GOA:C4KNU1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNU1"
FT                   /protein_id="ACQ97084.1"
FT                   /translation="MRGAAEMTPAARRQRRHSTLARQAFAVYAALVVYASLYPFTGWRS
FT                   LGIGPFDFLLAPLPRYLTAFDVVSNVLGYLPFGALAVLALYPLRGVPAALAATLLGALL
FT                   SGAMEALQTYLPTRVSSNLDLAANALGALVGAAAAAPAATALIERGVVRRVRFAWFERE
FT                   ASTPLFLSALWAGAILFPSPFLFGIGDWPSELWERADVTMRGALLAWAPDAWNVPAWPE
FT                   RLDGLLSDSAWETLLAALGLFAALAVASLAMRERAPRVRLVVGFAACALALKAAATFMQ
FT                   SYTGLVLDWATPGALRGIAAGLVAALVALRLPAAWRAALAAAALAAALALVNVLPVNPF
FT                   FDFALSGWQQGRYVHFNSIARWLAWIWPYAALVWLAGRAERAWLARRGAGASRRASGKR
FT                   RRSL"
FT   gene            319484..319813
FT                   /locus_tag="GBP346_A0364"
FT   CDS_pept        319484..319813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0364"
FT                   /product="ferredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97670"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNU2"
FT                   /protein_id="ACQ97670.1"
FT                   /translation="MGHIMDSYYRHHVFFCLNQREKGAERPSCANCGSQEMQEYAKKRV
FT                   KELGLAGAGKVRVNKAGCLDRCEEGPVVVVYPEGTWYTYVDKNDIDEIVESHLRDGQVV
FT                   ERLRI"
FT   gene            319860..320504
FT                   /locus_tag="GBP346_A0365"
FT   CDS_pept        319860..320504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0365"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95868"
FT                   /db_xref="GOA:C4KNU3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNU3"
FT                   /protein_id="ACQ95868.1"
FT                   /translation="MNAHTQKSLIAGPVGHIEIAIDLPDAVREGSAAPRGIALVAHPHP
FT                   LFGGTMDNKVAQTLARIFVQLNYAVIRSNFRGVGATEGEHDNGAGEVDDLLAVLAHMRA
FT                   LPGHADLPLVLAGFSFGTFVLSHVGKRLRDAGQAIERMVFVGTAASRWQVAAVPEDTIV
FT                   IHGENDDTVPIASVYDWARPQELPVIVIPGAEHFLHRKLHILKRIVVGAWR"
FT   gene            321280..322593
FT                   /locus_tag="GBP346_A0366"
FT   CDS_pept        321280..322593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0366"
FT                   /product="D-alanyl-D-alanine carboxypeptidase DacC"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF00768;
FT                   match to protein family HMM PF07943"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96495"
FT                   /db_xref="GOA:C4KNU4"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNU4"
FT                   /protein_id="ACQ96495.1"
FT                   /translation="MRLSSLGLTSLASSTAIAVAARNVALGIVLPAALVSTIAVAQAKP
FT                   AAKAKHAAAPAAAAAPTGAPATYVPGAVPPPGVNARSWVLVDASSNQVLASGNADERVE
FT                   PASLTKLMTAYLVFEALDAKKITMEQIVTPSEAVRRVGRDESRMFIEANKPVSVHDLVY
FT                   GMIIQSGNDAAIALAELVGGSEAQFVNMMNAEAQRLGMKSTHFADVNGMPDPNHYTTAG
FT                   DLAKLSTHLIRDYPDYYNIFSVKEFTYNNIKQPNRNRLLWLDPTVDGLKTGHTQAAGYC
FT                   LIASAKRALPGAADATRRLVTVMMGETKESDRVQDSMKMLNYGYTAFDSVRLYKASQPI
FT                   DTPRVYKGKSNNVQVGVKKDQFITVPRGLADKVKPEVALNAPLIAPLADGQVVGSVKLV
FT                   ADGKTVAEFPVVALQPVPEAGLLGRIWDSILLMFSKKK"
FT   gene            322683..323630
FT                   /locus_tag="GBP346_A0367"
FT   CDS_pept        322683..323630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0367"
FT                   /product="D-amino-acid transaminase"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95222"
FT                   /db_xref="GOA:C4KNU5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNU5"
FT                   /protein_id="ACQ95222.1"
FT                   /translation="MNQADIEPIVYLSVASHEELVPLSEARVPVLDRGFIFGDGVYEVV
FT                   PVYADGARRAPFRIAQHLARLARSLKRIGIADPHDEAGWRALVAQVVDANAAALGDGRH
FT                   AIVYIQVTRGVAKRGHAFPANAVPTVFAMASPLALPSDAQRAQGVRCVTAEDRRWLHCD
FT                   IKSVSLLGNVLMAQHAAEHDAIETIQLRDGNVTEGSSSNVWIVKNGELIAPPRSNRILE
FT                   GIRYALVEELAEECGIRFVAREINEAELRAADEILLTSATKEVLPVTRLDDLPVQGGRP
FT                   GPVFDALYAAYQRAKAREMEASERAVPPTRGETT"
FT   gene            323627..323935
FT                   /locus_tag="GBP346_A0368"
FT   CDS_pept        323627..323935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04359"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95809"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNU6"
FT                   /protein_id="ACQ95809.1"
FT                   /translation="MTEPNKTVELTGEIATPKETLLEFPCDFPIKVMGRAHPEFKDTIF
FT                   KVVSVHDNEIDLEKIEERASSGGNYTGLTITVRATSQAQLDNIYRALTGHPMVKVVL"
FT   gene            complement(323946..324911)
FT                   /locus_tag="GBP346_A0369"
FT   CDS_pept        complement(323946..324911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0369"
FT                   /product="glycine cleavage system transcriptional
FT                   activator"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98253"
FT                   /db_xref="GOA:C4KNU7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNU7"
FT                   /protein_id="ACQ98253.1"
FT                   /translation="MNIHRLPMLNALRVFEAAARHESFSRAADELSVTHGAVSHQMRAL
FT                   EAELGVPLFVRHGKRLALTDAGGRYAQQVRAALALLADATREVRASERDKRLVVSTLPS
FT                   FAARWITPRIGPFIERHPEIDLELRASDSLVDFARDDVDVAIRFGHGVYPGLHVEPLLD
FT                   ETFFPVCAPTLNGGMLPETPADLVRYPLLRSDDELWRPWFDAAGLDTLTEPKRGVLYQD
FT                   SSNLLQAAIDGQGIALVRRSLAVPEVAAGRIVRLFDIAGPSPWHYFFVCPPSLAQTPRV
FT                   QALRSWLLDEIARFRALCAAQETQHAAAYAAARARGKEEN"
FT   gene            325012..325338
FT                   /locus_tag="GBP346_A0370"
FT   CDS_pept        325012..325338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98798"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNU8"
FT                   /protein_id="ACQ98798.1"
FT                   /translation="MKEISSSITFEIPPGETVPMKVARSTRLAVRGAPVWATRSNDVHD
FT                   YFLSPGATLKLRRGERLWLSADGATSACVSFSAIAPPQQAALRGVARFASWLSAHWRDG
FT                   WRTV"
FT   gene            325431..326171
FT                   /gene="lipB"
FT                   /locus_tag="GBP346_A0371"
FT   CDS_pept        325431..326171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="GBP346_A0371"
FT                   /product="lipoyl(octanoyl) transferase"
FT                   /EC_number="2.3.1.181"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00214"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97590"
FT                   /db_xref="GOA:C4KNU9"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNU9"
FT                   /protein_id="ACQ97590.1"
FT                   /translation="MPSAPDAPDAAASVAPNPPAALPVTVRWLGETPYDACFDAMRAFT
FT                   DARTPDTDDEIWVVEHPPVYTLGQAGNPAHLLVADSGVPLVKVDRGGQITYHGPGQIVA
FT                   YLLVDLRRRKLMVRTLVTRIEEAVIETLAAYNLASARKAGAPGIYVESGPHRGAKIAAL
FT                   GLKIRNGCSYHGLSVNVKMDLRPFLAINPCGYAGLETIDMASLGATADWHEVAQTLVRR
FT                   LIAHLDGATAAAALPQQALEQSND"
FT   gene            326164..327153
FT                   /gene="lipA"
FT                   /locus_tag="GBP346_A0372"
FT   CDS_pept        326164..327153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="GBP346_A0372"
FT                   /product="lipoyl synthase"
FT                   /EC_number="2.8.1.8"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95776"
FT                   /db_xref="GOA:C4KNV0"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNV0"
FT                   /protein_id="ACQ95776.1"
FT                   /translation="MTDLTATPAPAEPAASAYDPTAKQKAQAKTARIPIKIVPIEKLKK
FT                   PEWIRVKAATGSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTR
FT                   RCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIRE
FT                   VREQSPATRIEILTPDFRGRLDRALAILNAAPPDVMNHNLETVPRLYKEARPGSDYAHS
FT                   LKLLKDFKALHPDVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHL
FT                   PVREYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV"
FT   gene            327189..327386
FT                   /locus_tag="GBP346_A0374"
FT   CDS_pept        327189..327386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96246"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNV1"
FT                   /protein_id="ACQ96246.1"
FT                   /translation="MRKPQPSLRFFYARGARRDARPLRGSLRADRARRVRTGEHPSGRG
FT                   SCARGYTVTAIAPNCSFDSG"
FT   gene            complement(327338..327610)
FT                   /locus_tag="GBP346_A0373"
FT   CDS_pept        complement(327338..327610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0373"
FT                   /product="NADPH:quinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96334"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNV2"
FT                   /protein_id="ACQ96334.1"
FT                   /translation="MIEYGALAAEQAPFPLFAVLGKRLSVHGYQYKRVGGDPAKLDAAT
FT                   RFVLDGLASGALKPTLDRVFPLDRIAHAHRYPESNEQFGAIAVTV"
FT   gene            complement(327738..329621)
FT                   /gene="ggt_1"
FT                   /locus_tag="GBP346_A0375"
FT   CDS_pept        complement(327738..329621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt_1"
FT                   /locus_tag="GBP346_A0375"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="identified by match to protein family HMM PF01019;
FT                   match to protein family HMM TIGR00066"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95416"
FT                   /db_xref="GOA:C4KNV3"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNV3"
FT                   /protein_id="ACQ95416.1"
FT                   /translation="MTDRIRPRPFRSRAGAIAAAFFAVAAAGCANAPGPGAQNAAAPAS
FT                   AASTPPAAPGAEAPAAPAELSSWVDKPGWTAQRDMIAAAHPLAAQAGQAMLKAGGTAVD
FT                   AAIAAQMVLMLVEPQASGIGGGAFLLHANGKTIEAYDGRETAPAAATDRLFLDANGKPL
FT                   PRAALGARTVGAPGALRMLELAHRAHGKLPWRRLFQPAIRLAEQGFPLGPRLAAALANE
FT                   PSLARDPAARAYFYDRNGAPKPAGTTLKNPQLAATLRLVAAHGANAFYTGAIARDIVAT
FT                   VRQAPNPGVLSMQDLAQYRAKTREPLCADYRKWTVCGMPPPSAGGLVVAQILGLLETQP
FT                   DWRQIGAQKPVRNAVGVEPTPFAAHLFSEAGRLAYADRAQYVADPDFVAPPGGSWKRLV
FT                   ERRYVAERARLIGDASAGEASAGSPSGLPPATAADRGAEPPSGSQITVVDRYGNAVSMA
FT                   STLDERFGSRLMVRGFLLNSQLLDFSPASAEHGKPVANRVQPGKRARSTLAPELVFEKG
FT                   SSRLMMALGSAGGASTANDVAKTLVGMIDWGMTMQQAIALPNFGSRNGPTELEQGRVSD
FT                   ALAGALKARGHDVRVVELGSSLQGIQRINVEGQSVWFGGSDPRRDGIVAGD"
FT   gene            329943..330218
FT                   /locus_tag="GBP346_A0376"
FT   CDS_pept        329943..330218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95858"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNV4"
FT                   /protein_id="ACQ95858.1"
FT                   /translation="MTPGRRGIRRARAPVRPCRRIRANRGGVEGARRLRSTRAGGECPS
FT                   AVPGEVVKPDAGRYHRRSVIATWRDVARWASARHGGGGGDIDIDGR"
FT   gene            330404..330745
FT                   /locus_tag="GBP346_A0377"
FT   CDS_pept        330404..330745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98185"
FT                   /db_xref="GOA:C4KNV5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNV5"
FT                   /protein_id="ACQ98185.1"
FT                   /translation="MQEPPDEQSRRALVRAYGFALAAILVIALFPVLSVAAAGIVADAA
FT                   GCELNEAAAHPCLIGGVDFGEMLYAMGVLGWLMLGSLPVGGVLLMGWAIALLVHLRQWR
FT                   AMRRAGARR"
FT   gene            complement(330870..331772)
FT                   /locus_tag="GBP346_A0378"
FT   CDS_pept        complement(330870..331772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0378"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99186"
FT                   /db_xref="GOA:C4KNV6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNV6"
FT                   /protein_id="ACQ99186.1"
FT                   /translation="MDLNALTLLVDILDAGNLSKAAQRLKMSRANVSYRLNQLEKSIGL
FT                   QLVRRTTRRIEPTEIGLRLYEHGRRIQSELFAAREAVTTLGQDLQGRVRLSVPSGYGQL
FT                   VMSNWLIAFKRLYPGIVLDVVFENRIEDLMRDEVDIAVRVMSEPPQNLVARDMGAVRYV
FT                   ACASPGFAATHGMPTELGQLFDAPVITSTVVGRQLRVAAYLGDERHEVLLEPTLISENF
FT                   LFLRQAILAGLGVGIVPDYVVHDDVRRGAAVTTLDAYRLSIFGTHMYMLYMPNRHHTRA
FT                   TSTFIDFMLEEARNAGRGG"
FT   gene            331927..334053
FT                   /locus_tag="GBP346_A0379"
FT   CDS_pept        331927..334053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0379"
FT                   /product="peroxisomal bifunctional enzyme"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="5.3.3.8"
FT                   /EC_number="1.1.1.35"
FT                   /note="identified by match to protein family HMM PF00378;
FT                   match to protein family HMM PF00725; match to protein
FT                   family HMM PF02737; match to protein family HMM PF03446"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97118"
FT                   /db_xref="GOA:C4KNV7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNV7"
FT                   /protein_id="ACQ97118.1"
FT                   /translation="MNQQASPATGTVTRERRDKVLVVTIDHPPVNALSADVRRGLVDAL
FT                   DAADADAAVGAVLIVGAGRNFIAGADIREFGKPPVPPLLPDVCNRIETSGKPVVVALHG
FT                   AALGGGLEVALAAHYRLAVPGAKLGLPEVQLGLLPGAGGTQRTPRLIGAKAALELMLSG
FT                   RHASAEEALALGLVDRLAHSDDTLAEGLAYVHELLAAGAGVRRTRDAQGLADRAAAEAA
FT                   LDAARADVARHSRGLFSPARIVDAVAAALAQPFDEGLRTERRLFVECLDSPQRAGLVHA
FT                   FFAQREAAKSPETRRGAPRAIERIGVVGGGTMGAGIAVAALDAGFPVTMIERDDASLER
FT                   GRAHVEKVYAGLVAKGRMTPAAQAARLARFKGGTSYEALAQADVVIEAVFEDMAVKKAV
FT                   FAELARACKPGAVLATNTSYLDIDELAASVERAPDVIGLHFFSPANIMKLLEVVVPAKV
FT                   SADVVATAFELARKLGKIPVRAGVCDGFIGNRVLAVYRTAADYMMEDGASPYQIDRAIR
FT                   EFGFPMGPYQVVDLAGGDIGWATRKRRAPTRDPRLRYVEIGDRLCERGWFGQKTGRGYY
FT                   LYPDGARVGTPDPEVEAIIAQARAAKGVSPRAFTDEEIVRRYLAAMINEGANVVHEKIA
FT                   LRPLDVDAVFLHGYGFPRHRGGPMHYADTVGLANVLADIRAFAGEDPVFWKPSPLLVDL
FT                   VARGETFASLNRID"
FT   gene            334108..335316
FT                   /locus_tag="GBP346_A0380"
FT   CDS_pept        334108..335316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0380"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97728"
FT                   /db_xref="GOA:C4KNV8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNV8"
FT                   /protein_id="ACQ97728.1"
FT                   /translation="MDLNFTAEEEAFRAQVQRFLADELPPRISRKVKGGLRLTRDDMRE
FT                   WHAILNARGWLASHWPREWGGPGWSLAQKFLFDNECAIAGAPRIVPFGVNMLGPVLIKY
FT                   GSPAQKRHWLPRILDGTDWWCQGYSEPGAGSDLAAVSTSAVRGVDARGDHYIVNGQKTW
FT                   TTLGHYANMIFCLVRTATDVRKQEGISFLLVDMNSPGVEVRPIVTLDGEHEVNEVFFTD
FT                   VRVPAENRVGEENQGWTYAKYLLTYERTNIAGVGFSVAALDKLRAVAAKVTKNGRPLAD
FT                   DPLFAARLARVAIELDNMKTTNLRVLAAVAGGGAPGAESSMLKIRGTQIRQEISSLMRR
FT                   AMGPYAQPFVDAALDADDGEPPGGLPEAASAAAQYFNNRKLSIFGGSNEIQKNIISKMM
FT                   LGL"
FT   gene            335326..336456
FT                   /locus_tag="GBP346_A0381"
FT   CDS_pept        335326..336456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0381"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95714"
FT                   /db_xref="GOA:C4KNV9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNV9"
FT                   /protein_id="ACQ95714.1"
FT                   /translation="MDFRHTEDRRMLADSLNRFIAEQYAFPVRDRIALSPAGYSDDMWR
FT                   RFAELGAIGALFPQECGGFGGAGFDIALVFECLGRGLVVEPFVGALMAGRALAQAGGRA
FT                   HLERLAALIEGRAIGAFAHAEPDTHYEPHTVRTRAARDGEGWVLDGAKAVVDCGEHATF
FT                   FVVSARIAGGEDDAAGLSLFVVPRTAPGVTVRGYRKIDGGRAADVRLERVALADDACVG
FT                   TPGEAADAIERAIGFGLLALAAEALGAMDVAKAHTLEYLRTRRQFGVPIGSFQALQHRM
FT                   ADLLLEIEQARSAVINAAAQLDAPRVARERALSAAKYSVGRIGALVAEESIQLHGGIGM
FT                   TWELPLAHYAKRLVMIDHQLGDEDHHLARYAALSRQ"
FT   gene            336482..337687
FT                   /locus_tag="GBP346_A0382"
FT   CDS_pept        336482..337687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0382"
FT                   /product="caib/baif family protein"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98683"
FT                   /db_xref="GOA:C4KNW0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNW0"
FT                   /protein_id="ACQ98683.1"
FT                   /translation="MRNEPGARPLAGIKVLDFSRVLAGPWCAMVLADLGAEVIKIEHPR
FT                   RGDDTRDWGLRVGDTETTYFNSVNRSKRSICVDLQTQAGRRIARELAAQADVVVHNFKA
FT                   GGAEKLGLGYDALAALNPRLVHCAISGYDRSGPEAGRPGYDLVVQGEAGLMALNGEAGR
FT                   PPLKFGVAVADLFTGMYSAQAILAALYERHATGRGRRIEMALFDCGLMVTSYYGLEALL
FT                   MGEDPPRYGNAHPSIVPYGVFDAADGPIVITVGNNPQFARFCDVIGRPELAADARFATN
FT                   IARSANRAALLPEILRELGRRPRAALLAALADAGIPCGEVLGLREALTSERARSAGLVT
FT                   RQPHPVAGEVDVLAPPYRFDGERLPVRGAPPVLGADTDRVLGEWLGMSGREIAQLRSER
FT                   VV"
FT   gene            338064..338369
FT                   /locus_tag="GBP346_A0383"
FT   CDS_pept        338064..338369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04341"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96655"
FT                   /db_xref="GOA:C4KNW1"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNW1"
FT                   /protein_id="ACQ96655.1"
FT                   /translation="METSVIETVVACRDYQQLVRARRRFSFTLTALMIATYYGFILLVA
FT                   LAPHTLAAPLYAGATISVGVVAGVAIIIVAIGLTAGYVLRANRSFDRAVDALFNRS"
FT   gene            338381..340096
FT                   /locus_tag="GBP346_A0384"
FT   CDS_pept        338381..340096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0384"
FT                   /product="transporter, SSS family"
FT                   /note="identified by match to protein family HMM PF00474;
FT                   match to protein family HMM TIGR00813"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97365"
FT                   /db_xref="GOA:C4KNW2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNW2"
FT                   /protein_id="ACQ97365.1"
FT                   /translation="MLRQSTARCARLMPAALFACAALAPAAARAMGAAAAPMPEKVAPN
FT                   PVAIGMFFVFVFATLALTRWAARRTRSARDFYTAGGGITGLQNGLAIAGDYMSAASFLG
FT                   LSGMVFMFGFDGLIYSIGFLVGWPFVMFLIAEPLRNLGRFTFVDVVAYRFAQRPIRLLT
FT                   SASALTIVVLYLVVQMVGAGKLIQLLFGLSYGVAELIVGVLMVVYVFFGGMTATTWVQV
FT                   IKAVLLLAGATLLAALALGEFGFSLDEMFRRAVAVHPGALGIMGPGKLIRDPANALSLG
FT                   IALMFGTAGFPHILMRFFTVPNAKEARKSVLYATGFIGYFYLLTFVIGFSAIVLLAQHP
FT                   EFFRHDAAGAFNLTRDLVGGSNMVAVKLAQAVGGNWFYGFIAAVTFATILAVVAGLTLA
FT                   GATTISHDLYAQMWARGKPHERREMRISRAATLALSAVAIGLSILFEHVNVAFMVGLVA
FT                   AVAASANFPVLATSIFWRGMTTRGAVAGGGLGLASAVALTVLSKSVWVDVLHHAHAPVF
FT                   LDNPALVSVPLAFAGIVIGSLTDRSERARRERDAFARQEFYAQTGALATRAATH"
FT   gene            340464..341750
FT                   /gene="dctA"
FT                   /locus_tag="GBP346_A0385"
FT   CDS_pept        340464..341750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctA"
FT                   /locus_tag="GBP346_A0385"
FT                   /product="C4-dicarboxylate transport protein"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95716"
FT                   /db_xref="GOA:C4KNW3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNW3"
FT                   /protein_id="ACQ95716.1"
FT                   /translation="MKKPFYKVLYVQVIFAIVVGVILGHYYPSLAVDMKPLGDGFIKLI
FT                   KMVIGPIIFCTVVTGIAGMQDMKKVGRVGGKALLYFEIVSTCALVLGLAATHILRPGVG
FT                   FNIDPATLNGKEVASYAAKAHGQSSVDFLMHIIPNTMIDAFAQGEILQILLIALLFGSV
FT                   LAHLGERGRVVTDFIDGITRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKL
FT                   IGTFYLTSVVFVLVVLGAIARFTGFSIIRFVGYIKEELLIVLGTSSSEAALPQLMEKLE
FT                   KAGCSRSVVGLVVPTGYSFNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTS
FT                   KGASGVTGAGFITLAATLAVVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVS
FT                   AWEKELDRAKLRAALSGNGEAAAGEAARV"
FT   gene            341753..343786
FT                   /locus_tag="GBP346_A0386"
FT   CDS_pept        341753..343786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0386"
FT                   /product="C4-dicarboxylate transport sensor histidine
FT                   kinase DctB"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96460"
FT                   /db_xref="GOA:C4KNW4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNW4"
FT                   /protein_id="ACQ96460.1"
FT                   /translation="MNAETAGRAAAPAPGGAGPDATRRAWLGPAAFSGGGYATIDDPYS
FT                   PEAVTVKRRLLVVLALAAMLAAACALTWTLTWQSGIADLRDSAAARVDRTTNALKSTLD
FT                   RYESLPYLLGGHPFVQDVLADPANRRQVNRANAYLEDMNRHAHATATYVITASGLCVAA
FT                   SNWRGPDSFTGIGYQFRPYFIDAVKGGTGRFFGIGTISRDPGYYISQPVRRDGKIIGVA
FT                   VVKLNLEWFQGADASEPLVVADDHGVIFLSSVPQWKYHTLKPLPGPIATSIHETRQYAH
FT                   YPVTPLPLRVERVLGPDAQIVRMGAARRAPRYLATRRLLGEPDWQLVTLAPIEPVDADA
FT                   RNATIVTAFGFVSLSLLAFYWRTRRARVKEMLRSRVLLQSAYAELNRRVEERTADLSQA
FT                   NARLKKEVGERIRAEQELRAAHDELVQASKLAALGQMAAGITHELNQPLAALRSFSDNT
FT                   RVLLDRGEQAAARENLQAIAALTERMGKITNQLKLFVGRAKPRNERAHVARALRNVLAL
FT                   LKERMKDVELVITLRDETRDPAVAARFDPSRDEPALIARCEDLRLEQVLINLLGNALDA
FT                   VAAVAAPRIDVAIDATAATLAITVRDNGPGIAPESLARLFEPFFTTKEMGRGLGLGLAI
FT                   SSSIARDAGGSLTARNAPAGGAEFVLTLRRARTHHPDTSAAS"
FT   gene            343835..345190
FT                   /locus_tag="GBP346_A0387"
FT   CDS_pept        343835..345190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0387"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   regulatory protein DctD"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98510"
FT                   /db_xref="GOA:C4KNW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNW5"
FT                   /protein_id="ACQ98510.1"
FT                   /translation="MANRLQVIYIEDDELVRRASVQSLQLAGFDVVGFGSVEAAEKAIV
FT                   GDATGVIVSDIRLPGASGLELLAQCRERTPDVPVVLVTGHGDISMAVQAMRDGAYDFIE
FT                   KPFAAERLTETVRRALERRALVLENHALRRELAGQGVVAPRIIGRSPAIEQVRRLIANV
FT                   APTDASVLINGDTGAGKELIARSLHELSPRRDKPFIAVNCGALPEPMFESEMFGYEPGA
FT                   FTGAAKRRIGKLEYASGGTLFLDEIESMPLALQVKLLRVLQDGVLERLGSNQPIRVNCR
FT                   VVAAAKGDMSEHVAAGTFRRDLLYRLNVVTIALPPLAERREDIVPLFEHFMLDAAVRYG
FT                   RPAPLLTDRQRASLMQRDWPGNVRELRNAADRFVLGVTEGIVGDAGPETDEHAEQSLKE
FT                   RVEQFERAVIAETLNRTGGAVATTADKLHVGKATLYEKMKRYGLSAKGETDR"
FT   gene            complement(345306..345842)
FT                   /locus_tag="GBP346_A0388"
FT   CDS_pept        complement(345306..345842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0388"
FT                   /product="redoxin domain protein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98974"
FT                   /db_xref="GOA:C4KNW6"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNW6"
FT                   /protein_id="ACQ98974.1"
FT                   /translation="MSPAPAPTSRRAGPLRYVAIAVAAVAIAVAGYFAFNGKSSAPEAT
FT                   FTLLSGQKLSTAADLKGKVYLVNFWATSCATCMQEMPQMVDTYNRFKSRGLEFVAVAMN
FT                   YDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVIGKDGKILKRYVGAPQF
FT                   AELDQLLQKALDTSA"
FT   gene            345916..346725
FT                   /locus_tag="GBP346_A0389"
FT   CDS_pept        345916..346725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97732"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNW7"
FT                   /protein_id="ACQ97732.1"
FT                   /translation="MYRQSGARTGAALSRRAAIMRLRSLSIVPAFFMIRAALRAMRLLR
FT                   SRSIGRLRAFGLLARSRSPEATRARRPGMPPGVRARRAAVVLGALASLAACSPAYDWRT
FT                   LHNDAGYTIDLPAKPTVEEHPVAIGGVPMKMRMQAAHVGGAVFAVGTVMLPDERDATQH
FT                   AVLDYLRTGLARNLRARPDERAVLVPLAAGGQAAGVELRMSGAPAGAAGAPGADRQADR
FT                   ASGAHAPKTVIARLVARGRHVYEVIVIADAPLASEPLEQFFGSLKLD"
FT   gene            347265..347417
FT                   /locus_tag="GBP346_A0391"
FT   CDS_pept        347265..347417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96103"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNW8"
FT                   /protein_id="ACQ96103.1"
FT                   /translation="MRPGAVRSVPIAGGHKRGFGRGQARDRAPGRHDALRTAARAPAAA
FT                   FPLRL"
FT   gene            complement(347412..348191)
FT                   /locus_tag="GBP346_A0390"
FT   CDS_pept        complement(347412..348191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0390"
FT                   /product="thioesterase domain protein"
FT                   /note="identified by match to protein family HMM PF00975"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98034"
FT                   /db_xref="GOA:C4KNW9"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNW9"
FT                   /protein_id="ACQ98034.1"
FT                   /translation="MALLPGTLTIPDRREHARHRLLMFHHACGSATNYFRWAAAFAPHI
FT                   EVWLVELPGRGRSLRHGAFDALPPLRDYLRELAPELPAEYSIFGHSMGALVAYCFAQDM
FT                   MQLGRAPRWLGVSGADSPFAASRRRAFPVHQRPDAAIVEHLATLGGTPPEVFAHDELRA
FT                   MLLQLAKADFRIVEAFFPLASATPLPVPVTVFAGAQDTVLSEGGLQDWQRASTLPIERE
FT                   TFDGGHFYLLDTPCAIHDAIGAALARHERQASVPAVL"
FT   gene            complement(348209..348637)
FT                   /locus_tag="GBP346_A0392"
FT   CDS_pept        complement(348209..348637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97506"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNX0"
FT                   /protein_id="ACQ97506.1"
FT                   /translation="MGDAARPLRAAHGSKRPTGESARFARQCARHKHTSTGARSRAPVF
FT                   DHGPSPRERRARLAAARGERPALGARPSARRARKPAQPRLAPAAPQPRIRAAKRQPESH
FT                   ANRNIVRATMSGPSAGIAPRPAPRAFAAPPDRPKTCLP"
FT   gene            348692..349156
FT                   /locus_tag="GBP346_A0393"
FT   CDS_pept        348692..349156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0393"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96506"
FT                   /db_xref="GOA:C4KNX1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNX1"
FT                   /protein_id="ACQ96506.1"
FT                   /translation="MTIVVRAARRTDWPALRALYLHARRDTFAWLPAERFAAGDFDEHT
FT                   RGEALLVAQARDEGIVGFVSVWEPERFVHHLYVAGTRLREGIGAALLRALPGWPAARYR
FT                   LKCLVRNERALAFYRAHGFVEIDSGVSADGEYRLLGTREAATAARPGKRD"
FT   gene            349178..349297
FT                   /locus_tag="GBP346_A0394"
FT   CDS_pept        349178..349297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96891"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNX2"
FT                   /protein_id="ACQ96891.1"
FT                   /translation="MPSGIAPKIDMPRPRRGCGAPIAMAHARRVLADSRARRV"
FT   gene            complement(349585..351171)
FT                   /locus_tag="GBP346_A0395"
FT   CDS_pept        complement(349585..351171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0395"
FT                   /product="putative Mg chelatase family protein"
FT                   /note="identified by match to protein family HMM PF01078;
FT                   match to protein family HMM PF07728; match to protein
FT                   family HMM TIGR00368"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95309"
FT                   /db_xref="GOA:C4KNX3"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNX3"
FT                   /protein_id="ACQ95309.1"
FT                   /translation="MSLAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRES
FT                   RERVRAALQNCGFEFPVRRITVNLAPADLPKESGRFDLPIALGILAASGQLPAGALDGR
FT                   EFAGELSLTGALRPMRGAFAMACGTARGQQADDDGSPAQAESPPARATVPNAAELYLPL
FT                   PSAAEAALVPGVTVYGAADLPALCAHLADTPDGRLAPVAAPRLDALPAAATADLADVIG
FT                   QAGAKRALEVAAAGGHHMLMIGPPGAGKSMLAARLPALLPPLTDDEALTSAAILSSSRA
FT                   GFSPAQWRRRPFRAPHHSSSSAALVGGRNPPQPGEITLAHLGVLFLDELPEFDRHVLET
FT                   LREPLEAGRITISRAALQADFPAACQLIAAMNPCPCGWRGDPAGRCRCSPDIAARYLRK
FT                   LSGPLLDRIDIQIEIPALTPAELAERPTAAGESSETVAARVALARERQFARQRKTNHML
FT                   TGRETDTLCRPDSAGETLLRDAGERFRWSARAYYRVLKVARTIADLAGDDAPSAAHIAE
FT                   AIRYRRAFAPA"
FT   gene            complement(351309..351560)
FT                   /locus_tag="GBP346_A0396"
FT   CDS_pept        complement(351309..351560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04380"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95128"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNX4"
FT                   /protein_id="ACQ95128.1"
FT                   /translation="MKQPSDVFNDLQARIGDLLKNSPAKDVERNVKAMLTQGFSKLDLV
FT                   TREEFDTQAQVLARTRARLEELEKRVAELEQKLADVQS"
FT   gene            351929..352267
FT                   /locus_tag="GBP346_A0397"
FT   CDS_pept        351929..352267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0397"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="identified by match to protein family HMM PF00543"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97279"
FT                   /db_xref="GOA:C4KNX5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNX5"
FT                   /protein_id="ACQ97279.1"
FT                   /translation="MKLITAIIKPFKLDETREALSALGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKMKIEAAVSDDLVDQAVEAIERAARTGKIGDGKIFVTSIEQVIRIRT
FT                   GETGADAL"
FT   gene            352300..353802
FT                   /gene="amt"
FT                   /locus_tag="GBP346_A0398"
FT   CDS_pept        352300..353802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt"
FT                   /locus_tag="GBP346_A0398"
FT                   /product="ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909;
FT                   match to protein family HMM TIGR00836"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98501"
FT                   /db_xref="GOA:C4KNX6"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNX6"
FT                   /protein_id="ACQ98501.1"
FT                   /translation="MRKILMSLLMAGSLLAGGIGAAMADDASSAPAAASAATASDTSAG
FT                   AAASAPAASAAPAASAAPAASAPAAASAAAPASAAAAPAAPTAPFSVDSSKINSGDTAW
FT                   MLTSTALVLFMTIPGLALFYGGMVRKKNVLATVMQSFAITALITVLWTVVGYSLAFTPG
FT                   NGFIGGFSRVFLSGMNYIHGDKATTLTVSHLASTIPESVYFVYQMTFAIITPALICGAF
FT                   ADRMKFSAMLVFMTLWSLIVYVPIAHMVWEPTGWLSADGVLDFAGGTVVHINAGIAGLV
FT                   SCLMLGKRVGYGREAMAPHNLVLTLIGGSMLWVGWFGFNAGSAVAADGRAGFAMLTTQV
FT                   ATACAALGWMFAEWIAKGKPSVLGIVSGAVAGLVAITPAAGFVGVAGALVIGIAAGVVC
FT                   FWSATWLKHKLGYDDSLDAFGVHGVGGILGALLTGVFAVKDIGGADGSLLLQAKGVAIT
FT                   LVYSGIVSFVLLKVIDIVIGLRVTEEEEREGLDVILHGEHVE"
FT   gene            354161..355450
FT                   /gene="gshA_2"
FT                   /locus_tag="GBP346_A0399"
FT   CDS_pept        354161..355450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA_2"
FT                   /locus_tag="GBP346_A0399"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF08886;
FT                   match to protein family HMM TIGR02049"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96904"
FT                   /db_xref="GOA:C4KNX7"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNX7"
FT                   /protein_id="ACQ96904.1"
FT                   /translation="MVPHLVTALNGPLLELERKILDATPAIERWFRLEWQEHTPPFYCS
FT                   VDLRNAGFKLAPVDANLFPGAFNNLPPEVLPLAVQAAMAAIEKICPDAKNLLVIPELPT
FT                   RNAFYLENVARLATIMRQAGLNVRFGSLDPSIAEVTPITLADGQKIVLEPLERTPRRLG
FT                   LKNFDPCSILLNNDLSAGIPSVLENLHEQYLLPPLHAGWAVRRKSTHFSCYDDVAKKFA
FT                   KMVGVDPWMLNPYFSPVEGVDWHASDGGEALAEAIDAVLKKIARKYREYGIGEKPYVVV
FT                   KADAGTAGRGVMTVHDASEIGRMTKHERAQMAESKAGVPVSDVIVQEGVYTFERIGDEV
FT                   AEPVVYMIDRYVVGGFYRTHGARERDQNLNAPGMHYVPLGFEHTALPDTHAKPGAAPPN
FT                   RFYMYGVVARLGLLASSVELEKTDPEAIQV"
FT   gene            355478..356434
FT                   /gene="gshB"
FT                   /locus_tag="GBP346_A0400"
FT   CDS_pept        355478..356434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="GBP346_A0400"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="identified by match to protein family HMM PF02951;
FT                   match to protein family HMM PF02955; match to protein
FT                   family HMM PF08443; match to protein family HMM TIGR01380"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97589"
FT                   /db_xref="GOA:C4KNX8"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNX8"
FT                   /protein_id="ACQ97589.1"
FT                   /translation="MDILFIADPLDRFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWT
FT                   GAGVEADVRRVTIAGDTADLHRDRWYEAAARESRALPSFGAILMRKDPPFDMEYVTSTW
FT                   LLELAERAGARVFNKPQTIRDHSEKLAIGEFAQFVAPSLVTRDAARLRAFHAEHGDVIL
FT                   KPLDGMGGMGVFRVKADGMNLGSIIEMLSHDGARSVMVQKFIPEIKAGDKRILLIDGEP
FT                   VPYSLARIPQGSEVRGNLAAGGVGVAQPLTERDREIAAALGPVLAARGLLLVGLDVIGD
FT                   WLTEVNVTSPTCFREIMEQTGFDVAGMFVDALERAVG"
FT   gene            356607..357080
FT                   /locus_tag="GBP346_A0401"
FT   CDS_pept        356607..357080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0401"
FT                   /product="PTS system, fructose-specific IIA component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95479"
FT                   /db_xref="GOA:C4KNX9"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNX9"
FT                   /protein_id="ACQ95479.1"
FT                   /translation="MAGILIIAHAPLATALRDCIAHIYGGLPARIGCIDVQAENDPAQV
FT                   MAFAHAELARLKEENGALVLTDMYGATPANIAGQLAKVEGVRVLAGVNLPMLVRAVCYR
FT                   TTPLDTLVDKALAGSTKGIHEIAAGTPPPRPSALGCGECAPIPPEPKAQTQPH"
FT   gene            357157..357426
FT                   /gene="ptsH"
FT                   /locus_tag="GBP346_A0402"
FT   CDS_pept        357157..357426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="GBP346_A0402"
FT                   /product="phosphocarrier protein HPr"
FT                   /note="identified by match to protein family HMM PF00381;
FT                   match to protein family HMM TIGR01003"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96533"
FT                   /db_xref="GOA:C4KNY0"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNY0"
FT                   /protein_id="ACQ96533.1"
FT                   /translation="MLQQETTIVNKLGLHARASAKLTQLAGNFQAEVWMTRNGRRINAK
FT                   SIMGVMMLAAGIGSTVTIETEGPDEREAMDALLKLIADKFGEGQ"
FT   gene            357604..359394
FT                   /gene="ptsP"
FT                   /locus_tag="GBP346_A0403"
FT   CDS_pept        357604..359394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="GBP346_A0403"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF02896; match to protein
FT                   family HMM PF05524; match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97272"
FT                   /db_xref="GOA:C4KNY1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNY1"
FT                   /protein_id="ACQ97272.1"
FT                   /translation="MIKEVRVSFTLHGIPVSRGIAIGRAYLIAPAALDVAHYLIEAERI
FT                   EAEIERFRTALGAVRRELDVLRADLTDDTPTEVAAFIDVHAMILGDAMLVQETIDLIRT
FT                   RRYNVEWALTEQLDVLAGHFDDIEDEYLRERKADIEQVVERVLKALAGAPSAAQALDRA
FT                   AGNGRDEMIVVAHDIAPADMMQFKTQSFQAFVTDLGGRTSHTAIVARSLGIPAAVGVQH
FT                   ASALIRQDDLIIVDGDQGIVIVDPAPIVLEEYSYRQSEKALEQRKLQRLKFSPAQTLCG
FT                   TKIDLLANIELPDDAKAAVDAGAVGVGLFRTEFLFMSKVRMPEEEEQFAAYKRAVELMH
FT                   GMPVTIRTIDVGADKPLDVHDEGYETAPNPALGLRAIRWSLSEPQMFLTQLRAILRASA
FT                   FGQVKILVPMLAHAQEIDQTLDLINEAKRQLDAAGLAYDPNVRVGAMIEIPAAAIALPL
FT                   FLKRVDFLSIGTNDLIQYTLAIDRADNAVAHLYDPLHPAVLHLIAFTLREAKRAGVPVS
FT                   VCGEMAGDPALTRLLLGMGLTEFSMHPSQLLVVKQEILRAHLKALEKPTADVLASFEPE
FT                   EVQAALARLASAEPRADVAA"
FT   gene            359457..359657
FT                   /locus_tag="GBP346_A0404"
FT   CDS_pept        359457..359657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98755"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNY2"
FT                   /protein_id="ACQ98755.1"
FT                   /translation="MAARPFGFDCKRGHALCFSADADADADADADADADADADADADAD
FT                   ADAAIITVARADGRARPLPQR"
FT   gene            complement(359682..360440)
FT                   /locus_tag="GBP346_A0405"
FT   CDS_pept        complement(359682..360440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0405"
FT                   /product="HesA/MoeB/ThiF family protein"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98430"
FT                   /db_xref="GOA:C4KNY3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNY3"
FT                   /protein_id="ACQ98430.1"
FT                   /translation="MNDEQLLRYSRHILVDEIGIEAQQRFLDAHAIVVGAGGLGSPAAM
FT                   YLAAAGVGTITLVDADTVDLTNLQRQILHATDSVGRKKVESGRDALARLNPDVKVNAVA
FT                   ERVDDAWLNAHVPHASVVLDCTDNFATRHAINRACVAHRVPLVSGAALRFDGQISTFDF
FT                   REPGSPCYACVFPEDQPFEEVACSTMGVFAPTVGIIGAMQAAEALRVIGGIGATLVGRL
FT                   MMLDSLRMEWNTMKIARQPDCPVCGAGGAH"
FT   gene            complement(360545..362119)
FT                   /locus_tag="GBP346_A0406"
FT   CDS_pept        complement(360545..362119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0406"
FT                   /product="carboxy-protease"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF03572; match to protein
FT                   family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99036"
FT                   /db_xref="GOA:C4KNY4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNY4"
FT                   /protein_id="ACQ99036.1"
FT                   /translation="MRMKLKNIGLIAAGLATGVFATLQISASAQQAVTTAAAPLPLDQL
FT                   RLFAEVFGQIKREYVEPVDDKKLLTAAIKGMVSSLDPHSSYLDKTDYQELQEQTKGRFA
FT                   GLGIEISQEDGLVKVISPIEDTPAFRAGIRPGDLITRINDRPVRGMTLDKAVKQMRGEP
FT                   GTKVTLTIFRKSDDRTFPVTVTRAVIRVQSVKMKLLDPGYAYIRITSFQERTTPDLAAK
FT                   LQDIARQQPNLKGLILDLRNNGGGLLQSAVGVAGAFLPPDSVVVSTNGQIPDSKQIYRD
FT                   NYENYRLPSFDSDPLKNLPAVFKTVPMIVLTNAYSASASEIVAGALQDSHRAVIMGKAT
FT                   FGKGSVQTVRPMTADSALRLTTAYYYTPSGRSIQNKGILPDIPVDQYADGDPDDVLVTR
FT                   EVDYTNHLANTQDPNEKKELEEREQRRMEQLRILEEQNDKKTPEQRQKDRERKPIEFGS
FT                   ADDFMMQQALNKLEGKPVEQSKMIAADSTAKSAAAKAGVASAAKGASGAAAKPASAAKP
FT                   ASAPQPQ"
FT   gene            complement(362340..363089)
FT                   /locus_tag="GBP346_A0407"
FT   CDS_pept        complement(362340..363089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0407"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.1"
FT                   /note="identified by match to protein family HMM PF00300;
FT                   match to protein family HMM TIGR01258"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95141"
FT                   /db_xref="GOA:C4KNY5"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C4KNY5"
FT                   /protein_id="ACQ95141.1"
FT                   /translation="MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKE
FT                   AGYTFDIAYTSVLKRAIRTLWHVQDQMDLMYVPVVHSWRLNERHYGALSGLNKAETAAK
FT                   YGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAKVPREQLPLTECLKDTVARVLPLW
FT                   NESIAPAVKAGKQVLIAAHGNSLRALIKYLDGISDADIVGLNIPNGVPLVYELDESLTP
FT                   IRHYYLGDQEAIAKAQAAVAQQGKSAA"
FT   gene            363223..363630
FT                   /locus_tag="GBP346_A0408"
FT   CDS_pept        363223..363630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0408"
FT                   /product="rhodanese domain protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95273"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPC2"
FT                   /protein_id="ACQ95273.1"
FT                   /translation="MTFFTDYTNLALIAILVVSGGLLAWPALRRGGGGLSAAEATQLIN
FT                   RRNALVVDLRPAAEYGAGHLPSARSVEFGELQAKAGQLAKNKATPVLLVCQNGQQSQKA
FT                   RKIVEEAGYQDVHVLQGGVAAWQQAGMPVVK"
FT   gene            363642..363902
FT                   /gene="grxC"
FT                   /locus_tag="GBP346_A0409"
FT   CDS_pept        363642..363902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="GBP346_A0409"
FT                   /product="glutaredoxin 3"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM TIGR02181"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95402"
FT                   /db_xref="GOA:C4KPC3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPC3"
FT                   /protein_id="ACQ95402.1"
FT                   /translation="MNKVVMYSTQVCPYCMQAERLLKLRGVEHIEKVLIDKEPERRAEM
FT                   MERTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLKPLLEAA"
FT   gene            364019..364498
FT                   /gene="secB"
FT                   /locus_tag="GBP346_A0410"
FT   CDS_pept        364019..364498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="GBP346_A0410"
FT                   /product="protein-export chaperone SecB"
FT                   /note="identified by match to protein family HMM PF02556;
FT                   match to protein family HMM TIGR00809"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96989"
FT                   /db_xref="GOA:C4KPC4"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPC4"
FT                   /protein_id="ACQ96989.1"
FT                   /translation="MSDVENQPFFNIQRIYLKDLSLEQPNSPAIFLEQEMPAVEVEVDV
FT                   KAERLAENVYEIVVAGTVTAKVREKVAFLVEAKQAGIFDIRNIPAEQIDPLCGIACPTI
FT                   LFPYLRSNIADSITRAGFPPIHLAEINFQALYEQRLAEISQQQQQGGAPNGTTLN"
FT   gene            364515..365522
FT                   /gene="gpsA"
FT                   /locus_tag="GBP346_A0411"
FT   CDS_pept        364515..365522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="GBP346_A0411"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97658"
FT                   /db_xref="GOA:C4KPC5"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPC5"
FT                   /protein_id="ACQ97658.1"
FT                   /translation="MLSMKVAVLGAGAWGTALAAHLAVRHDTLLWARDAALVAELAARR
FT                   ENARYLGGVALPPGLRYEADLATALSHAQADDALCVIAAPVAGLRALCRAMRDARRVPA
FT                   HFVWVCKGFEADTRRLPHQMVAEELPDHASYGVLSGPSFAREVAQGLPVALTVASASAA
FT                   CRERTLAAFHHGAMRIYTGDDVVGVEVGGAVKNVLAIATGIADGLGLGLNARAALVTRG
FT                   LAEMSRLGVALGGRAETFTGLTGLGDLILTATGDLSRNRSVGLQLAAGRSLNDILAALG
FT                   HVAEGVRCARAVLSIARERGVDMPITEAVCAVLFDGVAPRDAVSGLLRRDAKAE"
FT   gene            365642..366208
FT                   /locus_tag="GBP346_A0412"
FT   CDS_pept        365642..366208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0412"
FT                   /product="appr-1-p processing enzyme family domain protein"
FT                   /note="identified by match to protein family HMM PF01661"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96240"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPC6"
FT                   /protein_id="ACQ96240.1"
FT                   /translation="MRIAIRSLEGAMPNIGPTSVEACVVDITTLTLDAIVNAANASLLG
FT                   GGGVDGAIHRAAGPELVKECAALGGCATGDAKLTRGYRLPAKYVIHTVGPVWRGGGHGE
FT                   AGLLASCYRRSLEVAAGAGCASIAFPAISCGVYRFPPADATAIAVRTVAGALAGELADA
FT                   RFERVVFACFSSDMLDFYRTALVRF"
FT   gene            complement(366639..367178)
FT                   /locus_tag="GBP346_A0413"
FT   CDS_pept        complement(366639..367178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0413"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97074"
FT                   /db_xref="GOA:C4KPC7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPC7"
FT                   /protein_id="ACQ97074.1"
FT                   /translation="MTARRIRRRIHTHSHAFHRSNRIMFNVVLVEPEIPPNTGNVIRLC
FT                   ANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAQMRVHRDWDAFVAAEAPDPARMFAFT
FT                   TRGSGRFHDRAFEPGDWFVFGAETRGLAPALVDRFAPEQRVRLPMRPGNRSLNLSNTVA
FT                   VVVFEAWRQAGFEGGA"
FT   gene            complement(367175..367942)
FT                   /locus_tag="GBP346_A0414"
FT   CDS_pept        complement(367175..367942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0414"
FT                   /product="ComF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97380"
FT                   /db_xref="GOA:C4KPC8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPC8"
FT                   /protein_id="ACQ97380.1"
FT                   /translation="MANPAVLRCGIRAMAARAGIVLARFSAAALPNRCALCGNLSHRTI
FT                   CDCCDGAYWNEARLRCPRCALPLPGARGAMRFHCGACAKAPPPFDATLALADYRAPLDS
FT                   LALDLKFRAQLALGREFGERLARLAADALDGAPPLDVIAPVPLARRRLVERGYNQAWAI
FT                   ARPLARKLKVRADAALAARVADTAPQSRLAFDARRANVAAAFAVARPVAGLHVGVVDDV
FT                   MTSGATLDALARTLKEAGARHVTNFVALRTAKD"
FT   gene            367975..368991
FT                   /locus_tag="GBP346_A0415"
FT   CDS_pept        367975..368991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0415"
FT                   /product="methyltransferase type 11"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97165"
FT                   /db_xref="GOA:C4KPC9"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPC9"
FT                   /protein_id="ACQ97165.1"
FT                   /translation="MARSERVYFGLFASVPDMSPASAKTSRPAYDPRRLRRIFDRRAAA
FT                   FDAVSFLPREIAQRMRERLDYIKVNPAGVLDAGCGTGDDLPLLRARFPQAPVFGVDASG
FT                   GMLARAAARDTAETSWRRFLPATLTKALGHRGPRVAQADFSALPFASGAFDLLWSNFAL
FT                   HWHARPDLVFPEWHRVLRVDGLLMFSTLGPDTLRELRAACADAAAAAGEARAVARVIDF
FT                   VDMHDLGDMLVESGFEIPVMDQETLTVTYKSPDSLLADVRRLGAYPFERGAPGHASRRL
FT                   RAALYDALEARRRDDGTIPLTFEVIYGHAWKAAPRTTAEGFSIVRVQDIGKGRPKRS"
FT   gene            369228..369704
FT                   /locus_tag="GBP346_A0416"
FT   CDS_pept        369228..369704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97725"
FT                   /db_xref="GOA:C4KPD0"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPD0"
FT                   /protein_id="ACQ97725.1"
FT                   /translation="MEAANGLHDAEPVLADWLMKRNCSVSPRQFVAFYVSLAAFSLLIA
FT                   VLLLWRGAWLVLPFTGIELLAVGVAFAIYARHAVDYERIRLFPHRLVIERMSAERLTQI
FT                   ELNPRWVRVEPGASPRDPITLVSRGESVVVGQHLAQYRRAQFARELRASLSRYG"
FT   gene            369754..371331
FT                   /locus_tag="GBP346_A0417"
FT   CDS_pept        369754..371331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0417"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="identified by match to protein family HMM PF00034;
FT                   match to protein family HMM PF00116; match to protein
FT                   family HMM PF00691; match to protein family HMM PF02790;
FT                   match to protein family HMM TIGR02866"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98302"
FT                   /db_xref="GOA:C4KPD1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPD1"
FT                   /protein_id="ACQ98302.1"
FT                   /translation="MEILGKEAMKTIKRALTGVLACSALLLSGAALAVGDSPGGPRVNE
FT                   INLQPPVTKIAEELYDLHTMMLILCTVIFVGVFGVMFYSIFAHRKSKGHKAANFHESTT
FT                   VEIIWTIVPFIIVVLMALPATKAVVAMKDTTNADLTVKVTGYQWKWGYDYVKGPGEGIS
FT                   FLSTLSTPRTEVNGRQPISDTYLQEVDHPLVVPVNKKIRVITTANDVVHSWYVPAFGVK
FT                   QDAIPGFVRDTWFKAEKVGTYRGFCTELCGKEHAYMPVVVEVLSDDDYAKWVSTQKAKL
FT                   AAGAVDPNKVYTRAELMAHGEEVYKANCAACHQPNGKGVGAFPALDGGKIVNGPIAGHL
FT                   EQVLKGKGAMPSWASLSDLDIASVITYERNSWGNHKGDSLQPKQVADARNGKLPEDAQQ
FT                   ADGGAAANAASGAAAQTQAQAPALPAAIYFETGKSELPADAKDAIAAAAEYVKAHPDAK
FT                   LALSGFTDKTGSADANAELAKRRAQVVRDALKTAGVAEDRIILKKPETITGGADAKEAR
FT                   RVEIGPAA"
FT   gene            371375..372982
FT                   /gene="ctaD_1"
FT                   /locus_tag="GBP346_A0418"
FT   CDS_pept        371375..372982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD_1"
FT                   /locus_tag="GBP346_A0418"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by match to protein family HMM PF00115;
FT                   match to protein family HMM TIGR02891"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98875"
FT                   /db_xref="GOA:C4KPD2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPD2"
FT                   /protein_id="ACQ98875.1"
FT                   /translation="MSSIGHDVAAGHAHDDHAHETPHGWRRWLFATNHKDIGTLYLLFS
FT                   FIMFLSGGVMALAIRAELFEPGLQIMRPEFFNQLTTMHGLIMVFGAIMPAFVGFANWMI
FT                   PLQIGASDMAFARMNNFSFWLLPVAAVLLVGSFFSPGGATAAGWTLYAPLSTQMGPGMD
FT                   FAIFAVHIMGASSIMGGINIVVTILNMRAPGMTLMKMPMFAWTWLITAYLLIAVMPVLA
FT                   GAITMVLFDRHFGTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSQVIPAFS
FT                   RKPLFGYSSMVYATASIAILSFMVWAHHMFVTGMPVTGQLFFMYATMLIAVPTGVKVFN
FT                   WLATMWRGSLTFETPMLFAIGFLFVFTMGGFTGLMLAMAPLDIQYHGTYFVVAHFHYVL
FT                   VAGSLFALFAGWYYWAPKWTGWMYNETRGKIHFWASMIFFNVTFFPMHFVGLAGMPRRY
FT                   ADYPAQFTDFNQLATIGAFGFGLAQVYFLFAIVLPAYRGGGELERASDKPWDGATGLEW
FT                   TVPSPAPFHTFEHPPTVE"
FT   gene            373006..373191
FT                   /locus_tag="GBP346_A0419"
FT   CDS_pept        373006..373191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95464"
FT                   /db_xref="GOA:C4KPD3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPD3"
FT                   /protein_id="ACQ95464.1"
FT                   /translation="MSYDAGGAHPNEKIRMTRNSQKRRTPDEIRAGNKRLLLILLIVVA
FT                   VFFVGAVVRQWIASTS"
FT   gene            373213..373818
FT                   /locus_tag="GBP346_A0420"
FT   CDS_pept        373213..373818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0420"
FT                   /product="cytochrome c oxidase assembly protein"
FT                   /note="identified by match to protein family HMM PF04442"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95946"
FT                   /db_xref="GOA:C4KPD4"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPD4"
FT                   /protein_id="ACQ95946.1"
FT                   /translation="MSKSEANVDRAFNRSMLLKLVVVAGLMFGFGFALVPMYRAICQIT
FT                   GINNLLQRDVSAREAKNTQVDYTRTVSIELDANARGPLGFKPRRNSIDVHPGELATVVY
FT                   EVTNGQGRTVVAQAIPSYAPKQATEFFKKIECFCFTQQTLAANETRDMPVVFVIDPKLP
FT                   KDVKTITLSYTFFELNTPAPAVKGAAVQTGGAAAKPAA"
FT   gene            373835..374038
FT                   /locus_tag="GBP346_A0421"
FT   CDS_pept        373835..374038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95664"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPD5"
FT                   /protein_id="ACQ95664.1"
FT                   /translation="MVSGSGNKSTFVQTIKAVMWSFFGVRKRRDLEADATQLNPLHVLI
FT                   AALIGAALFVGVLVLIVHAVVG"
FT   gene            374172..375029
FT                   /locus_tag="GBP346_A0422"
FT   CDS_pept        374172..375029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0422"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="identified by match to protein family HMM PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96374"
FT                   /db_xref="GOA:C4KPD6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPD6"
FT                   /protein_id="ACQ96374.1"
FT                   /translation="MTGQNESPYYFVPHPSQHPISAAVGLLIMLGSFALWVNGEPWAPY
FT                   TALVGLLWLLFVLYHWFGDAIAESEGGMYGKRVDKSYRWSMSWFIFSEVMFFGAFFGAL
FT                   FYAREIAMHQLGSLDYKLIWPDFSAVWPNEGPGALVGHFKTMGPWPIPTLNTALLLSSG
FT                   ATLTVSHHALREDHRGKAIAWLAATLVLGVCFLFLQGFEYFHAYNELNLTLGSGVYGST
FT                   FFLLTGFHGFHVFLGGTMLAVVLARMIRGHFKPDHHFAFEGAAWYWHFVDVVWLGLYVV
FT                   VYWL"
FT   gene            complement(375189..375440)
FT                   /locus_tag="GBP346_A0423"
FT   CDS_pept        complement(375189..375440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0423"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95762"
FT                   /db_xref="GOA:C4KPD7"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPD7"
FT                   /protein_id="ACQ95762.1"
FT                   /translation="MTLSSSNCRFPVSFMHILVPIAFVLIIASMVSALYFMMHDRGHTK
FT                   RMVWSLAMRVGLSISLFLFILFANWMGWIHSTGIPIGR"
FT   gene            375486..376199
FT                   /locus_tag="GBP346_A0424"
FT   CDS_pept        375486..376199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0424"
FT                   /product="surf1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97278"
FT                   /db_xref="GOA:C4KPD8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPD8"
FT                   /protein_id="ACQ97278.1"
FT                   /translation="MRIRWLPALLILAVIAITVRLGFWQRERAHQKEALDAQITRYEHA
FT                   NPVDVPRERIALKDIEFHRVRATGRFMPEHAVFLDNRPYNDQPGFYVVMPMKLANGGYV
FT                   LVNRGWLPRNYADRTAIEPFATPAGDVTIEGIARGNASRAFELGEGGSAARQKIRQNLD
FT                   AAEYAQETGLPLQPFVIQQTSDDGDKLVRDWPAPTTGVERNYGYMFQWWGMAAAAAGFG
FT                   LYAARRAARKQSGDA"
FT   gene            376348..376905
FT                   /locus_tag="GBP346_A0425"
FT   CDS_pept        376348..376905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96688"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPD9"
FT                   /protein_id="ACQ96688.1"
FT                   /translation="MLLALALVCAAPVIASYFTYYVIKPRGGATNYGTLIEPQRPIPPD
FT                   LSVVDETGRTIPLASLRGVWLFMMEDGGACDDACAKKLYFMRQVRATQAGERHRITMVW
FT                   LKSDAANVPAAIADAYPDTRKLRADPAAVAAWLPADAGTRVTDHLYLVDPNGNLMMRFP
FT                   KNPDPSRIKQDVTKLLKWSSIG"
FT   gene            376949..378058
FT                   /locus_tag="GBP346_A0426"
FT   CDS_pept        376949..378058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0426"
FT                   /product="cytochrome oxidase assembly protein"
FT                   /note="identified by match to protein family HMM PF02628"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95398"
FT                   /db_xref="GOA:C4KPE0"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPE0"
FT                   /protein_id="ACQ95398.1"
FT                   /translation="MYLLQLGLIGLCIALLPLSYVWVKADDDKFRKLVWITTFLTLDLV
FT                   MFGGFTRLTDSGLGCPDWPGCYGTSSPFIAHAAITAAHQAMPTGPVSMTKAWIEMIHRY
FT                   FAMAIGVLIIAQTVIAWAARLRRKPLHVSPWWPTSLLLLILVQGAFGAWTVTMKLQPVI
FT                   VTIHLLLGLTLLGTLGWLAARQTPLPAHEPGAGRYRAAALAALVLLVVQIALGGWVSTN
FT                   YAVLACTDFPTCNGAWIPPMDFRNGFHLWRALGMTNDGDAITQDALVAIHWTHRTFAFV
FT                   VVAYLAAFALKMRRFASLRRPANGVLAVVVLQFVTGLTNIVLQWPLPVAVAHNGGAAIL
FT                   LLLVVMLNFRILSSRPGRVAQPARDAAPA"
FT   gene            378071..378973
FT                   /gene="cyoE"
FT                   /locus_tag="GBP346_A0427"
FT   CDS_pept        378071..378973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="GBP346_A0427"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96030"
FT                   /db_xref="GOA:C4KPE1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPE1"
FT                   /protein_id="ACQ96030.1"
FT                   /translation="MDTTLSHTPGSRLSQYLALTKPRVTQLAVFCAVIGMFLATPGMVP
FT                   WKVLLGGTIGIGLLAGSAFAINCLVEQKIDAMMRRTAWRPSARGEITTLQILAFSTVLG
FT                   GLGAWTLYTFTNPLTMWLTIATFVGYAVIYTLLLKPMTPQNIVIGGASGAMPPALGWAA
FT                   VTGAVPGDAWILVLIIFVWTPPHFWVLALYRRKDYENAGLPMLPVTHGEQFTRLHILLY
FT                   TVILFAVTMMPFISGMSGAVYLTSAVLLGALFLAYAWKIYRDYSDALARRAFRYSIVYL
FT                   SLLFAALLVDHYARPVIGM"
FT   gene            378993..379610
FT                   /locus_tag="GBP346_A0428"
FT   CDS_pept        378993..379610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0428"
FT                   /product="SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95455"
FT                   /db_xref="GOA:C4KPE2"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPE2"
FT                   /protein_id="ACQ95455.1"
FT                   /translation="MLKTLFARRRAQRGWLFACALAGAMLIAGCNRQPAFQNLDITGNS
FT                   QFASDFALPDTAGKIRTLGEFKGKAVVVFFGYTHCPDVCPTTMAELSQALQQLGPDGKR
FT                   VQVLFVTVDPERDTAALLGQYVPAFNPAFIGLRPADEAQLKKVTKDFRVYYAKVPGKTP
FT                   GSYTMDHTAASYVFDPNGKLRLFVRDGQGPGPWVHDLKLLLD"
FT   gene            complement(379690..379983)
FT                   /locus_tag="GBP346_A0429"
FT   CDS_pept        complement(379690..379983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0429"
FT                   /product="YCII-related domain superfamily protein"
FT                   /note="identified by match to protein family HMM PF03795"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95097"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPE3"
FT                   /protein_id="ACQ95097.1"
FT                   /translation="MYVIDIRYTAPLERIDDALERHRAYLQRHFDAGVFVACGPKVPRD
FT                   GGVILAVRIERDRLDAILETDPFVTEGLVTYTVTEFKTTRVAPGVNLPALPS"
FT   gene            380170..381810
FT                   /locus_tag="GBP346_A0430"
FT   CDS_pept        380170..381810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0430"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF08269"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96998"
FT                   /db_xref="GOA:C4KPE4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPE4"
FT                   /protein_id="ACQ96998.1"
FT                   /translation="MNRMSLNRKLWLALALVWVGLLGVGAWSAFETRTTMLAERKEGMA
FT                   NLVDSAAGVVKAYYALAQSGKMSDEDARRDALERLAAMRYGDSGYLFVMDSKPVVLMHP
FT                   TLPKLVGTQVGDYLDPDGKRLFVTILNAAKAGGHGFAEYRGRLPHSETAVPKISYVTRF
FT                   APWDWNISSGVFLKDIDTVYYETLVGHLAVVFVIGLVITAAMLVIIRNVRASLGGEPDE
FT                   AASLAARIAAGDLTRPVAVRAGDGTSMMAAMRDMQGRLRSTIGGIRRAAESIAAASHEI
FT                   ASGNHDLSQRTEQQAASLEETAASMEELTATVKQNAENARQASGLANNASEIALKGNDV
FT                   VSRVIGTMGEINDSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGE
FT                   VRSLAQRSATAAKEIKQLIDASVERVNNGSALVGQAGETMTEILQAVRRVTDIMGEIAA
FT                   ASEEQSSGISQVGRAVTQMDEMTQQNAALVEEAAAAASSLQEQAARLRESVSAFQVGDG
FT                   AAAGAGAAAGVVGGPNAAASSGRVEPALA"
FT   gene            381807..381959
FT                   /locus_tag="GBP346_A0431"
FT   CDS_pept        381807..381959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96425"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPE5"
FT                   /protein_id="ACQ96425.1"
FT                   /translation="MTHGHTYMSGMYFTVPRSCDTICAFVSAARPVRPSRPLYRAWMVL
FT                   QASEK"
FT   gene            381960..382778
FT                   /locus_tag="GBP346_A0432"
FT   CDS_pept        381960..382778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0432"
FT                   /product="D-methionine-binding lipoprotein MetQ"
FT                   /note="identified by match to protein family HMM PF03180;
FT                   match to protein family HMM TIGR00363"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97375"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPE6"
FT                   /protein_id="ACQ97375.1"
FT                   /translation="MKRRTLLKVVSAVAASAAALSVSVGAQAQDKVIKVGTVAGPDAQV
FT                   WQVVQKVAKEKQGLDVKVIEFNDYVQPNAALDSGDLDANSFQHQPYLDSQVKQRGYKIV
FT                   SAGLTYISPIGVYSKKFKSLKELPAGAKVALPNDPSNENRALLLLQTQGVIKLKAGAGT
FT                   GGSNATVLDVAENPKKLKLTELDAAQLPRVLSDVDAAVINTNYALAANLQPTKDAIALE
FT                   SLTSPYANLIAVRAKDKDQPWVKKLVKAYQSPEVKEFITKQFKGSMVASF"
FT   gene            383029..384000
FT                   /locus_tag="GBP346_A0433"
FT   CDS_pept        383029..384000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0433"
FT                   /product="ABC-type transporter, periplasmic component"
FT                   /note="identified by match to protein family HMM PF04392"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97944"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPE7"
FT                   /protein_id="ACQ97944.1"
FT                   /translation="MKRFKIVAAHSIAAGVAAFAMLGAGAAHAQTVKVLSIVDHPALDA
FT                   IRDGVRAQLKAEGYGDDKLKWEYQSAQGNTGTAAQIARKFIGDRPDVIVAIATPAAQAV
FT                   VASTKTVPVVYSGVTDPVAAQLVKGWGPTGTNVTGVSDQLPLDRQVALIKRVVPKAKTV
FT                   GMVYNPGEANSVVVVKVLKEILAKQGMTLKEAAAPRTVDIAPAAKSLIGKVDVIYTNTD
FT                   NNVVSAYESLVKVANEAKIPLVAGDTDSVKRGGIAALGINYGDLGRQTGKVVARILKGE
FT                   KPGAIASETSSNLELFVNTDAAAKQGVTLAPDLVKEAKTVIK"
FT   gene            384319..385215
FT                   /locus_tag="GBP346_A0434"
FT   CDS_pept        384319..385215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0434"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95636"
FT                   /db_xref="GOA:C4KPE8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPE8"
FT                   /protein_id="ACQ95636.1"
FT                   /translation="MSLFSLLGALEIGLIFSLVALGVLISFRILNFPDLTVDGSFPLGG
FT                   AVAATLIAAGHDPFTSTLAALAAGACAGFVTGWLNVRLKIMDLLASILMMIALYSVNLR
FT                   IMGRPNVPLITEPTLFTVLQPDWMPDYVLRPALLAVVVVCAKLGLDWFFSSQLGLAMRA
FT                   TGANPRMARAQGIPTGRATLAGMALSNALVALAGALFAQTQGGSDISMGIGTIVIGLAA
FT                   VIIGETLLPARRLFLTTLAVVLGAILYRFFIALALNSEFVGLKAQDLNLVTALLVTVAL
FT                   VLPATRKKLFGRKTGGA"
FT   gene            385216..386010
FT                   /locus_tag="GBP346_A0435"
FT   CDS_pept        385216..386010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0435"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96216"
FT                   /db_xref="GOA:C4KPE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPE9"
FT                   /protein_id="ACQ96216.1"
FT                   /translation="MLSAQDLKLTFNPGTPIETRALRGLSLDIPDGQFVTVIGSNGAGK
FT                   STFLNSVSGDQPVDSGRIAIDGVDVTRKPAWDRAPLVARVFQDPMAGTCEALTIEENMS
FT                   LAMARGARRGFLPALNRASRELFRDKLRLLNLGLENRLTDRIGLLSGGQRQAVSLLMAS
FT                   LRPSRILLLDEHTAALDPKTAAFVLELTARIVDESKLTTMMVTHSMRQALDYGDRTVML
FT                   HQGQVVLDVAGDERRGLDVPDLLQLFEKTRHEKLDDDALLLG"
FT   gene            386217..386927
FT                   /locus_tag="GBP346_A0436"
FT   CDS_pept        386217..386927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99136"
FT                   /db_xref="InterPro:IPR017166"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPF0"
FT                   /protein_id="ACQ99136.1"
FT                   /translation="MSASSLSLESLHPSLWRGSQLARGGPRTVDTGYAALSVELPGGGW
FT                   PLGGLVELLVPHMGCGEMRVLAPALAATGSARRPLAFVAPPQPPHACALAGLGVPLDAL
FT                   LWLRASSGVNALWAAEQALRTGCCGALLLWHQNARADALRRLHLAAARAGDTLFVMFRP
FT                   LAAAQQPSPAVLRLALHPSPGGVSVEIVKRRGPARGEPLALELPSPIVESRYARLARHP
FT                   SAAPAARRVRAAVA"
FT   gene            386905..388335
FT                   /locus_tag="GBP346_A0437"
FT   CDS_pept        386905..388335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ94992"
FT                   /db_xref="GOA:C4KPF1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPF1"
FT                   /protein_id="ACQ94992.1"
FT                   /translation="MCAPPSPDGGNGCAVLEQGVVLIADAPARANGVRAGMKRGGVLTL
FT                   APGTRLVERDPAREADALRAVALALLRFSPCVALDDEATLVVDVGASLRLFGGLPSLCR
FT                   QVRATLAALGYAARVAVAPTGRGAWLLARAPGKPGTRRRVVRAASLARALDALPCELLP
FT                   DARPYAGWFDGLGCRTLADLRRLPRAGLTRRCGPALVAALDRAYGDAVEPLAWMPVPPV
FT                   FDARLELPERVEYAQAVLFVARRLVVQLCGWLAARQLSLSAMVFALEHERGRQAVPPTP
FT                   LELAFAEPARDETHFMRVLGERLARVALPAAVIAVRVTATRVESVAPPADDLFPEPGGT
FT                   REARARLVELLSARLGADNVLRAAPVADYRPEAANRWLPLDAPTGKPVAPGVAPPRPAW
FT                   LLAPPQPLAMRGNRPFYRTPLRFVSSIERIEAGWFDGQLVERDYRIAQDDYGACYWIYQ
FT                   ERGNRAAGQCWFLHGLFG"
FT   gene            388341..391571
FT                   /locus_tag="GBP346_A0438"
FT   CDS_pept        388341..391571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0438"
FT                   /product="error-prone DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF02811; match to protein
FT                   family HMM PF07733; match to protein family HMM TIGR00594"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98079"
FT                   /db_xref="GOA:C4KPF2"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPF2"
FT                   /protein_id="ACQ98079.1"
FT                   /translation="MDAASGILPDYAELFCRSNFSFLHGASSAEELVERAAKQGYRGIA
FT                   ITDECSLAGAPRMHVAAKAVGLPLVVGAYFGVTPDDAAPGHDPGHDPGPGAFGLVLLAQ
FT                   NREGYGNLSELISWRRMNAPKGTYRLTPRMLAAPPRALAHLRGVPDCFAILVPTYPARA
FT                   DVLDAQLAWFDALFGERARLGLVQLQRALDGAHREQVRAAGERRGMHIVALGDVTMHIR
FT                   SCKPLQDTMTAIRLGMPIAECGHALAPNGEQHLRTRQRIAQLFPADALAQTCRMLDACH
FT                   FSLDDLRYEYPHEIVPAGHTPTSYLAQETWAGARRRYPDGVPDTVRQRIEFELALIADL
FT                   KYEPYFLTVYDIVKYARSKDILCQGRGSAANSVVCYCLGVTEINPQQSTLLFERFLSRE
FT                   RGEPPDIDVDFEHQRREEVIQYLYEKYGHDRAALAAAVSTYRPRGALRETGKALGVDPM
FT                   LVERVAKEHRWFDGSRDLLARFASVGLDPEVPLIRTWAEIAARLLNFPRHLSQHSGGFV
FT                   VSRGKLTRLVPVENAAMEGRRVIQWDKDDLEALGLMKVDVLALGMLSALHRAFDMITAW
FT                   RGPPLPDGRPFRLEHIPQDDEATYDMICRADTVGVFQIESRAQMSMLPRLRPRGYYDLV
FT                   VQVSIVRPGPIQGGAVHPYLERRRIAAGEAHGEITYPSEALERVLERTLGIPIFQEQVM
FT                   QIAIVAAGFTPGEADALRRAMAAWKRKGDLGKYHERIVAGMLERGYSREFAEQIFEQIK
FT                   GFGEYGFPESHAASFAKLAYASSWLKRHEPAIFLAALLNSQPMGFYPPAQLVQDAKRHG
FT                   VTVLPIDATKSGWEASLEAQPGAAPPDGRPAVRLGLSLVRGLGEEAARRIGAACAAGPF
FT                   ASVDELARRACLERRDLEALAAANAFATLAGNRRDALWQAVAAAPERGLLAAAPIDEAV
FT                   RPALGAPTEADDVFADYRTIGLTLNRHPVALLRPALDARRLSSAAALRDRRNGRLARAC
FT                   GLVTARQMPGTAKGVLFVTLEDETGCVNVIVRPELLERQRRETLDSQLLAVSGVWQCES
FT                   DVRHLVAQYLEDLTPLIAGLRTESREFH"
FT   gene            complement(391864..392685)
FT                   /locus_tag="GBP346_A0439"
FT   CDS_pept        complement(391864..392685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98506"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPF3"
FT                   /protein_id="ACQ98506.1"
FT                   /translation="MNSITTTPNHLLDIVYPVLEGMAPGALQRALADAFDAESASLAQI
FT                   EHAFNTLTSGKPPQEALRMFFASWSKTNNSAASVSGLANRVTLLARSDPGSPASARLYD
FT                   VCASLQRITDEDLGALGGALHADLFYNMATTICGDDAWLLKSNCVASAQAFKDWTDRQR
FT                   LRNRDLMQGLLTTLVHEVYTHGEVEFIHPLYKAWVEHRMNVPAERVRFVVAWVTVHTGG
FT                   TESAHFAHAVRAIDTFCDAMDVRIDPASSTALFREYLRRKADVMRTCAAAL"
FT   gene            complement(392729..393922)
FT                   /locus_tag="GBP346_A0440"
FT   CDS_pept        complement(392729..393922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0440"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96824"
FT                   /db_xref="GOA:C4KPF4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPF4"
FT                   /protein_id="ACQ96824.1"
FT                   /translation="MVTNTLRFAFFMCGCAAFLGLYATQGILPQIAATFGTRIEQAALG
FT                   ITATTVAMAATAPFVGMLTRRLERRRIITLAALLLAAPMLWTAHADSFAEFLAGRIATG
FT                   VVIPVLFAVTVSYIGETWQDSTATEMTSFFIAGTTLGGFGGRFIVNGVTAMSGWPRALD
FT                   VLACAMLAAGVAIRLCLPRTRAAATAAAPAAMSLRALGRNRPVLASYFIGACILFSQVT
FT                   TFTYVGLYLAKPPYRFGTAAIGSIYAVFLLAVVVTPMAARLSRRRPPADLLALAAGLGV
FT                   AGALLTLHADVRVILLGLAIGSTGVFVGQAAASAFVTRSTAEGRTFAVGLYLSFYYLGG
FT                   SAGTVLPVPAWQRFGWAGCVALVVCAHLLAAIAACTFWKPGGIDATRTRPSSITTSR"
FT   gene            393909..394169
FT                   /locus_tag="GBP346_A0442"
FT   CDS_pept        393909..394169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98924"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPF5"
FT                   /protein_id="ACQ98924.1"
FT                   /translation="MLVTTVRFGLLKNDSLAPARAFPPIPNSDRLIPDAQWRAKRGPAA
FT                   FAHAGARFACLAYFMRVARRLHPMRFRHVSSERTIPCFLPR"
FT   gene            complement(394124..395125)
FT                   /locus_tag="GBP346_A0441"
FT   CDS_pept        complement(394124..395125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0441"
FT                   /product="fatty acid desaturase family protein"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96898"
FT                   /db_xref="GOA:C4KPF6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPF6"
FT                   /protein_id="ACQ96898.1"
FT                   /translation="MNYRKKYATEAHALSAIRPWRCAWVIARQWIGIAIAFALPIALVA
FT                   RLTGGTSLAHAFAALGAPQRLGVAAALGAAYVYLACKQHALGIVMHDATHFRLFESRRV
FT                   NELVGNWLCAFPIGMVTSCYRRSHLPHHLFTNKPNDPYWARLVEDAHYAFPMSRAAFGR
FT                   ILLGDVFGANLRAWWPTLRSWTGWSSVLDNREKLLTPSERRQFVAFWIGALALAAYFGV
FT                   LSYFLLLWVLPMFTLSLAFIRLRVIAEHNLEKAGHELERTRHVDGGWFERLAIAPLNIN
FT                   YHVAHHLFPSVPLYNLPKMHALLMQEPAFREHAQLWRSYLGRKHGMVRSLLT"
FT   gene            complement(395201..396553)
FT                   /locus_tag="GBP346_A0443"
FT   CDS_pept        complement(395201..396553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0443"
FT                   /product="diaminobutyrate--2-oxoglutarate transaminase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00202; match to protein family HMM TIGR00709"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98184"
FT                   /db_xref="GOA:C4KPF7"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPF7"
FT                   /protein_id="ACQ98184.1"
FT                   /translation="MQDVDPAYAFVRARESGARTYADTFDTVFAHGAGTVLTDTAGRRY
FT                   LDFLSCAGTLATGHNHPAVVERVRAFVDSGQAMQMLDMTTPVKHRFVERLFGILPPALA
FT                   RHARVQFCGPSGADAIEAAIKLFKTATGRRSVIAFHGGYHGMTAGALALTGNLRAKHAV
FT                   ASLMPDVHVMPYPYAYRCPFGLGAPHTAAASLHYIESMLSDPESGIAKPACVIVEAVQG
FT                   EGGVIPAPPEWLAGLRALTARLDIALVIDEVQTGIGRTGAMFAFEHSGIRPDAVVLSKA
FT                   IGGGFPLALVAYDERYDVWQAGAHAGTFRGNQIAMAAGVACLDVIESEGLIAGAAAKEA
FT                   HVRARLERLAARHPEIGDVRGRGLMWGIELVDPDAAPDAAGARPAAPALARALKRYCFA
FT                   HGLIVETGGRHGAVVRLLPPLTVSAAELDLAFDTLDAGLAALGEHARAEFA"
FT   gene            complement(396598..397131)
FT                   /locus_tag="GBP346_A0444"
FT   CDS_pept        complement(396598..397131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97677"
FT                   /db_xref="GOA:C4KPF8"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPF8"
FT                   /protein_id="ACQ97677.1"
FT                   /translation="MPDLILAYLRNAALFAPAIAFMLFMRALPGGGDAHWRHAALAGAL
FT                   LALPHTAWLLRRRPLHGTALGLNAYLIVSAALPFVSADAARDWGAALGSAAMLGSVLAA
FT                   HALGLAVAPEAFSGAADPALARARCRKMTVYSGIALAAAFPHRHDPLLGGALPVVALIL
FT                   LHKRLRRGALAPSA"
FT   gene            complement(397206..398297)
FT                   /locus_tag="GBP346_A0445"
FT   CDS_pept        complement(397206..398297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0445"
FT                   /product="ABC-2 type transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98031"
FT                   /db_xref="GOA:C4KPF9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPF9"
FT                   /protein_id="ACQ98031.1"
FT                   /translation="MLEVFLILTRNELLGQLRSKARLFWTFVFPILLMSVMLVAFGKHS
FT                   SLGVVELAFDGNAAAPQARACRAAIEAAFAGNGTVGARVVAPNAAGAAGGDRVRVSWPA
FT                   RAADPVRVSYDFNGPLAARAAARTIEIALVRCAASEAGLPAAYQVRFENDGHALAPLDY
FT                   GEFFATGILIMAFMSIGVVSTATTIATLRERNTFKMYVCFPVSRFVFLASLIVSRVILM
FT                   LAASVTLMLAARYLFQVPLPLWSLRALRAIPVVLLGAAMLLSLGTLLASRARSLAAAEA
FT                   WCNLIYFPLLFFSDLTIPLRAAPHWLRVVLLVLPTNQFAVALRGVFVRDLGYAQAAWPL
FT                   AVVAGWTLVFLAGAALTFRWHQD"
FT   gene            complement(398290..399333)
FT                   /locus_tag="GBP346_A0446"
FT   CDS_pept        complement(398290..399333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0446"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97089"
FT                   /db_xref="GOA:C4KPG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPG0"
FT                   /protein_id="ACQ97089.1"
FT                   /translation="MSPVPFPAGEAGEALEGAQTAEAVEAAEAMEGGAAVARGATPGRA
FT                   ASALAARRIDVKAGDFTFHATDIAFRTGALTAIVGPNGSGKSTLLEALFGFRRAQLEGA
FT                   TILGVPAARFMRDTRALRRFGAQLQRVEYAEHARVDEILAVHRALYRKQDAAVARALAI
FT                   DELRAKPYSGLSKGQRQRLDLFIAFAHRPALVALDEPFTGLDRTMTRSVLGLLRGPLAG
FT                   ITIAMICHAGEELAIADDVLWVRDGTLRYQGGKDALKRRLVGEFRALIHVDDDAQAERV
FT                   REVLARDAHVQRIVAPAPRQIGAFGRAGLDAALRTLMEQAGIRHFEFAPTDEGDLLRAC
FT                   TEGATDA"
FT   gene            complement(399339..400406)
FT                   /locus_tag="GBP346_A0447"
FT   CDS_pept        complement(399339..400406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0447"
FT                   /product="taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="identified by match to protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96373"
FT                   /db_xref="GOA:C4KPG1"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPG1"
FT                   /protein_id="ACQ96373.1"
FT                   /translation="MSEIRDSITFQNAAALKAQARLGPGVICGLRSERAPLPLVVSPHG
FT                   DSALAADRDAALAWFDARRAAFDALLLEHGGLLLRGFAVPDTHAFRALTDRYPPHAFGY
FT                   IAGASPRKAIDGNVYESTHLPAPYKLSLHQEKAYMSHYPRLIAFYCRQAAAVGGETPLS
FT                   DMRAVTRRLPARTLERFRGKGVMYRRNFSAKPMPAHFNQFYRRWQDAFMTDERAEVESL
FT                   CRATQLEYEWLPDGSLTVTHVGPATVVHPRTGEEVWFNHASTQHINARVVHPTILRALQ
FT                   SFYKTRAALPYDIRYGDGTPMPAEDLDPVYDAIDAEETAFRWREQDVLLLDNILVAHGR
FT                   NPYSGQRDIQVAMMD"
FT   gene            complement(400403..401068)
FT                   /locus_tag="GBP346_A0448"
FT   CDS_pept        complement(400403..401068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0448"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95736"
FT                   /db_xref="GOA:C4KPG2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPG2"
FT                   /protein_id="ACQ95736.1"
FT                   /translation="MLLKNLRPADDYDRFANEALAPWDALFIARIRELARALPPGTLAD
FT                   IGTATAVVPVRLAADPAMAQWRFVGVDLDPAMLDEGVPRIARLGLAGRVALKVGDALAL
FT                   PFDDASLSMVVSRATLHHLPDKALSLAEMFRVLRPGGVGVVHDMRRDAPPALLERFTQM
FT                   RAAANYPPTHLEEKVTLDEARELVAAAGLAEHASVTSPPFGLGALGFEILLTKPGEPS"
FT   gene            complement(401108..402259)
FT                   /locus_tag="GBP346_A0449"
FT   CDS_pept        complement(401108..402259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0449"
FT                   /product="citrate synthase-related protein"
FT                   /note="identified by match to protein family HMM PF00285"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95138"
FT                   /db_xref="GOA:C4KPG3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPG3"
FT                   /protein_id="ACQ95138.1"
FT                   /translation="MGLATELLNRPATRYRGTDIDGAILEPEGLWVRGRNLNDLIGTVS
FT                   FEDALWHLWFERMPTPAEGAALRARLAQYGAHFAHGNPSTRAAAAVAQTGVDMVFAAAT
FT                   GLLRDIERPPFDAGEAPGWGADFDTLLGCLAGAPYLMRAALGAPRVDDPGTSHAARVLR
FT                   AAGASGGGSPHAERVIDALLVAWHGGFGYVTPTVLVPRCAIGTGVSLSQAIAAGFMSSG
FT                   PNHVGAARSAMQWLRALARRLDDEPDALDAVVRRAIGRVLDESGALLAGFGHPLFEADP
FT                   RPPRIRALFAEWGFGGRHVDMFDVACDEARKRKNLKPNIDFATGAALLDLGFTEPQWGI
FT                   GVGLSARIAAMAAHAVERRRRPAFGANSATARRMLAAVPVGWL"
FT   gene            complement(402261..404132)
FT                   /locus_tag="GBP346_A0450"
FT   CDS_pept        complement(402261..404132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0450"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97258"
FT                   /db_xref="GOA:C4KPG4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPG4"
FT                   /protein_id="ACQ97258.1"
FT                   /translation="MSAYQVSLRELRFFLWELCDAEAAFLSHAPYRTHDRAYYDRLLER
FT                   ARDFALEIGESYRASDIESCSLRDDGTVRIPADFHALWPRFRDEWAGLLFDRHSAEAGD
FT                   APHADVPMVVKQAVFEMLMGANPSFMTYGGFTHPACKLLTLHGTPEQKALRGPLLRYDW
FT                   DACFCATEPQAGSDMTAVRTVATPLGDGVYAVTGEKVYISAGMHDLTENTLYFVLGRIG
FT                   STAPDSFSLSCLIVPRFWRDDATGKLESNHVECVALPRKMGLNGCANAHLVFGRSGTTR
FT                   AHLLGNRRNVGLLQLVPLMNQARMGTGLFGIGVASSAYLQSVSYACRRVQGRPIDAASD
FT                   TAAPRVRIVEHGDVQRMLVDMKARVEGCRGLLGKLTAAATRATILEATPGADPADIERA
FT                   RKLQLLLTPICKAFISDQAWRVCETAIQVHGGVGYTDASPVEQNARDVKILSIWEGTNY
FT                   IQAQDLVREKLGFGRKPLLLRYFRDALDASLARIEPTAPATFAPWFAQLRGAADALARA
FT                   LESIARAVRDGHMHASSQVYTRFLEMFGLVACAWALLEAACIAERRLATREVAAEPAEA
FT                   AFYRGKVKAARYCFANLLPLAAQHAAAIDALPDIACAITAEELAEVE"
FT   gene            complement(404129..405169)
FT                   /locus_tag="GBP346_A0451"
FT   CDS_pept        complement(404129..405169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0451"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /note="identified by match to protein family HMM PF08541"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99025"
FT                   /db_xref="GOA:C4KPG5"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPG5"
FT                   /protein_id="ACQ99025.1"
FT                   /translation="MLTIHHTAIRQPSRQSVDAAQASGRYRYDGRLAPHAIRFAMPYER
FT                   LDYDTHTFAHLARPAPASLPVETRGRTLSDLALEAVRDVVGAAGPGACASISQIVVAQA
FT                   SLNEHAGESVAGRMQHALGLKHIVPFALGQCGTLGLHAALPLAHGLLRDGGRMLFVAAD
FT                   KWVYPFLRTYGEFVAYGDGAAAILLGHAETDAEADAAQARVLGHALAHGEPIADPWARQ
FT                   PAELERALVAPTVDAARAALADAGVGAARIDCFAPGGFSASFRTTLARALAIPPSRLQV
FT                   RDGVEHLSTADTPRALAQAQASLAPGERRLALFCDTALAGGAGALVAQLRGAHASSSST
FT                   RTRYPS"
FT   gene            complement(405187..406755)
FT                   /locus_tag="GBP346_A0452"
FT   CDS_pept        complement(405187..406755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0452"
FT                   /product="acyl-CoA ligase (AMP-forming), exosortase system
FT                   type 1 associated"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR03098"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98828"
FT                   /db_xref="GOA:C4KPG6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR017529"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPG6"
FT                   /protein_id="ACQ98828.1"
FT                   /translation="MNPHIRLADLLDSAAAQRPDGIAIAEPRRRVRYAQLAADVRRAAA
FT                   ALAAAGIAPGERVATYAPKAYETIVTMLAANLAGAIVVPINPQLRDHQVRHILADSGAR
FT                   LLLTTAPRLARLAERPAGLVTWLVEDVAALAGAGDDVRDAGRAHAVDSDPAALLYTSGS
FT                   TGQPKGVVLSQRNLTAGADSVAAYQRLSHDDVILGALPLSFDAGLSQLTSALAAQACYA
FT                   PLDFLRAEEVPAWCAQVGVTSITGVPPLWMQLAAVAWPDAARLPVRRIANTGGTMPQPL
FT                   LHRLRQIFPNAAPYLMYGLTEAFRSTYLPPEEAAARPGSIGKAVPNAQILVLRADGSEC
FT                   DAGEPGELVHRGAFVTLGYWNAPELTAQRFRALPHARHPVPLADVAVWSGDIVTRDDEG
FT                   FLYFVSRADEMIKTSGYRVSPTEIEDILFECPQTLEAVAFGVPHPALGQAVVACVYGGG
FT                   DPASCRQALLDACRARLPSYMVPQHIEIAGAPLPRNPNGKIDRPLLKRAHLSRFEAEPR
FT                   AAALG"
FT   gene            complement(406763..407959)
FT                   /locus_tag="GBP346_A0453"
FT   CDS_pept        complement(406763..407959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0453"
FT                   /product="pyridoxal-dependent decarboxylase family protein"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF02784"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98234"
FT                   /db_xref="GOA:C4KPG7"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPG7"
FT                   /protein_id="ACQ98234.1"
FT                   /translation="MNTDTIGSAPHAAADAGNAEWLDGLDTPCYVFDPQCVLAGYAALR
FT                   AALGTRLVVSLKANSHADLFLRCAHAFEDGIELASQGELDTVVGRGKHVKYLNNPAMGD
FT                   ALMRAGIASRCHFILDGPDMVRRFIALASGKETEDVMLRINAGALLGAHAPKSLRDHFG
FT                   MTPAEALGMANLLTQAGRRVAGLHAFVGSGNFRAGPTKGGDADSADLAWALAQLAEQIE
FT                   ALVRAPVTHLNLGGGFSEKGHDDATFERYRARIAPLAKRYTLVHEAGRAIFANAGVFVT
FT                   RVRAVKVWDDRVIAVCDGGMSHNFLLAKTEAVLKTWEAPTLVPAGAADAHRAPNARPIT
FT                   FVGNTCNRADVIGRLERHPRLPQPGDFVVFSQCGAYHHSYTVSGFLSHKPAQVYIRQA"
FT   gene            complement(407949..408947)
FT                   /locus_tag="GBP346_A0454"
FT   CDS_pept        complement(407949..408947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96009"
FT                   /db_xref="GOA:C4KPG8"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPG8"
FT                   /protein_id="ACQ96009.1"
FT                   /translation="MRPDQANHWIGIDAAAYELPDAAIEIGAWAARHAWPRAQVDAILE
FT                   SGCRFFHAAPQTSEVELASRAIGALVDSTGIAPSSIDLMVHVHTQTFSMPAPPRSLLYE
FT                   VAHAHGIRPLWSGSIAQLNCASIAAAIRMIDALFYAYPQAQSALVVSADRAYDEATRLR
FT                   QFSGIQGDGAGCLLVTRNSRRNRVGGVALHNHAAWYPGSDSANAVERAMISTEWLHTHR
FT                   IVDAACALTGRPIAHYERILPINTDLRGWHALCRALRVPAERLFGANVARCGHVCCSDF
FT                   AINLADDGLAALDAGRHVMGVMQSNVGAFAAVALHPLEAASSSTPAEAYEH"
FT   gene            complement(408952..409935)
FT                   /locus_tag="GBP346_A0455"
FT   CDS_pept        complement(408952..409935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95397"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPG9"
FT                   /protein_id="ACQ95397.1"
FT                   /translation="MQPYEDAARSQRWSMPVDALMMGDYEYRETALTNLYHKAKAAQWD
FT                   VNRDIDWNVTLDPDNPLGMPDGMLLVFGTDLWHKLGAAERAEMRHHWQGWLLSQILHGE
FT                   QAALICASKLASAEQSLPARLCAAAQIMDEARHVEAYAKLVNEKISVRYPMSRSLEGLL
FT                   KDTVTSSALDITNLGMQVLVEGIALSTFQTVVAFSADPFVKDLFARIQRDEARHFAVGR
FT                   LTLARVYSDMTSAEMKEREEFVSEGASVLYEHLCADDIWEPLGYSKQACAQMVRESEVS
FT                   RALRRSIFRRLVPTIREIGLLTPRVRRTFEQLDVIDYEDMPLALDM"
FT   gene            complement(409954..410520)
FT                   /locus_tag="GBP346_A0456"
FT   CDS_pept        complement(409954..410520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97533"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPH0"
FT                   /protein_id="ACQ97533.1"
FT                   /translation="MTPFALRRYRLERAPRTPVLVRASSYGIPAATTDDYARLAAYQPD
FT                   STAPVLLDHAQYVRFMSELVDALWQALGAETRVFVRFRMPYNGALPANLLDPRVLIGSG
FT                   LDTQMAFWSRVEAQPGIGIVDRIRRDLDYPGDNTLAFACASERRLDALEAALLRDWPRY
FT                   AIRLARAADAADAAGQPARPPARFA"
FT   gene            complement(410517..411404)
FT                   /locus_tag="GBP346_A0457"
FT   CDS_pept        complement(410517..411404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96974"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPH1"
FT                   /protein_id="ACQ96974.1"
FT                   /translation="MIELAPIPEPAATALGAARLQLRALAYRRVAAAAGGVGELLEAAA
FT                   QLGRLLGREALACAGAAAGHAPIDDYVVCSTILSGLLMDDSPHHAAFVGAIASHGPRAA
FT                   DWLTHGYECASWGYVLRETLGKAMHTGTRRLLLQIVDVDIHRFSYWLSHPQWGASGFGV
FT                   CTLALDVAPGADWPLHLGAAPPAHALAMLGRGFAAFGRERAGVPVAPPFFKEASRRALL
FT                   KCLGDAPVHPDGHARFGHAFGSDPWISLLLHRCAPGAPAAARAIVGSLALNGYFAIAEI
FT                   GYDAAARFRLDDTA"
FT   gene            complement(411437..411685)
FT                   /locus_tag="GBP346_A0458"
FT   CDS_pept        complement(411437..411685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0458"
FT                   /product="phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98441"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPH2"
FT                   /protein_id="ACQ98441.1"
FT                   /translation="MSTPAAETLPLLAREVAKILHVETVETNVGIGELGIDSLNIVELI
FT                   VFCEQLYGSIDPETLNITQYTTLAQLDAELRAPQTAA"
FT   gene            complement(411741..412859)
FT                   /locus_tag="GBP346_A0459"
FT   CDS_pept        complement(411741..412859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97349"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPH3"
FT                   /protein_id="ACQ97349.1"
FT                   /translation="MMPDTALPDTPDTPDTPARTFPAAAHADAADLPTLAAQPVRERLA
FT                   AFGAPPAALDALLRAGATRLLDSDMIIAQPRAHAAARAAERATTPLRYEQSAQTEAVLE
FT                   QIAHEGLAPHFKPFMRGFSHVMSALFLTPEQDAKVQAYRAAGHHLRFLMSDGGGPALAG
FT                   WRSTVRVEHGRTRLAIDKVWGIEAHRESIGLVAVRAPGAFMPAAYLVWPEQYRTLERAA
FT                   CGEPFLEGGLQLGNVRGEIETTPEDRLRIGGPNVFNKYLTIVRPYFVRALMAHVGWLAR
FT                   EGRLALSPAHESVRRFVADAARAQSRSSVYGADVVQRVLALKFAANELLGDLVRGGAVR
FT                   RFDDQRDLLALSKMEGSAYRCYYEIRMGTKRA"
FT   gene            complement(412939..414705)
FT                   /locus_tag="GBP346_A0460"
FT   CDS_pept        complement(412939..414705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0460"
FT                   /product="AMP-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95104"
FT                   /db_xref="GOA:C4KPH4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPH4"
FT                   /protein_id="ACQ95104.1"
FT                   /translation="MRDSSPLIERLLAPLAEGRNCRAHGVGTLDESGIERVLSYRQLSE
FT                   AGLRMSAALNALGARAGDLALVALPATGDYLALLVGCVLSGVVPCTVPPPLKRASGSGP
FT                   QVLEVACRLYRPRFVFTASAHVAELEAQLRDTGARVIDVGILHAASTGAEPRLALRGAG
FT                   DTHHIQLTSGSTSHPKAAVISHRNVAANIAGIANACGYSKHAADNTVIWLPLHHDMGLV
FT                   SLLLHLYYRTSLRLMPSMSFVRNPLGWLRRIAHARSTIAVAPTFALRYCVRRFNAATMD
FT                   GADFSHLRTFLVGAERVDRATLSDFASTFAPYGFHASALQPCYGMAEATLAVTLHRSFD
FT                   TPNAPAFTHVIADRIDTATLARHRRAAPAPDGHTGATDTLLAVGAPLDDMAYEIRDAQG
FT                   RLAAEREAGEIFIRGASVMQGYLPSAGAPAPQPFDAHGWFATGDIGYVSGGQLFILGRK
FT                   KEIIIIRGTNYFPHEIEETIDSHPAVYKGACIAVGIHDETQGTENLVVLVEAHANHVSR
FT                   DSRAELQARMQQRLGYCAQRIAFVEPGALPRTTSGKPQRLKARAMFVSGELREIALPPS
FT                   RRADADRVAPYP"
FT   gene            415139..416062
FT                   /locus_tag="GBP346_A0461"
FT   CDS_pept        415139..416062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0461"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98810"
FT                   /db_xref="GOA:C4KPH5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPH5"
FT                   /protein_id="ACQ98810.1"
FT                   /translation="MIDLRRLRYFIVVAEELHFGKAAQRLHLAQPPLTRHISALEGELG
FT                   LRLFDRSTRSVKLTAEGELFLPHARDVLDAVHRAEIASQRAALGKEGKVALGYTSSVPL
FT                   CDAFGTLIRNFARSFPDIELSLVEASSAQQGRSIKEGLLDIGIGWKNSFEDYEGCRVKT
FT                   IAAEPLVVAVSQERALASEASLAVEQLADETFVLFPPGYGSTLDRKAFDLCATAGFTPR
FT                   RGPSASQMTTMIALVAAGRGVAIVPEAVSTLRKPGVAYVPLTDESALIELVLMWREAGL
FT                   SLAARSFVEWHKAHVAQRVDGMVGVG"
FT   gene            416805..417539
FT                   /locus_tag="GBP346_A0462"
FT   CDS_pept        416805..417539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0462"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98331"
FT                   /db_xref="GOA:C4KPH6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPH6"
FT                   /protein_id="ACQ98331.1"
FT                   /translation="MDIGWSTLAPDARSDTPLYLQLARNLAGAIHGGAWRAGEALPSER
FT                   GLSAAAGVSRITARRALALLVEQGLIRRVRGAGSFITPRVADPLSRLVGFTAKMRQRGF
FT                   APDSVWLARSLRAASRDELARFGLSPGATVARLERLRRADGVVMAYERSTLPANCVPEP
FT                   QVLEGSLYGYLQSRGLDVVRASQRFRAVNASADVAQWLGLAPGAALLVITRIGYGADRR
FT                   AIEATETYCRDDYYDFVAELKR"
FT   gene            417638..418741
FT                   /gene="nagA"
FT                   /locus_tag="GBP346_A0463"
FT   CDS_pept        417638..418741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="GBP346_A0463"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR00221"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95857"
FT                   /db_xref="GOA:C4KPH7"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPH7"
FT                   /protein_id="ACQ95857.1"
FT                   /translation="MLTGNILTAEGWIHGTLEFENGRITTLSGDAADPSNNDAPYILPG
FT                   FIDLHVHGAGGADVMEGGDAIETIARTHARYGTTSLLATTMTAPRDELMRVVAELGDVA
FT                   RTRTPGGSRVLGVHLEGPYINPGKLGAQPDAAVSAALDEVLKYLSIAPIRVVTLAPEIA
FT                   GHIEIISEMAARGVRVQLGHSLGTYDDAVAALKHGACGFTHLFNAMSPLHHRNPGIVGA
FT                   ALAHAEYAEIIPDLLHVHPGAIRAALRAIPRLYVVTDSTSATGMPDGEYRLGSQRVTKC
FT                   LGGVRLADGTLAGSTLTMDQALRNLVSLGLPIADVSSRMSRYAADYLGLADRGRIARGA
FT                   WADLAVFDRELNLTATFVEGESIVEYA"
FT   gene            418725..419741
FT                   /locus_tag="GBP346_A0464"
FT   CDS_pept        418725..419741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0464"
FT                   /product="SIS domain protein"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97172"
FT                   /db_xref="GOA:C4KPH8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPH8"
FT                   /protein_id="ACQ97172.1"
FT                   /translation="MSNMLNEARESARVVAAQLADTRRVEALAQHLATHAPQVALTVAR
FT                   GSSDHAASYFASLTMSRLGVPVASLPMSVATLQQAPLKVRGQLALAFSQSGKSPDLVNT
FT                   MAALREAGALTVAAVNVLPSPLAHACEHPLPLLAGPELSVAATKSYIAMLSIAAQLVAF
FT                   WQRDAALASALRGLPDALEQAGRLDWSSAVDELRDVERMIVIGRGLGLAIAQEAALKLK
FT                   ETSGIQAEAFSSAEVRHGPMELIERDYPLLVFAPPGPEQESLLQLARDMRARGARVLLA
FT                   APAGTPDATLPLARTAHAALDPIAAILTFYVMAAGLAPARGRDPDAPRHLHKITETH"
FT   gene            419799..422387
FT                   /locus_tag="GBP346_A0465"
FT   CDS_pept        419799..422387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0465"
FT                   /product="pts system, glucose-glucoside (glc) family
FT                   eiia/phosphocarrier hpr/phosphoenolpyruvate-protein
FT                   phosphotransferase component"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00381; match to protein
FT                   family HMM PF00391; match to protein family HMM PF02896;
FT                   match to protein family HMM PF05524; match to protein
FT                   family HMM TIGR00830; match to protein family HMM
FT                   TIGR01003; match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98917"
FT                   /db_xref="GOA:C4KPH9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPH9"
FT                   /protein_id="ACQ98917.1"
FT                   /translation="MKQQASHDQIVLVAPLTGPVVPLADVPDPVFSGGMFGDGIGIDPL
FT                   EGRLLAPCAGVVSHVARTGHAVTIAADGGAEILLHIGIDTVELNGLGFTAKIAEGARVA
FT                   AGDLLIEFDQDAIARAAHSLVSVIAIANSDAFEVVERAGAGVVKAGETPLLALRARGAG
FT                   ASVGTSASAGAAADASCAQPAAEARKSITLTQPGGLHARPAARAREAARGLDAHVDVHF
FT                   EGRKAALQSVVGLLGLGAGEHATIELVATGRDAAKALERVAHELLREAHGEAEEKPARI
FT                   VSPAPAAAGIARAPLEPNTLAGVCAAPGIAVGTLVRWDDAQIVPPELASGTPAAESRLL
FT                   DRALAEVDAQLETTVREASRRGAIGEAGIFAVHRVLLEDPALVDAARDLISLGKSAGYA
FT                   WRETIRAQTAVLADVDDTLLAERAADLRDIDKRVLRALGYASASARELPAEAVLAAEEF
FT                   TPSDLASLDRERVAALVMARGGATSHAAIIARQLGIPALVAVGDALYAIAQRTQVVVDA
FT                   SAGRLEYAPSALDVERARHERQRLAGVREANRRMSGEAALTRDGHRIEVAANIATLDDA
FT                   RVALDNGADAVGLLRTELMFIHRQAAPTASEHQQSYQSIVDALQGRTAIIRTLDVGADK
FT                   EVDYLTLPPEPNPALGLRGIRLAQVRPDLLDDQLRGLLAVKPYGSVRILLPMVTDVGEL
FT                   VRIRKRIDDFARAMGRAQAVEVGVMIEVPSAALLADQLAQHADFLSIGTNDLTQYTLAM
FT                   DRCQADLAAQADGLHPAVLRLVDATVRGAEKHGKWVGVCGALGGDPVAVPVLVGLGVTE
FT                   LSVDPVSVPGIKAQVRRLDYQLCRQRAQDLLALESAQAVRAASREIWPAE"
FT   gene            422500..424260
FT                   /gene="nagE"
FT                   /locus_tag="GBP346_A0466"
FT   CDS_pept        422500..424260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="GBP346_A0466"
FT                   /product="pts system, N-acetylglucosamine-specific iibc
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR01998"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97030"
FT                   /db_xref="GOA:C4KPI0"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPI0"
FT                   /protein_id="ACQ97030.1"
FT                   /translation="MDGNPFLKIQSLGRALMLPIAVLPVAGILLRLGQQDVLNIKMIAD
FT                   AGGAIFENLPLLFAIGVAVGFAKDNNGVAALAGAIGYLIEVAIMKDIDPKLNMGVLSGI
FT                   IAGVVAGLLYNRYKDIKLPDYLAFFGGKRFVPIITGLACVVLGIVFGYVWQPVQHAIDA
FT                   VGQWLLTAGAIGTFVYGFLNRLLLVTGLHHIINSLVWFVFGTFTPAGGAAVTGDLHRFF
FT                   AGDPSAGGFMAGFFPIMMFGLPAACLAMFHEAPKARRAIVGGLLFSMALTSFLTGVTEP
FT                   IEFSFMFLAPVLYVIHAVLTGLSLAICQLLGVKLGFTFSAGAIDYVLNYGLSTKGWIAI
FT                   PLGLAYGLAYYGLFRFFIRKFNMATPGREPAGADAQAQSFASGGFVAPTAGASVPRAQR
FT                   YIAALGGAANLSVVDACTTRLRLSVVDPEKVSEADLRTIGARGVLKRGGSSVQVIIGPE
FT                   ADLIADEIRATLGSGAAAPEAAAAAAPAAAATAAGAQSGPLDPEPTRWLAVFGGATNVA
FT                   SLDAVAATRLRVVVRDPSAVDRQRLATLDVAWVASDTFHIVCGQSAPRYAQQLAARLPS
FT                   SDGGTAAQPA"
FT   gene            complement(424946..427447)
FT                   /locus_tag="GBP346_A0467"
FT   CDS_pept        complement(424946..427447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0467"
FT                   /product="chitobiase"
FT                   /EC_number="3.2.1.52"
FT                   /note="identified by match to protein family HMM PF00728;
FT                   match to protein family HMM PF03173"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97724"
FT                   /db_xref="GOA:C4KPI1"
FT                   /db_xref="InterPro:IPR004866"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPI1"
FT                   /protein_id="ACQ97724.1"
FT                   /translation="MNRISHSLCAALLAAATLLPTASRAQLPARPTAGAAAPATAAPVR
FT                   PASTPAELAARLANGLAVRVAVDNNHAASAGVPCADLGADWASCATGRLILQNRGHSPL
FT                   TDGGWKLYLHSIRRLLRIDRPGFTLRHLTGDLYELTPQPGTVRLAQGERIELPFVAEYW
FT                   LRRYSDVIPRPYVVVDGAAPAVLRYDDTDDELRYVETLPADAQNNSPGNAPPAAAQPVA
FT                   NRALPSVKRQRALPGALDLRGVELTLPELPSAQVAALRERAGTLGLDGARVPVWGVVAP
FT                   RRLPADIAVPGGYRLAIGPRGAFIEGADRAGLYYGVQTLFSLVPAGGATVPAMLIEDAP
FT                   RFTHRGMHVDLARNFKPPATLRQLIDQMSAYKLNRLHLHLSDDEGWRIEIPGLPELTDV
FT                   GARRCHDPSETRCLLPQLGSGPDDRSGGGYLTRDDYVALLRYAAERFVEVIPEIDMPAH
FT                   SRAAVVSMEARYRRLHAAGREREANAYRLLDAQDTSNLLTVQFYDRRSDLNPCMPGALN
FT                   FASKVIREIASMHADAQAPLRIWHFGGDEAKNILLGAGFQPLDGADPGKGRVDLAAQDK
FT                   PWARSPACTALLRRGEIKSIDELPTRFAKQVSAIVNANGIGTMAAWQDGIKHASGPREF
FT                   STRHVMVSLWDTIFWGASDSARDLSAKGYRTVLALPDYLYFDFPYTRNPRERGYYWGSQ
FT                   ATDEYKVFSLAPENLPQNAEVFGDRDGNPFEVTSAGAAPSIEGIQGQAWGEVMRNGQLL
FT                   EYMVYPRLLALAERAWHKADWELPYAAGVRYKLGDTHHVDTAALERDWAGFATVLKQRE
FT                   LPKLERAGIGYRKPTFTLTGE"
FT   gene            complement(427658..427918)
FT                   /locus_tag="GBP346_A0468"
FT   CDS_pept        complement(427658..427918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95813"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPI2"
FT                   /protein_id="ACQ95813.1"
FT                   /translation="MIGAGRSPATGAAHPARRAVRNTPRAAMHADTPAATRAEIPIETP
FT                   IDMSAAAPADIRFDARRAAAPKASNAITTAVAPATAARRRR"
FT   gene            complement(428162..428338)
FT                   /locus_tag="GBP346_A0469"
FT   CDS_pept        complement(428162..428338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0469"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95481"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPI3"
FT                   /protein_id="ACQ95481.1"
FT                   /translation="MTHRSPHAHPGFAGVKRARLRLRAFPFDIAAHASPRAALASRFNP
FT                   AFFERTDANSIPN"
FT   gene            complement(428335..428757)
FT                   /locus_tag="GBP346_A0470"
FT   CDS_pept        complement(428335..428757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95564"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPI4"
FT                   /protein_id="ACQ95564.1"
FT                   /translation="MSCLTRDAMRREAAAERAGSRRAFVPDTAPAFRGGFYLMRHGFPR
FT                   SGRSRSDFDAGGRSRASRRARYVEIREAPLALPDACAHVAARRASAARFGRRRFLPGWR
FT                   SPRRDALAPGHIALGQPFRSAGARCVRPRPGFHPLP"
FT   gene            complement(428785..428955)
FT                   /locus_tag="GBP346_A0471"
FT   CDS_pept        complement(428785..428955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0471"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF08173;
FT                   match to protein family HMM TIGR02106"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95225"
FT                   /db_xref="GOA:C4KPI5"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPI5"
FT                   /protein_id="ACQ95225.1"
FT                   /translation="MRRIARPAFRAIFARFCKFRRSRIMWYFSWILGIGVALAFGIINA
FT                   MWLEARQKRDA"
FT   gene            complement(428974..430110)
FT                   /gene="cydB_1"
FT                   /locus_tag="GBP346_A0472"
FT   CDS_pept        complement(428974..430110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB_1"
FT                   /locus_tag="GBP346_A0472"
FT                   /product="cytochrome D ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF02322;
FT                   match to protein family HMM TIGR00203"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95690"
FT                   /db_xref="GOA:C4KPI6"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPI6"
FT                   /protein_id="ACQ95690.1"
FT                   /translation="MDYATLKVIWWLLVGILLIGFALTDGFDMGVAALLPFLGKTDDER
FT                   RIIVNTVGATWEGNQVWLITAGGAMFAAWPLVYAASFSGFYFAMLLVLFALFFRPVGFD
FT                   YRSKRDDPRWRTSWDWALFAGGFVPALVFGVAFGNLLQGVPFAFDTDMRVTYHGSFWAL
FT                   LNPFALLCGLVSLTMLVAHGAAFVKMKTDGAIAKRASIALRVSSLVAVVLFVLAGALIA
FT                   SFIGGFQITQAAPLDTVANPLLKQASAAPGLWLVNYGLYPWMIAAPAVGIAGGVLAMLL
FT                   AGSKREKTAFICTGLMITGVILTAGFSMFPFIMPSSLDPKSSLTVWDSTSSQLTLEVML
FT                   VAVIVFLPIVLLYTGWVYRVLRGKVTPRVLDENRHSMY"
FT   gene            complement(430148..431743)
FT                   /gene="cydA"
FT                   /locus_tag="GBP346_A0473"
FT   CDS_pept        complement(430148..431743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="GBP346_A0473"
FT                   /product="cytochrome D ubiquinol oxidase, subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95240"
FT                   /db_xref="GOA:C4KPI7"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPI7"
FT                   /protein_id="ACQ95240.1"
FT                   /translation="MISSEVVDLSRLQFGITALYHFLFVPLTLGMSWLLVIMEAVYVMT
FT                   GKQVYKDMTQFWGKLFGINFAMGVTTGITLEFQFGTNWSYYSHYVGDIFGVPLAVEGLM
FT                   AFFLESTFVGLFFFGWNRLSKVQHLVVTFLVALGSNLSALWILVANGWMNNPVGAEFNY
FT                   QTMRMELANLFDVLFNPVAQVKFVHTVSAGYVTAAMFVLGVSAWYLLKKRDVDFALRSF
FT                   AIAAGFGLASTLCVIVLGDESGYTTGEVQKMKLAAIESEWETQPAPASFTLIGLPNQEA
FT                   ERTDYAIKIPYALGLIATRSVSEPVIGLRELAKRSEEHIQSGMIAYGALQKLKAGDTSA
FT                   ETKATFDQHKQYLGYGLMLKQFTQNVTDATPDQIKAAAKQTIPPVAPVFFSFRIMVFLG
FT                   FLFLATFIAAFWFCARRQLLQDNRRWFLRYAVWAIPLPWLAAEFGWVVAEVGRQPWTIA
FT                   GILPTHLSASSLMATDLYLSLAGFIVFYTALFIIEITLMFKYARLGPSSLHTGRYHHEQ
FT                   AGRPLEKAVAGTAA"
FT   gene            complement(431733..432017)
FT                   /locus_tag="GBP346_A0474"
FT   CDS_pept        complement(431733..432017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96787"
FT                   /db_xref="GOA:C4KPI8"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPI8"
FT                   /protein_id="ACQ96787.1"
FT                   /translation="MALTLINKKASPDGTPPARPAGWRDRAAAWARGPTLARDISIVLA
FT                   FKLVLLIALKYAFFNHPQAAHMSLPPAVVAAQLLSATPSAPTEGDRHDK"
FT   gene            complement(432496..433431)
FT                   /gene="rpoH"
FT                   /locus_tag="GBP346_A0475"
FT   CDS_pept        complement(432496..433431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="GBP346_A0475"
FT                   /product="alternative sigma factor RpoH"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM TIGR02392; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96064"
FT                   /db_xref="GOA:C4KPI9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPI9"
FT                   /protein_id="ACQ96064.1"
FT                   /translation="MSNALTLPNTLRPASAKAVSAGSLTLASHSMLPGHLGNIDAYIQA
FT                   VNRIPLLSAEEERQYATEYREQNNLDAARRLVLSHLRLVVSVARNYLGYGLPHGDLIQE
FT                   GNIGLMKAVKRFDPAQNVRLVSYAIHWIKAEIHEYILRNWRMVKVATTKAQRKLFFNLR
FT                   SHKKGTQAFTPEEIDGLAQELNVKREEVAEMETRLSGGDIALEGQIDDGEESYAPIAYL
FT                   ADSHNEPTAVLAARQRDMLQTDGIARALESLDARSRRIIEARWLNVDDDGSGGSTLHDL
FT                   AAEFGVSAERIRQIEASAMKKMRTALAAYA"
FT   gene            complement(433629..433748)
FT                   /locus_tag="GBP346_A0476"
FT   CDS_pept        complement(433629..433748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98143"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPJ0"
FT                   /protein_id="ACQ98143.1"
FT                   /translation="MPSSSEQHLMVKVFSDRHRPTKWFSSELTRISILYPNCP"
FT   gene            433754..434365
FT                   /locus_tag="GBP346_A0477"
FT   CDS_pept        433754..434365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0477"
FT                   /product="lipid A 3-O-deacylase (PagL) superfamily"
FT                   /note="identified by match to protein family HMM PF09411"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97584"
FT                   /db_xref="GOA:C4KPJ1"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPJ1"
FT                   /protein_id="ACQ97584.1"
FT                   /translation="MRRGSIQPEKLESEMNDKNGGRVGRAIARTALALALVGASGSAFA
FT                   DRWGLQLGGGVADHDMKKGDIAVVWDPNWTWWEIGGWHFAFVAEGHLSYWRYTGDRAIN
FT                   SSIWEVGATPIIRFIKSAGYVRPFVELGAGVRFLSHPTISQNYSMSTSFQFADMVGVGA
FT                   QFGNRQQYQAGFRFQHVSNAGIKDPNPGINFSQLYVQYNF"
FT   gene            434407..434793
FT                   /locus_tag="GBP346_A0478"
FT   CDS_pept        434407..434793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02246"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99154"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPJ2"
FT                   /protein_id="ACQ99154.1"
FT                   /translation="MVAKGIDAIRALERDRFRAMVDGDGEALDALLSDKVCYVHTNGKR
FT                   ETKQQFIDAITAGRRRYRQIEIQSQDVLPVGDATYVVAGRALIEMETNNGGLVFSIAYT
FT                   AVQTHESGRWRLLAWQATRCATDA"
FT   gene            complement(435120..436760)
FT                   /locus_tag="GBP346_A0479"
FT   CDS_pept        complement(435120..436760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0479"
FT                   /product="2-isopropylmalate synthase
FT                   (Alpha-isopropylmalatesynthase) (Alpha-IPM synthetase)"
FT                   /EC_number="2.3.3.13"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM TIGR00970"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98406"
FT                   /db_xref="GOA:C4KPJ3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPJ3"
FT                   /protein_id="ACQ98406.1"
FT                   /translation="MKRNPAEKYRPFEPVRINGRRWPSRAIERAPIWMSTDLRDGNQSL
FT                   IEPMTIEQKLEYFEMLVAIGFKEIEVGFPSASQTDFDFVRKLIVERRIPDDVTIEVLVQ
FT                   SREDLIARAFDALEGAPRAIVHLYNAICPSFRRIVFGMSKDDVKALAVDGTRIIKAHAQ
FT                   ARPATHWTFQYSPETFSMTELPFAREVCDAVAQTWRPTRDHKMIVNLPATVEAATPNVF
FT                   ADQIEWMDRNLGYRDSIVLSVHPHNDRGTAVAAAELALLAGAERIEGCLFGNGERTGNV
FT                   DLVTLALNLYTQGIDPGLDFSDIDAVRRVVERCNRIPVHPRHPYAGDLVFTAFSGSHQD
FT                   AIRKGLAQQRPDAIWEVPYLPIDPADLGRSYDAVIRVNSQSGKGGATYLLERAMGFAPP
FT                   RRVQIEFSHAVQTLADTSGAEVTADAICALFTREYLQTIGPAARAGASASWHDREVALA
FT                   HAEDAPSAARQAAAAFASAAGVAIDITSCEVERTVNGETAVFVGARIGDAALRHGAGVH
FT                   RDPVAAATDAVASAINRSAWSRDKRRAAA"
FT   gene            436708..436917
FT                   /locus_tag="GBP346_A0480"
FT   CDS_pept        436708..436917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96526"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPJ4"
FT                   /protein_id="ACQ96526.1"
FT                   /translation="MMRTGSNGRYFSAGLRFIFASGGQVASEDGRHDAPVGAACARACP
FT                   MARRRAIFAIRPSDRRTKADDYGL"
FT   gene            complement(437195..438016)
FT                   /locus_tag="GBP346_A0481"
FT   CDS_pept        complement(437195..438016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0481"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96972"
FT                   /db_xref="GOA:C4KPJ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPJ5"
FT                   /protein_id="ACQ96972.1"
FT                   /translation="MQQIAVLLDGMIKKNAYLPRRIGGTMRVDEQPGYAIVDSGLPTDT
FT                   FNLVIGKAHGQPDAAAIARIAARFNDAGLPAAWWTCRELTDAAFARALGEAGFVADETS
FT                   VGMLAELDALPPVAPPPGFGVRQINAQRDVAHFGTLIGALFDPPDAFVDAFYARVAALD
FT                   FDVAEPLKLFVGELDGRPVSTTALYVDADTAHVFDVSTSAGQRKRGLASAIMHSALVHA
FT                   RERLGATRAALQASPDGLNVYRRLGFRAVCEFQVYSNRATVSPRGEVGGAR"
FT   gene            complement(438664..439644)
FT                   /locus_tag="GBP346_A0482"
FT   CDS_pept        complement(438664..439644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0482"
FT                   /product="glycosyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF02885"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96130"
FT                   /db_xref="GOA:C4KPJ6"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPJ6"
FT                   /protein_id="ACQ96130.1"
FT                   /translation="MTDSDAHATEPPDHFPCARLIKEIGRGPNGARALPYDDAFALYRA
FT                   MLDGHVSDVELGAVLIAYRLKGETADELAAMLAAAHASFEPLHVQDAMFRTVSIPSYNG
FT                   ARRQPNLVPLLALLLAREGVPVLVHGVTEDPGRVTSAEIFAELAIAPGSTHDEIEDTLA
FT                   ERRAAFAPIEVLAPKLARLLALRRVLGVRNSTHTIVKLLQPFEPAGLRLVNYTHPPYRD
FT                   SLVELFRGHPAAAAGGALLARGTEGEAVADTRRQVQVDWLHDGHCETIVEPARASSDAP
FT                   PVELPASRDAATTAAWTDSVMRGEIPVPDAIAMQVDTIVRLARLA"
FT   gene            complement(439641..442496)
FT                   /locus_tag="GBP346_A0483"
FT   CDS_pept        complement(439641..442496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0483"
FT                   /product="nitrate reductase"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM PF04324; match to protein family HMM PF04879"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96605"
FT                   /db_xref="GOA:C4KPJ7"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPJ7"
FT                   /protein_id="ACQ96605.1"
FT                   /translation="MTVDTLAQPIAPSTPGAVRETRSTCCYCGVGCGVVIETRRDANGR
FT                   DTIVGVRGDPDHPANFGRLCSKGSTLHLTATPERYAQTRATHPELRASRDAARTRVSWD
FT                   DALDHVAQRLARTVERHGPDSVGFYISGQLLTEDYYVFNKLAKGLVGTNNIDSNSRLCM
FT                   SSAVVGYKKTLGADAPPCSYEDLDHALTVLIAGANPAYAHPILYRRLEAARARNPQMKV
FT                   IVADPRRTDSASDATLHLALQPGTDTMLFNAMLHVLIWDGALDSAFIAAHTHGFDALRD
FT                   AVRDATPAAAAQVCGLRANDIVQAARWFGAGPSLSLYCQGLNQSSSGTAKNVALINLHL
FT                   ATGQIGKPGAGPFSLTGQPNAMGGREVGGMATLASAHRDLANPAERAEIARLWGVPDLP
FT                   AKPGLTAVEMFERLAEGALKAIWIVCTNPAHSIPSQALARAGLERAEFVVLQDAYAHTG
FT                   TAPYADVLLPAATWGEKEGTVTNSERRISRVRAATQPYGNARADWRIAADVGRRLEARL
FT                   APGRPTLFPYEDAEAIWNEHRATTLGRDCDIGGLSWPLLARDGPQQWPFPAGATQGLAR
FT                   LYTDGRFPSADGRARFVPTPYQPVAEAVDARYRFALTTGRLRDQWHGGSRTGSVAKLFA
FT                   HAPQPCVELNPGDCARLGLGAHDFVHLTSRRGSALMPARADDAVAPGQAFAPMHWGDEY
FT                   VSGVAGNRAAMGINALTTPARDPHSQQPELKHAAIKLLKADLPWRWLIAARVPPGELLA
FT                   RQRAARAFFARFPYASCVPFGTDAYAGLAWRAAAYEPAPAELQREIETLFELPAQAADV
FT                   MSYGDARRGTGRRVRIVDGALVAFSVAGAAGATEDSAAVLRDYVDTGASVGALGRLLLF
FT                   AGRVPLQTAPARGRTICNCVGVSEREIGAVLAADAPSAAPVERLANLQERLKCGTQCGS
FT                   CIPELRRLIAETATAAAPPPR"
FT   gene            complement(442493..442951)
FT                   /locus_tag="GBP346_A0484"
FT   CDS_pept        complement(442493..442951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0484"
FT                   /product="nitrite reductase"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM TIGR02378"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95992"
FT                   /db_xref="GOA:C4KPJ8"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPJ8"
FT                   /protein_id="ACQ95992.1"
FT                   /translation="MRDASRIAPPAHPVNHPGIRIMSATQPEWIAVCRLDDIPPLGARV
FT                   LTREAGTPIALFRTASDAVFALLDRCPHKGGPLSQGIVHGEQVTCPLHGFNVAFSSGCA
FT                   LPPDEGCTSVFSVKRDGDTVLLERTELATLGVDDAAQPAALASPGAAA"
FT   gene            complement(442964..445408)
FT                   /gene="nirB_1"
FT                   /locus_tag="GBP346_A0485"
FT   CDS_pept        complement(442964..445408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB_1"
FT                   /locus_tag="GBP346_A0485"
FT                   /product="nitrite reductase [NAD(P)H], large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01077; match to protein
FT                   family HMM PF03460; match to protein family HMM PF04324;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR02374"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96351"
FT                   /db_xref="GOA:C4KPJ9"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPJ9"
FT                   /protein_id="ACQ96351.1"
FT                   /translation="MRKMKLVMVGNGMAGVRTLEELFKLAPDLYDVTVFGAEPHPNYNR
FT                   ILLSPVLAGEQTLEQIVLNDYAWYASHGVTLHVGKKIVKIDRVKRVVIADDGTEAAYDR
FT                   LLLATGSNPFMLPVPGAQLDGVLGYRDIADTQAMIDAAARHTHAVVIGGGLLGLEAANG
FT                   LKLRGMDVTVVHLAPTLLERQLDAKAGGLLRASLEARGLTFLMPKQTQALVGDEHGRVR
FT                   AVHFKDGGECKADLVVMAVGIRPNTALAESAGLYCNRGIVVNDTMQTYDPRIYAVGECV
FT                   SHRGIAYGLVAPLFEQAKVAANHLAQFGIGRYTGSVTSTKLKVTGIDLFSAGDFLGGDD
FT                   TEDITLSDPIAGVYKKLVIKDDRIVGACLYGDTADGAWYFKLLREGRNIADIRETLMFG
FT                   ETSLGDTGHSGATRAMTMADDAEVCGCNGVCKGTIVSAIKEKGLFTLDDVRKHTKASAS
FT                   CGSCTGLVEQILMSTLGGDYSASPKAKPVCGCTDHTHAEVRAAIREHKLLSVPEAMRFL
FT                   EWRTPNGCSSCRPALNYYCISTWPHDAKDDPQSRFINERAHANIQKDGTYSVVPRMWGG
FT                   VTSADELRRIADVVDKYAIPTVKVTGGQRIDLLGVKKEDLPGVWRDLGMPSGHAYAKAL
FT                   RTVKTCVGSEWCRFGTQDSTLMGQQLERALWRMYAPHKVKLAVSGCPRNCAESGIKDVG
FT                   VIGVDSGWEIYVGGNGGIKTEVAQFFCKVKTHEEVLEYAGAFLQLYREEGWYLERTVHY
FT                   LERVGLDHVKARVLDDAENRRALWDRLQFALKDEPDPWHDTQDAKVDLRQFIPIAVAPA
FT                   DA"
FT   gene            445546..445806
FT                   /locus_tag="GBP346_A0486"
FT   CDS_pept        445546..445806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99027"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPK0"
FT                   /protein_id="ACQ99027.1"
FT                   /translation="MVRRRTAGAPFRTRSVHCSNRAPAKCRRIGGANRRGARRVTLSAV
FT                   AAAFGAGGFSPVGFAASAACRARTPARRSTIETMKDTDEAI"
FT   gene            445793..446437
FT                   /gene="maiA"
FT                   /locus_tag="GBP346_A0487"
FT   CDS_pept        445793..446437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maiA"
FT                   /locus_tag="GBP346_A0487"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /note="identified by match to protein family HMM PF02798;
FT                   match to protein family HMM TIGR01262"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95160"
FT                   /db_xref="GOA:C4KPK1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPK1"
FT                   /protein_id="ACQ95160.1"
FT                   /translation="MKLYSYFRSSAAFRVRIALHLKKLPFDYVPVHLLRDGGQQLTDDY
FT                   RVLNPDALVPTLVDGDAPLQQSLAIVEYLDEAYPAVPLLPQAPVDRAYVRAIALQVACE
FT                   IHPLNNLRVLKYLKHTLKVDDDAKDAWYRHWIEDGFKSLEARLSGDPRTGKLCFGDTPT
FT                   LADLCIVPQVFNAQRFSIGLERFPTIQRIHDHAMTLDAFKAAAPAAQPDAE"
FT   gene            446475..446597
FT                   /locus_tag="GBP346_A0489"
FT   CDS_pept        446475..446597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98165"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPK2"
FT                   /protein_id="ACQ98165.1"
FT                   /translation="MPNRAARRRTSNPARGVRLAQGARFAAGRLRPAKRIGRAA"
FT   gene            complement(446594..447910)
FT                   /gene="ftsY"
FT                   /locus_tag="GBP346_A0488"
FT   CDS_pept        complement(446594..447910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="GBP346_A0488"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97838"
FT                   /db_xref="GOA:C4KPK3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPK3"
FT                   /protein_id="ACQ97838.1"
FT                   /translation="MFSFFKRFKKAPDAAPAEPQQAPDAPRDASRAPASPDAARVDAPA
FT                   APQPRDERSENHDRPEHDETPTAEHSRSGAQPAARATPPASAAASEAPVGQPRAAARAS
FT                   EPAPSVVMTVTPSSNGRHGVVETVEIVPPPAPEPAAKKSWIARLKSGLAKTSSSITNVF
FT                   VNTKIDDALYEELETALLMSDAGIDATEHLLGALREKVRAGRLTDPQQVKDALRELLVE
FT                   LLAPLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAA
FT                   REQLAIWGERNNVTVVQQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEE
FT                   LRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGG
FT                   ILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADALLG"
FT   gene            448162..448788
FT                   /locus_tag="GBP346_A0490"
FT   CDS_pept        448162..448788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0490"
FT                   /product="RNA methyltransferase, RsmD family"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97634"
FT                   /db_xref="GOA:C4KPK4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPK4"
FT                   /protein_id="ACQ97634.1"
FT                   /translation="MSRSSPARPQAQRAPAAGRGKPHTIRIIGGDWKRTPLPVLDLDGL
FT                   RPTPDRVRETLFNWLGQALEGRRCLDLFAGSGALGFEAASRGAASVVMVERHPRAAQQL
FT                   RALKDKLAARAIEIAEADALRIAAGLAPRSFDVVFVDPPFGDAAAFARALDLAPNLVAP
FT                   GGFLYVETGAPLDPSAHASLAGWQVARRGKAGAVHYHLLQRENDE"
FT   gene            448899..449399
FT                   /gene="coaD"
FT                   /locus_tag="GBP346_A0491"
FT   CDS_pept        448899..449399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="GBP346_A0491"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98370"
FT                   /db_xref="GOA:C4KPK5"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPK5"
FT                   /protein_id="ACQ98370.1"
FT                   /translation="MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF
FT                   SLEERLKIANEVLGHYPNVKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGM
FT                   NRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMAQG
FT                   PSA"
FT   gene            449351..449728
FT                   /locus_tag="GBP346_A0492"
FT   CDS_pept        449351..449728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0492"
FT                   /product="ferredoxin"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97784"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPK6"
FT                   /protein_id="ACQ97784.1"
FT                   /translation="MADGEGGRDGPGAVRVSARARRAARSGRPRAGGSETSMALMITDE
FT                   CINCDVCEPECPNGAISMGPEIYVIDPNKCTECVGHFDEPQCQQVCPVECIPQDPGRPE
FT                   TKDQLMAKYRALIAAEQKDDA"
FT   gene            complement(449907..450980)
FT                   /gene="hisC_1"
FT                   /locus_tag="GBP346_A0493"
FT   CDS_pept        complement(449907..450980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC_1"
FT                   /locus_tag="GBP346_A0493"
FT                   /product="histidinol-phosphate transaminase"
FT                   /EC_number="2.6.1.9"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR01141"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97342"
FT                   /db_xref="GOA:C4KPK7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPK7"
FT                   /protein_id="ACQ97342.1"
FT                   /translation="MVSRYWSDIVRQLEPYVPGEQPALAHPVKLNTNENPYPPSPRALD
FT                   AIRRELGDTGEALRRYPDPVARRLRETVAAYHGIAPEQVFAGNGSDEVLAHAFQALLQH
FT                   DRPLRFPDITYSFYPTYARLYRVAYETVPLADDFSIVVDDYLDDAGCVLFPNPNAPTGR
FT                   ALPLADIERIVAANPSSVVVIDEAYVDFGAESAVSLIARYPNLLVVHTVSKARSLAGMR
FT                   VGFAFGDAALIDALTRVKDSFNSYPLDRLAQVATQASYEDEAWFQATRKQVIASRERLV
FT                   GALAALGFDVVPSAANFVFARPRSHDAATLAAQLKQREIFVRHFKLPRIDQHLRITVGS
FT                   DAECDALVAALRELLAA"
FT   gene            complement(451066..451671)
FT                   /gene="pth"
FT                   /locus_tag="GBP346_A0494"
FT   CDS_pept        complement(451066..451671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="GBP346_A0494"
FT                   /product="aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98736"
FT                   /db_xref="GOA:C4KPK8"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPK8"
FT                   /protein_id="ACQ98736.1"
FT                   /translation="MIKLIVGLGNPGAEYTATRHNAGFWLVDQLAREAGATLRDERRFH
FT                   GFYAKARLFGEEVHLLEPQTYMNRSGQAVVALAHFFKILPTEILVAHDELDLPPGAAKL
FT                   KLGGGSGGHNGLKDISAHLSSQQYWRLRIGIGHPRDLIPESARAGAKPDVANFVLKPPR
FT                   KDEQDLIDAAIERALAVMPTAIKGETERAMMQLHRNGA"
FT   gene            complement(451785..452399)
FT                   /locus_tag="GBP346_A0495"
FT   CDS_pept        complement(451785..452399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0495"
FT                   /product="ribosomal protein L25, Ctc-form"
FT                   /note="identified by match to protein family HMM PF01386;
FT                   match to protein family HMM TIGR00731"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98242"
FT                   /db_xref="GOA:C4KPK9"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPK9"
FT                   /protein_id="ACQ98242.1"
FT                   /translation="MKVVAFERQQQGTGASRRLRNAGKTTGIVYGGEAAPQMIELDHNA
FT                   LWHALKKEAFHSSILDLEVAGKSQRVLLRDVQYHPFRQLVLHVDFQRIDPKKKLHTKAP
FT                   LHFLNAETSPAVKLSSAVVSHVVTEIEIECLPADLPEFLEVDLSKIEAGQSLHAKDIAL
FT                   PNGVALTAHVDAENPVIASATIPAGAVSDEAAAGEGETPAA"
FT   gene            complement(452563..453519)
FT                   /locus_tag="GBP346_A0496"
FT   CDS_pept        complement(452563..453519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0496"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96354"
FT                   /db_xref="GOA:C4KPL0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPL0"
FT                   /protein_id="ACQ96354.1"
FT                   /translation="MSSHDGLMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQV
FT                   EIQENVRGKDVFVLQSTCAPTNDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRP
FT                   RSARVAISAKVVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPILLGDLRKQN
FT                   YPDLLVVSPDVGGVVRARALAKQLNCDLAIIDKRRPKANVAEVMNIIGEVEGRTCVIMD
FT                   DMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLSGGAADRIAASALDELVVTDTIPLSA
FT                   ESLACPKIRALSSAGLLAETFSRIRRGDSVMSLFAES"
FT   gene            complement(453566..453644)
FT                   /locus_tag="GBP346_A0497"
FT   tRNA            complement(453566..453644)
FT                   /locus_tag="GBP346_A0497"
FT                   /product="tRNA-Gln"
FT   gene            complement(453697..454578)
FT                   /gene="ispE"
FT                   /locus_tag="GBP346_A0498"
FT   CDS_pept        complement(453697..454578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="GBP346_A0498"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96046"
FT                   /db_xref="GOA:C4KPL1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPL1"
FT                   /protein_id="ACQ96046.1"
FT                   /translation="MTDTTRSLRDCLAPAKLNLFLHITGRRPDGYHALQSVFQLLDWGD
FT                   RLHFTLRDDGKVSRVTDVPGVPEESDLVVRAASLLKAHAGATLGVDIEIDKRLPMGAGL
FT                   GGGSSDAATTLLALNRLWRLDLPRTTLQSLAVKLGADVPFFVFGKNAFAEGIGEALQAV
FT                   ELPARWFLVVTPRVHVPTAAIFSEKSLTRDSKPITITDFLAQRGIDAGWPDSFGRNDMQ
FT                   PVVTSKYAEVAKVVEWFYNLTPARMTGSGASVFAAFKSKADAEAAQAKLPAGWNSAVAE
FT                   SMSEHPLFAFAS"
FT   gene            complement(454612..455235)
FT                   /gene="lolB"
FT                   /locus_tag="GBP346_A0499"
FT   CDS_pept        complement(454612..455235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolB"
FT                   /locus_tag="GBP346_A0499"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="identified by match to protein family HMM PF03550;
FT                   match to protein family HMM TIGR00548"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97244"
FT                   /db_xref="GOA:C4KPL2"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPL2"
FT                   /protein_id="ACQ97244.1"
FT                   /translation="MTTMPRFAQPRARGVALVVAAAAAVLLGACATQPPRAPAAAPDAR
FT                   QTEQNRAYTGRFAVQYQDPLGNPRNVYGNFDWQEQGTNVSLELRSPLGQTLAIVKSAPG
FT                   GASLELPNRQPQFAPDVGELMQRALGFALPLDGLRYWLLPTPSPTTPATTVRDPQDGAR
FT                   IKEIRQDGWTIDYVAYADAPAAGVKRINLARQTPPLDIKLVLDR"
FT   gene            complement(455232..457052)
FT                   /locus_tag="GBP346_A0500"
FT   CDS_pept        complement(455232..457052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0500"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96977"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPL3"
FT                   /protein_id="ACQ96977.1"
FT                   /translation="MTLPLKLSQKRLAAARGPRAVPVRRAIGAALVAAWALAALPAHAQ
FT                   DDAGDDAPQAAFASALPEEQKDLPNVALTSQIVYQVLAAEVALQRSLPAPAYQTYLALA
FT                   RDTRDPRMAQRATEIALAAQSPADALTAANLWREYSPGSQRAAQVDAALLVLGGKPAEA
FT                   QPMLSQELARATGENRGQAIIALQALLARGPNRVGGLTVLQDLLKNDMGRPEARLAIAR
FT                   QQLATDDKDGATQSLKEALRIKPDYLPAALMLSQMGPGERAAGIASFEKFVQQNPKSRD
FT                   GRLALAQLYLADDRLDDAQKQFDAMRRNDSSDPTPLMAIALIKIQQKHLDDATTYLKQY
FT                   VKVAQKKPGADVGQAYVYLAQIALDQNNEALAAQWLDKVDEASQQYVPAQVTRAQLLQK
FT                   QGKADEARKLLANLQASDPRDAAVIARTDASILFTSKRYKEAADRLAQAVEDFPDDPDL
FT                   RYDYAMASEKIGQYTTMEQQLRLLMRAQPDNPQAYNALGYSLADRNLRLQEASKLIEKA
FT                   NSLAPNDAFIMDSLGWVKYRLGDTAGATAILKRAYDLQPNAEIGAHLGEVLWRSGSRDE
FT                   ARAAWRAAQKLEPDNDTLVQTLKRLQVNGL"
FT   gene            457141..457971
FT                   /gene="mutM"
FT                   /locus_tag="GBP346_A0501"
FT   CDS_pept        457141..457971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="GBP346_A0501"
FT                   /product="DNA-formamidopyrimidine glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF06831; match to protein family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97335"
FT                   /db_xref="GOA:C4KPL4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPL4"
FT                   /protein_id="ACQ97335.1"
FT                   /translation="MPELPEVEVTRRGIEPFVAGRRVERVDVRTAMLRWPVPVGFAEML
FT                   RSREVLRVERRGKYLLFEVDAGWFIVHLGMTGTLRVLPNDAPPPAPAKHDHVDWIFDEF
FT                   VLRFRDPRRFGAVLWHPRDAGDVHAHPLLASLGVEPFSAAFSGALLFGRTRGRTVSVKQ
FT                   ALLAGDIVVGVGNIYASESLFRAGIRPTTAAGRVSLPRYERLADAVRATLADAIERGGS
FT                   TLRDFVGSNGESGYFQLDCFVYDRAGEPCRVCGAPIRQIVQGQRSTYFCPNCQR"
FT   gene            457976..459082
FT                   /gene="mutY"
FT                   /locus_tag="GBP346_A0502"
FT   CDS_pept        457976..459082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="GBP346_A0502"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96926"
FT                   /db_xref="GOA:C4KPL5"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPL5"
FT                   /protein_id="ACQ96926.1"
FT                   /translation="MKPPRIPPAPPVITPLHSAFAPTLIAWQRKHGRHDLPWQNTRDPY
FT                   RIWLSEIMLQQTQVSTVVPYYVRFLERYPDVAALAAAPIDDVMALWAGLGYYSRARNLH
FT                   RCAQAVVERHGGAFPASPEALAELPGIGRSTAAAIASFAFGARATILDGNVKRVLARVF
FT                   GVEGFPGDKRIENEMWALAEALLPDAAEPTDVTAYTQGLMDLGATLCVRGKPECGRCPF
FT                   AGECVAQRSGRQRELPAARPKKAVPTRRTWMLVLRDGDAVLLQRRPPAGIWGGLWSLPE
FT                   ADGDAALARRAREFGGAALVPLAPLTHTFTHFRLEIEPRLAELDGAAGGAPPAADDETA
FT                   WVLLDRLDAYGVPAPVRKLLDGLSGPLL"
FT   gene            complement(459476..460108)
FT                   /locus_tag="GBP346_A0503"
FT   CDS_pept        complement(459476..460108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0503"
FT                   /product="ATP-dependent protease La domain protein"
FT                   /note="identified by match to protein family HMM PF02190"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97075"
FT                   /db_xref="GOA:C4KPL6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPL6"
FT                   /protein_id="ACQ97075.1"
FT                   /translation="MSSLSTTLIDLPLFPLHTVLFPGGLLPLKVFEARYLDMARACLRD
FT                   DAPFGVCLLKSGPEVAQEGEVSVPETIGCMARIVECDTGEFGMLLLRTIGTQRFELLSH
FT                   RVEANGLLVGIAEPMQEDIPLEGDSALAQFGACAEALERIVEVLRRSDAELPFAEPFRF
FT                   DDPTWVSNRLAEVLPLDLRARQKLMEFPDVGARIDAVHRELNRHGWL"
FT   gene            complement(460135..461028)
FT                   /locus_tag="GBP346_A0504"
FT   CDS_pept        complement(460135..461028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03668"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96268"
FT                   /db_xref="GOA:C4KPL7"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPL7"
FT                   /protein_id="ACQ96268.1"
FT                   /translation="MRIVLITGISGSGKSVALNALEDAGYYCVDNLPPHVLPELARYLA
FT                   HEGQNRLAVAIDARSSASLDEMPGLIRALSREHDVRVLFLNASTQALIQRFSETRRRHP
FT                   LSGSPSHDADVGLLVSLEEAIERERELVAPLAEFGHQIDTSNLRANVLRTWVKRFIEQK
FT                   NDDLVLMFESFGFKRGVPLDADFMFDVRALPNPYYDHELRPLTGLDQPVVAFLDALPVV
FT                   HQMLDDIETFLVKWLPHFREDNRSYLTVAIGCTGGQHRSVFLAETLAARLSRQASVIVR
FT                   HRDAPVAVDASSRLVT"
FT   gene            complement(461114..462082)
FT                   /locus_tag="GBP346_A0505"
FT   CDS_pept        complement(461114..462082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0505"
FT                   /product="HPr kinase/phosphorylase"
FT                   /EC_number="2.7.11.-"
FT                   /EC_number="2.7.4.-"
FT                   /note="identified by match to protein family HMM PF07475"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97647"
FT                   /db_xref="GOA:C4KPL8"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPL8"
FT                   /protein_id="ACQ97647.1"
FT                   /translation="MDTSSINAQSIFDDNAAMLKLSWLTGHEGWERGFSADTVANATSS
FT                   ADLVGHLNLIHPNRIQVLGEAEIDYYQRQTDEDRSRHMAELIALEPPFLVVAGGAAAPP
FT                   ELVLRCTRSSTPLFTTPMSAAAVIDSLRLYMSRILAPRATLHGVFLDILGMGVLLTGDS
FT                   GLGKSELGLELISRGHGLVADDAVDFVRLGPDFVEGRCPPLLQNLLEVRGLGLLDIKTI
FT                   FGETAVRRKMKLKLIVQLVRRPDGEFQRLPLESQTVDVLGLPISKVTIQVAAGRNLAVL
FT                   VEAAVRNTILQLRGIDTLRDFMDRQRLAMQDPDSQFPGKLV"
FT   gene            complement(462211..462729)
FT                   /locus_tag="GBP346_A0506"
FT   CDS_pept        complement(462211..462729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0506"
FT                   /product="nitrogen regulatory protein (Enzyme IIA-NTR)"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM TIGR01419"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97927"
FT                   /db_xref="GOA:C4KPL9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPL9"
FT                   /protein_id="ACQ97927.1"
FT                   /translation="MTDMENQSAARRPQAAPTPANMNRLAKILPLENVVIDLSVTSKKR
FT                   VFEQAGLIFENQNGIARSTVTDNLFARERLGSTGLGEGVAIPHGRIKGLKHPLAAFVRL
FT                   AEPIPFEAPDGQPVSLLIFLLVPEQATQAHLEILSEIAQLLSDRDTRERLHTEPDRDEL
FT                   HRLLTQWQP"
FT   gene            complement(462953..463312)
FT                   /gene="raiA"
FT                   /locus_tag="GBP346_A0507"
FT   CDS_pept        complement(462953..463312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="raiA"
FT                   /locus_tag="GBP346_A0507"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="identified by match to protein family HMM PF02482;
FT                   match to protein family HMM TIGR00741"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97482"
FT                   /db_xref="GOA:C4KPM0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPM0"
FT                   /protein_id="ACQ97482.1"
FT                   /translation="MNLKISGHHLEVTPAIREYVITKLDRVLRHSDQVIDGAVILTVDN
FT                   HKEKDKRQKAEITLHLKGKDIFVESANGDMYAAIDLLIDKLDRQVVKHMERLQTHAHEP
FT                   LKHQQAAEQIELPPQ"
FT   gene            complement(463462..465003)
FT                   /gene="rpoN_1"
FT                   /locus_tag="GBP346_A0508"
FT   CDS_pept        complement(463462..465003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN_1"
FT                   /locus_tag="GBP346_A0508"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /note="identified by match to protein family HMM PF00309;
FT                   match to protein family HMM PF04552; match to protein
FT                   family HMM PF04963; match to protein family HMM TIGR02395"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99104"
FT                   /db_xref="GOA:C4KPM1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPM1"
FT                   /protein_id="ACQ99104.1"
FT                   /translation="MANFRYDSLFAMKASLQLRLSQHLALTPQLQQSIRLLQLSTLELQ
FT                   QEVATAIAQNPLLENDDDWIASPLRVAADGSVIAQTPASSAPEPMAGAPNGTAATNERT
FT                   ERDETAGVDEYDSYSADGGDASQWNLDDFGRSPAASDDDDLPPMQIHETSTSLRDHLMA
FT                   QLRVTQASPRDRALVTFLIESLDDDGYLSASLEEVLADLPAELEVDVDELNAALALVHS
FT                   FDPAGVGARSASECLKLQLLRLDPSPTRALALDIVSQHLELLAARDFTRLRKQLKATDD
FT                   ALRDAHALIRSLEPFPGAAYGKAEADYVVPDIIVKKAGQNWQAELNPEVVPKLRINNLY
FT                   ANILRNSRGDPSAGSLKQQLQEARWLIKNIQQRFETILRVAQAIVERQKNFFAHGEIAM
FT                   RPLVLREIADTLGLHESTVSRVTTGKYMLTPFGTLEFKYFFGSHVSTDTGGAASSTAIR
FT                   ALIKQLIGAEDPKSPLSDSRIAELLAEQGFVVARRTVAKYREALKIPAVNLRKSL"
FT   gene            complement(465139..465915)
FT                   /locus_tag="GBP346_A0509"
FT   CDS_pept        complement(465139..465915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0509"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98618"
FT                   /db_xref="GOA:C4KPM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPM2"
FT                   /protein_id="ACQ98618.1"
FT                   /translation="MNALPNRQPAGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVG
FT                   LLGPNGAGKTTSFYMIVGLVPLDAGDISLNGSPISLMPIHKRASLGLSYLPQEASVFRK
FT                   LTVEQNVRAVLELQHDENGKRLSKDAIGARTEALLEELQIAHLRENPALSLSGGERRRV
FT                   EIARALASNPSFILLDEPFAGVDPIAVLEIQKIVKFLKQRNIGVLITDHNVRETLGICD
FT                   HAYIISDGSVLASGAPKEIIENESVRRVYLGEHFRM"
FT   gene            complement(465912..466577)
FT                   /gene="lptA"
FT                   /locus_tag="GBP346_A0510"
FT   CDS_pept        complement(465912..466577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lptA"
FT                   /locus_tag="GBP346_A0510"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="identified by match to protein family HMM PF03968;
FT                   match to protein family HMM TIGR03002"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95576"
FT                   /db_xref="GOA:C4KPM3"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPM3"
FT                   /protein_id="ACQ95576.1"
FT                   /translation="MNESFPCLFPSGARRAARAMVAAALVAAPLAGLAPAAHAEKADRD
FT                   KPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGYQYATATASGKK
FT                   HASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGVSTVADTVHGSVITY
FT                   DGQRDFYTARGGKDVAGPGNPGGRVRAMLTPKNSGPAPLSGGPAQLAPSNDMQGAPNP"
FT   gene            complement(466596..467210)
FT                   /locus_tag="GBP346_A0511"
FT   CDS_pept        complement(466596..467210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06835"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95114"
FT                   /db_xref="GOA:C4KPM4"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPM4"
FT                   /protein_id="ACQ95114.1"
FT                   /translation="MDGKFRLTSMIPLAAMAALAGGTYWLLQATLPPPGEAVVRPKSHT
FT                   PDYFADNFSVTELDQTGSTQYRLTAAGLVHYEDDETSDLTRPALRAFQPGKPTVTATAK
FT                   RGAVNGDVSIVDLYDDARILRAAGAGDPPMQADSQHFRVLVNDDVIETEKPVKLQRGLS
FT                   IANAAAGMKYNNVTRVIELYGNVRGTIAASDTSGGAAGQPK"
FT   gene            complement(467216..467758)
FT                   /locus_tag="GBP346_A0512"
FT   CDS_pept        complement(467216..467758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0512"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase (KDO 8-P phosphatase)"
FT                   /EC_number="3.1.3.45"
FT                   /note="identified by match to protein family HMM TIGR01662;
FT                   match to protein family HMM TIGR01670"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95918"
FT                   /db_xref="GOA:C4KPM5"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPM5"
FT                   /protein_id="ACQ95918.1"
FT                   /translation="MMSAPPATAAERASRVKLMIFDVDGVLTDGGLHFTAAGDAMKSFN
FT                   TLDGHGVKLLGEAGIATAIITGRRSEALAARAKEMRIAHLHEGVENKLAVFGELLRALG
FT                   LEPGECGYMGDDWPDLAVMLRCGFAAAPANAHPDVIARAHWVAEARGGHGAVREVCDAI
FT                   LRAQHRYDALLAAACGA"
FT   gene            complement(467755..468738)
FT                   /locus_tag="GBP346_A0513"
FT   CDS_pept        complement(467755..468738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0513"
FT                   /product="arabinose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.13"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR00393"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98714"
FT                   /db_xref="GOA:C4KPM6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPM6"
FT                   /protein_id="ACQ98714.1"
FT                   /translation="MIAKINDDRALALARDVLDIEANAVRALAEQLDGEFVAAVGLLLN
FT                   CRGRVVVSGIGKSGHIARKIAATLASTGTPAFFVHPAEASHGDLGMVTKDDVFVAISNS
FT                   GESEELVAILPLIKRLGAKLIAMTGRPASSLATLSDVHLNAGVAKEACPLNLAPTASTT
FT                   AALALGDALAVAVLDARGFGSDDFARSHPGGALGRRLLTYVRDVMRTGDEVPAVPLDAT
FT                   LSDALFQITAKRMGMTAVIDDANRVAGIFTDGDLRRVLERDGDFRRLPIVDVMTRHPRT
FT                   IAPDHLAVEAVELMERHRINQMLVVDERGALIGALNMHDLFSKKVI"
FT   gene            468866..470875
FT                   /locus_tag="GBP346_A0514"
FT   CDS_pept        468866..470875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0514"
FT                   /product="transporter, monovalent cation:proton
FT                   antiporter-2"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02080; match to protein
FT                   family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97735"
FT                   /db_xref="GOA:C4KPM7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPM7"
FT                   /protein_id="ACQ97735.1"
FT                   /translation="MISPLEMTLLLLLASVVGVVVFRSLNLPPMLGYLTVGILVGPHAL
FT                   GFAADLERAEHLAEFGVVFLMFSIGLEFSLSKLRAMRRLVFGLGLAQVLGTIAIALVLG
FT                   ALFERWMHITWEGSVALGGALAMSSTAIVSKMLAERLEIETEHGRNIFGVLLFQDLAVV
FT                   PLLIVIAAFGGESSKDLAMSLGFAAVKIVVALALLLIVGQRFMTRWLNVVARRRSQELF
FT                   VLNLLLVTLGAAFITDRFGLSLALGAFIAGMLISETPYRHQVEEDIKPFRDVLLGLFFV
FT                   TTGMLLDPSVIWRHPLLVLAFFVGQVLLKSVMITGLARAFGATPGVAMRTGLGLAQAGE
FT                   FGFVLLNLILDRHLVDATLLQSILASMLLSMLAAPFLIQNADRIVMRLSAAEWMQQSLQ
FT                   MTRIATQSIKQKGHVIICGYGRAGQNLARMLEQEGIAYVALDLDPDRVTAAAAAGESVV
FT                   FGDAARRESLLAAGIHRAAAVAVTYANTPSALRVLHNVHELEPTLPAIVRTVDDADLEK
FT                   LLAAGATEVIPEIVEGSLMLASHTLVLMGVPMRRVVRRVEEMRDARYSLLRGYFHGADD
FT                   ADDDDHEQVRLQSVPVDARADAVGRSLSELGLFALGLEVTAIRRHGIRGVEPDPETKLR
FT                   ASDIVVLRGLPEALAQAEERLSRHRREGGSAAVA"
FT   gene            470872..471522
FT                   /gene="apt"
FT                   /locus_tag="GBP346_A0515"
FT   CDS_pept        470872..471522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="GBP346_A0515"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01090"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96105"
FT                   /db_xref="GOA:C4KPM8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPM8"
FT                   /protein_id="ACQ96105.1"
FT                   /translation="MTPGGRRLFSCRAIDERREIAAPFFSESFMMSTSDAPLDPVEFIH
FT                   SRIRTVPDWPQPGVMFRDITPLLQSAKALRVLVDLFVERYVDAKLDYIAGLDARGFIIA
FT                   PIVAYELSVGFVPIRKVGKLPYATQRESYALEYGTATVEIHEDACKPGDRVVIVDDLIA
FT                   TGGTMMAGKNLLERLGAVVVEGAAIVDLPDLGGSALLRGAGLPLYTVTEFPGH"
FT   gene            471616..472230
FT                   /locus_tag="GBP346_A0516"
FT   CDS_pept        471616..472230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0516"
FT                   /product="translocator protein, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96894"
FT                   /db_xref="GOA:C4KPM9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPM9"
FT                   /protein_id="ACQ96894.1"
FT                   /translation="MPNFMLFLATSIAITVAPGPDNLQVLARGISQGRAAGIVAALGFA
FT                   SGVLFHTTLAAFGVAALLRSSPVAFHLLKLAGGAYLIWIGIKALRSKGLATAHARAPQP
FT                   LSTIFRQSVIGNLLNPKVTLFFVVFLPQFVDPHGAQPVALQMLELGALFMAQTAAVFSV
FT                   FGVGAGAIGVWLKRRPRVGVWLDRLAGATFVALGLRVALKD"
FT   gene            472243..473100
FT                   /locus_tag="GBP346_A0517"
FT   CDS_pept        472243..473100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0517"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95156"
FT                   /db_xref="GOA:C4KPN0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR031804"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPN0"
FT                   /protein_id="ACQ95156.1"
FT                   /translation="MTFACIAAARRFDAAAHVPFAIAGRQVGWLRRGDVARLARWPDVF
FT                   EFPAGRVELAARYDSVDARSMALASPIGALAAEGAIVGWRDEIYAIRNRFDDPPLAYIE
FT                   RAASRFFGTMTYAVHLNGIVEYAPSAPLAMWLGRRSATKATDPGMLDNVVAGGIGWGLG
FT                   IEDTIAKECWEEAGIAAELAARAIPGRVAHVLRSLPEGTQAEQIFVYDLPLPRDFVPHN
FT                   QDGEVAEHLLAGVDEIVAWLRAGEATVDASLAMLDSLLRHRAIAPEDARGIDALFAPPP
FT                   LGLG"
FT   gene            473152..474033
FT                   /gene="purU_1"
FT                   /locus_tag="GBP346_A0518"
FT   CDS_pept        473152..474033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU_1"
FT                   /locus_tag="GBP346_A0518"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00655"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98484"
FT                   /db_xref="GOA:C4KPN1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPN1"
FT                   /protein_id="ACQ98484.1"
FT                   /translation="MPADHSFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRT
FT                   GEFFMRVHFEQAGACGAAAALDALRAEFAPLAETFAMRWELHDAAVKPRVVILVSKIGH
FT                   CLNDLLFRYRTGQLPIEISAIVSNHKDFYQLAASYDIPFHHLPLAAGASADAKAAQEAR
FT                   VLEVIDGHAADLVVLARYMQILSPALCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGV
FT                   KLIGATAHYVTTDLDEGPIIEQEVERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHR
FT                   IVLNGTKTVVFR"
FT   gene            complement(474330..475415)
FT                   /locus_tag="GBP346_A0519"
FT   CDS_pept        complement(474330..475415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0519"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98987"
FT                   /db_xref="GOA:C4KPN2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPN2"
FT                   /protein_id="ACQ98987.1"
FT                   /translation="MEKQSEPTREPQAREPHLRSVRLTSDFSLPKLSAIEIGSYLLALF
FT                   GLWLVLHLKLLGGLLAGLLVYQLVHMIAPAIERHMSSQRARWVAVVLLSTAIVGGLAGL
FT                   TIAVIEHFEHTVPNAQNLLGQVMQIVDQARTRTPEWISNLLPVDAEQMRAKAAGLMNRH
FT                   MDQLQQGGKSVARGFGHVLFGMIIGAMIAIGIDRHKLRQPLSTALVARISRFSDAFRRI
FT                   VFAQIKISALNAFFTAIYLLVALPIFHQRLPLSKTLVLVTFIAGLLPVVGNLISNTLIV
FT                   AVSLSVSMGTAIASLVFLVVIHKLEYFLNAKIIGGQIESRAWELLLAMLVMEAAFGVPG
FT                   VIAAPIFYAYVKRELIYLRLI"
FT   gene            complement(475616..478483)
FT                   /gene="uvrA"
FT                   /locus_tag="GBP346_A0520"
FT   CDS_pept        complement(475616..478483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="GBP346_A0520"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97588"
FT                   /db_xref="GOA:C4KPN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPN3"
FT                   /protein_id="ACQ97588.1"
FT                   /translation="MEQIRIRGARTHNLKNVNLDLPRHKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLYARVGTPYCPDHEIPLEAQSVSQMVDAALALPEETRLMILAPVVANRKGEHA
FT                   ELFDEMQAQGFVRFRVRSGGGAANEGAAKIYEVDSLPKLKKNDKHTIDVVVDRLKVRPD
FT                   MKQRLAESFETALRLADGRAIALEMDTDREHLFSSKFACPICSYSLQELEPRLFSFNNP
FT                   MGACPECDGLGQITFFDPKRVVAHPSLSLAAGAVKGWDRRNQFYFQMLQSLAAFYDFDI
FT                   DTAFEDLPEKIRKILLYGSGKQTIPFSYINERGRTTIREHVFEGIIPNLERRYRETDSA
FT                   AVREELAKYQNNQPCPSCDGTRLRREARFVRVGQGDYARAIFEVSSWPLRDALGYFDGL
FT                   TLDGAKREIADKVIKEIVARLTFLNNVGLDYLSLERSAETLSGGEAQRIRLASQIGSGL
FT                   TGVMYVLDEPSIGLHQRDNDRLIGTLKHLRDLGNSVIVVEHDEDMIRTADYVVDMGPGA
FT                   GEHGGMIVAEGTPKQVQANGDSLTGQYLVGKRTIEYPDERISPDPQRMLRIVDAHGNNL
FT                   KHVDLDLPVGLLTCITGVSGSGKSTLINDTLYNAVARHLYGSATEPAPHESIEGLEHFD
FT                   KVINVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPASKERGYDPGRFSFNVKGGRCES
FT                   CQGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLEVQYKGRNISEVLDMTVEHAYEFFS
FT                   AVPVVARKLKTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELSKRDTGRTLYILDEPT
FT                   TGLHFHDIALLLEVIHRLRDQGNTVVIIEHNLDVIKTADWVIDLGPEGGAGGGQIIAQG
FT                   TPEQVAKTKASFTGKYLAPLLKRKK"
FT   gene            478727..479884
FT                   /locus_tag="GBP346_A0521"
FT   CDS_pept        478727..479884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0521"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98071"
FT                   /db_xref="GOA:C4KPN4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPN4"
FT                   /protein_id="ACQ98071.1"
FT                   /translation="MSAPELRATTSLAAIFALRMLGLFMIMPVFSVYAKTIPGGENVVL
FT                   VGIALGAYGVTQSLLYIFYGWASDKFGRKPVIAAGLLIFALGSFVAAFAHDITWIIVGR
FT                   VIQGMGAVSSAVLAFIADLTSEHNRTKAMAMVGGSIGMSFAVAIVGAPIVFHWVGMSGL
FT                   FAIVGALSVAAIGVVLWVVPDAPRPVHVPAPFAEVLHNVELLRLNFGVLVLHATQTALF
FT                   LVVPRLLVDGGLPVASHWQVYLPVMGLAFVMMVPAIIVAEKQGRMKPVLLGGIAAILIG
FT                   QLLLGVATHTILIVAAILFVYFLGFNILEASQPSLVSKLAPGSRKGAATGVYNTTQSIG
FT                   LALGGVVGGVLLKHGGPDTVFFACSALVAVWLIIAAGMKQPPRKA"
FT   gene            479998..480552
FT                   /locus_tag="GBP346_A0522"
FT   CDS_pept        479998..480552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0522"
FT                   /product="single-stranded DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98504"
FT                   /db_xref="GOA:C4KPN5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPN5"
FT                   /protein_id="ACQ98504.1"
FT                   /translation="MASVNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASG
FT                   EFKEMTEWHRVAFFGRLAEIVNEYLKKGSSVYIEGRIRTRKWQGQDGQDRYSTEIVADQ
FT                   MQMLGGRGGSGGGGGGGDDGGYGGGGGGYGGGRDMERGGGGGRASGGGGAGARSGGGGG
FT                   ASRPSAPAGGGFDEMDDDIPF"
FT   gene            complement(480664..481395)
FT                   /locus_tag="GBP346_A0523"
FT   CDS_pept        complement(480664..481395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0523"
FT                   /product="dienelactone hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01738"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97540"
FT                   /db_xref="GOA:C4KPN6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPN6"
FT                   /protein_id="ACQ97540.1"
FT                   /translation="MGTRSIAYDCGGARLTGYFADDAPNTKKPAVLIAHEAFGLNEHIR
FT                   ARARRLAELGYAAFALDMYGAEGFPMPEAIRRHIELMSTPGLMHARASAALSVLMEQPG
FT                   VDRERVAAIGFCQGGISALELARGGAPIRCAVGFHPGLMRPAGSQDGPIRAKVLMMIGA
FT                   RDPDVPAADQAAFAAEMQEKQVDWQLHLFGGVGHAYTNPDADGWNKPGYGYSRAADQRA
FT                   WTMMLALFDEVFGGAAAVGKA"
FT   gene            complement(481449..481616)
FT                   /locus_tag="GBP346_A0524"
FT   CDS_pept        complement(481449..481616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98108"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPN7"
FT                   /protein_id="ACQ98108.1"
FT                   /translation="MNRCNCAAPREVRVCRKRDVSKTETISMAKPAERRGRSSRFPACA
FT                   ASTRRGGEFS"
FT   gene            481738..483318
FT                   /locus_tag="GBP346_A0525"
FT   CDS_pept        481738..483318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98433"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPN8"
FT                   /protein_id="ACQ98433.1"
FT                   /translation="MNPFFGAQREWQDVPVPARAYARLDNLHLPHADAPDRQAALRFDL
FT                   IDADWLDNQAGADNPLFDLGRPHRMRAAWKRWFAAARGGDADDPFRAAPLYVLEVSVPF
FT                   DAREWRKRLGLTREAMANDAHGEILAAFRRRWYELTVLREAAARAGAMLGLLHRGIADE
FT                   GLRVCCFAALAPAAHAAGLTALGTLAGSPALTSASLKPLVRDVRATYLGVYDVGQANAN
FT                   ALLGGIRGRDLHGMVRHGVFPTLYFDLGMPLQSQRHTAPANVRFCFTAEPPIVLSHWHD
FT                   DHLGGVALPTAAGCPTSQQMDWIVPDYSLATRHKALVTAIWAAGGSVHVFSASPAGRRL
FT                   QAATASGHLLTLTRGTARDPNNGGIVMQVSSAQQQARRFADPPRSWLLPGDCDYKHFPS
FT                   TFTPTNVIALVAPHHGADLGKGSVPVPPAASGYLRLVYSFGRDNKYQHPRQGFVDAHHA
FT                   AGWTHPVVPATGAITCVSGDDVRTTNVHSPWSAKPRGVLVGWSKAPHSVPACTLGGGAT
FT                   NCTLPLAKV"
FT   gene            complement(483480..483725)
FT                   /locus_tag="GBP346_A0526"
FT   CDS_pept        complement(483480..483725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99063"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPN9"
FT                   /protein_id="ACQ99063.1"
FT                   /translation="MIEPNEHAGYLAALHARGLSGNEFTLRETDTTDPKGDENIGQTGF
FT                   VTITRHSTHATREYPLGDAGDWLQHFKKDLEAGAFD"
FT   gene            483713..483838
FT                   /locus_tag="GBP346_A0527"
FT   CDS_pept        483713..483838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0527"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95703"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPP0"
FT                   /protein_id="ACQ95703.1"
FT                   /translation="MVRSIAWLRSRASGVRCTWVRAYRGGKAIAGRARSLAQAAE"
FT   gene            complement(483904..484221)
FT                   /locus_tag="GBP346_A0528"
FT   CDS_pept        complement(483904..484221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96280"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPP1"
FT                   /protein_id="ACQ96280.1"
FT                   /translation="MIAPDPESTFRGLPLTPEQNAEVMHYIKVRTQRGLPWDTPELEAM
FT                   IRDMMLPPEDEAADSDFLSDEARAVAERAMSSVEDEMDPIEAREEWRAAMEAENMKGLR
FT                   R"
FT   gene            484383..484550
FT                   /locus_tag="GBP346_A0529"
FT   CDS_pept        484383..484550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96696"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPP2"
FT                   /protein_id="ACQ96696.1"
FT                   /translation="MERLAVVPNLPFDIAGIDDGFRVATVDHPARQRDRSYVEYRMVIP
FT                   QKFIIAAAEL"
FT   gene            complement(484836..484967)
FT                   /locus_tag="GBP346_A0530"
FT   CDS_pept        complement(484836..484967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0530"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97192"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPP3"
FT                   /protein_id="ACQ97192.1"
FT                   /translation="MYHTGITKMAWSDRHRITYTLPDKFEANYYWRISNITDAPAST"
FT   gene            complement(485043..485966)
FT                   /locus_tag="GBP346_A0531"
FT   CDS_pept        complement(485043..485966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0531"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98111"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPP4"
FT                   /protein_id="ACQ98111.1"
FT                   /translation="MQVAHHFTSLEKRQAAQKNGTAGHLDLLCPCFTQQTSPRRPSQCI
FT                   NLNSILVNNMANGDENICNSVREALIQNGIFESEQEIQYATKFSVRSGTNKAGVIVYNS
FT                   GKIHVEGPDSELKKWLGELKGSIESGAATPGILLPAEIEKFPQTLQDRVPDCDGVVLWF
FT                   FQEALRCYKAGSTAGAAFMLGAASEKAILLLTDTYGNRIKDEKNREGYFTRINSKMISV
FT                   KYDEFKRSYKSATPKPKELPLSQDLEQLLDGAFNFYRHTRNAVGHPQIIPDLDKGVILA
FT                   NLGQFIVYVERIYGLMAFYQANDVAV"
FT   gene            complement(486110..486460)
FT                   /locus_tag="GBP346_A0532"
FT   CDS_pept        complement(486110..486460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0532"
FT                   /product="4-carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02627;
FT                   match to protein family HMM TIGR00778"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96096"
FT                   /db_xref="GOA:C4KPP5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPP5"
FT                   /protein_id="ACQ96096.1"
FT                   /translation="MALPQSYRELTGEVATQMRALRKTQPDLMSAFAALAAAGTKEGAL
FT                   GKKTRELVALGIAIASRCDDCIGFHVQTLVKLGTTREEFEDLLATAVYMGGGPSLMYAA
FT                   HALRAVEEFGGE"
FT   gene            complement(486512..486733)
FT                   /locus_tag="GBP346_A0533"
FT   CDS_pept        complement(486512..486733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0533"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96772"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPP6"
FT                   /protein_id="ACQ96772.1"
FT                   /translation="MRIAADQIAADRLSYARRRVRSVSGACVWISRGMARPHVKDRTES
FT                   ACRRGRFDPGQRRCRFDAPMRLRAERYS"
FT   gene            complement(486730..492825)
FT                   /locus_tag="GBP346_A0534"
FT   CDS_pept        complement(486730..492825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0534"
FT                   /product="FG-GAP repeat/YD repeat/RHS repeat protein"
FT                   /note="identified by match to protein family HMM PF01839;
FT                   match to protein family HMM PF05593; match to protein
FT                   family HMM TIGR01643; match to protein family HMM
FT                   TIGR03696"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96081"
FT                   /db_xref="GOA:C4KPP7"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPP7"
FT                   /protein_id="ACQ96081.1"
FT                   /translation="MAKTSGTADEILNLPSGGGSVSGDGGDFSVDLNTGTATLKFDLTV
FT                   PAGPNGITPPHTLQYSAGAGDGAFGIGWSLGLMTIRRRITPATGAAEPAPPGACSLVGV
FT                   GELVDMGARRFRPIVDATGLLIEFTGASWTATDKTDTQYTLGTSANARIGGGALPAAWL
FT                   VDRCADSAGNAIAYTWLDVGGARVPQAIAWGTYRLDFVYEARPDVLVDGSYGAPVTLDK
FT                   RCARIELHATTEAPSLVRSWTLLYDDDGGRGRSLLATIREQGHAADGSILAAPERTFAY
FT                   SSPGAPALVPVTGWTTPLSDPNTDLVDLNGDGLPDIVHLGHGMPTMHPNLGGGQFGAPR
FT                   PLARTAAPLRLSAPSVAFADMSGNGSVDVLVLDAPFSGYYPLAAPGGSAPAGFGRPIVF
FT                   ERAPAVSPSDVRLRFVDLNGDGITDILLDTGRGWLAYLRDGPASWSDAPRVLPPARTPP
FT                   VSLADPHVHLADMTGDGLMDIVRVTGGGLTYWPARADGGWDAAIAMTPSPAFGRDFDPH
FT                   RLALYDVDGDGCADLVYVGLQSVTLWRNVGATRLAAPVAIPGTPVALPGSYRIVDLLGS
FT                   GTAGVHFQLPSIAGASRQSYLDLGGGVKPYLLTDLAHGAAQSTHIGYRTSTEYARDDAQ
FT                   AGAPWRTYHPFPIQCVARTDQTDHGTGATTSTRYAYHDARYDPATRTFLGFGRVDSEQL
FT                   GDASCPTLRVETTFHLGLDPADPARPLTGDEALKLGALRRKPLVTATYGLDGSPLEHRP
FT                   YSITRHAYDALLVASTADNGKRIAVPYCTTSTEERWERQSAAVSARTVDYLAITSEGDV
FT                   TSQRTRAQRAGIAAPDQDVTTTTTLATGGKNLRLPARVTQTAPGGDIVSESICFYDGDA
FT                   FAGLPEGQATRGLVTRIEDRVFDDAFVASVWGDTPPDLTQYGYHRLPGEAGSWWKTRRA
FT                   HARGANASGPTLATKGPLGALQTLQYDASGQRVVKVIDALGNAVAATTDARVFQTASLT
FT                   DANGHRTADAFDALGRVVATIGPLDTPALPTIAFTYTVGAISTVTSATRGTHGGADAVP
FT                   ALTWIDGTGNVLGKGTPAAAPGEWTVTHAVRRNARGLVAASFLPYAATGANWQPPPADT
FT                   GATTSTYDALGRLVQLTRPDGLVVTSRREGDTLITSETWPGGAALDVERQVYDAAGQLV
FT                   SVSRNAGDHWVEQRYAYAPSGKVRDVTLPGGAHVAFTLDLLGRVFAQQSPDTGRTVFLL
FT                   DASDNQRARTNAAGQIVRTDVDAMNRATNVYHDAEPAPRVRYEYADASGAPPADGIVAN
FT                   RYTRLWRITDEIGTVDFEYDEAGRKTATTRTVAATGQRFVTRRAYDALGRLARATLPAS
FT                   APGGAARTIAYGYAADGRLVSASGVVKDAAYDRFGRLTSIDYENGASTLIDYAANAGGI
FT                   ARVRVLDAARNVLRDTTLTRGGGLVQTLTSAHAGDDSVDFGYDPLRRLTSAHYRQGATA
FT                   ADAHDWTFDDAFNATAATDAGVLTYEPGTHRLASVGGAAVAFDAAGRMTSGRFGAATFD
FT                   AADHLSAVTLPDATHIAHTYDYQGRRVRSTKNGAQTYFSPIEDIEFQGDTAIVWITFGR
FT                   QRIAADIGGALTFVHPNALGVMDLITDSGGAYGTRVRQTPFGYARAADGAAPAGGVAAV
FT                   ALALGAADATGLVCHGLRWYDPRVGQFISPDPMVTSVYTVGAWNPYVYCLGNPILLADP
FT                   NGCSFLSVLEIIGVAILAAACVVGAIFTGGATLVALGVLSANIGGWLLAGVALGSLGGA
FT                   IAGELAAQKAGGNLWAGAFLGAFLGGATSLIGGALGGAAAAGIDTLIGGTKTFLSFVAA
FT                   GAIQGTLAGAGTGLAIGYAGGKGNAESMLIAMAKGAAWGAVLGTLLGAGIGAIAGTGIS
FT                   GAAKPDNFLNIGAFGQKFADFTSTSTAINSADNAAGVTESLAQLSMPNGFNAGNLLGLL
FT                   PNLVTTNEQAAGWFSIPIGWLGPGVLNDAGFAGLVDTSMALDQAGFSYAHQISLLLGAA
FT                   PYFIDYAATMAQIVDANGVNNFEMAFNNAFGSGSPSNTG"
FT   gene            complement(492847..496113)
FT                   /locus_tag="GBP346_A0535"
FT   CDS_pept        complement(492847..496113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96530"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR040840"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPP8"
FT                   /protein_id="ACQ96530.1"
FT                   /translation="MLSLTQRVLTYSFIDRPPVNPRAIGTSSADAALLAQIDALLASAA
FT                   ASFKARAYDAALDDYFACESLIYSHLDAQWNPDLGGRLRSRLPRDAALFDSLLSATSQW
FT                   LNVLPVPAPASPVRPATPPPAQALAGVAALRGAGLAPVSPNPAATAQALSDMQLASLYT
FT                   SQGNSAASSVAVTRAKAVDAAVVGAFSPPQMPNPSALPAANPNAAPSTTPGFHPAPGVM
FT                   PPRGIDLAPAALTPLKIQPMPKLPIALLAQKQVGLLTGSGAQTAVKAIQWAASGAPDIA
FT                   SIKTILYAPHASAAALPDALTNANSLWERSVLLPHDYFYTIPLAIAHCYQALGDYANAE
FT                   TYYLQAAGYAYLNTATEGPYIWVALAQLYRAWGDSLYLQGDRAGATNAYGKVVTPGSPA
FT                   APATALYQLAGLATAAKRATALLPQLATLAQTGTGGVTADDVAIATVLLEVYAKLVQIG
FT                   AGLDYWGNYAAAVPIWSFSYLQQVAINFAQLAQQAENQVVNFWNQADQAKLTRTELANQ
FT                   VSQASGQINAAQQQLAVAQAQAQAYQAGVALAQTRATNAAKNAQEYGSLNSQVIVIQAT
FT                   GQQVSGGDDGDYNGVSAMANQYLSGQRISGDSATVAAATNLAANRLSQQFQIDSMNRTT
FT                   AEMQQALAQAQAQLAAANAQVSAAGANLAVAQLNAQAAAQTLGVFDADTFTPQVWKAMG
FT                   NFVDQIYERYMNMALRAAKLMQQAYNFENDVSVSFIKASYQGVVDGLLAADALMADIQS
FT                   FTDDLVNAKRGKKQYLKQSISLASRYGYLFETQLRKTGTMTFETTLDDFDSAYPGTYQG
FT                   RIRRVLVSVQGIVPPTGISGTLGNEGISFYRLPADVATPAAPSKVRVQSAETQVISDYD
FT                   PVQDAVLAPPPENQTGIFEGAGVAGSWTLSLPPALNDINYGTLTDVVLTFLYEARFDPR
FT                   LVQPVLAQLASRPGFYNRERAIPLAWLYPDLFYGFVSTGTLTLNLSAADFPIDQTAPAV
FT                   TAVSLLVAMKPGTPASNVTIALAAPGKGALSGVTDATGAISSQSAGSAWAGAVGGAALG
FT                   DWTLTLGAAANPSLAPGGKLDLSPLINLVLVIDYAFKPRG"
FT   gene            complement(496086..496301)
FT                   /locus_tag="GBP346_A0536"
FT   CDS_pept        complement(496086..496301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95916"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPP9"
FT                   /protein_id="ACQ95916.1"
FT                   /translation="MPSYCLDTPVFDFALPRRKRRAPLDAVIAVRANEVATVNQVHGRP
FT                   SAIRRSGAAARRCRGAPRCFRSHSAY"
FT   gene            complement(496331..496447)
FT                   /locus_tag="GBP346_A0537"
FT   CDS_pept        complement(496331..496447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95270"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPQ0"
FT                   /protein_id="ACQ95270.1"
FT                   /translation="MNGTRLDPTVGVLSFRTSAEDDEASINPTITISRQRII"
FT   gene            complement(496654..496785)
FT                   /locus_tag="GBP346_A0538"
FT   CDS_pept        complement(496654..496785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0538"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98867"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPQ1"
FT                   /protein_id="ACQ98867.1"
FT                   /translation="MARDARRRSASAPRRLPCKPGANDFHCVARSEGMRLISTAAFN"
FT   gene            496885..497043
FT                   /locus_tag="GBP346_A0539"
FT   CDS_pept        496885..497043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98323"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPQ2"
FT                   /protein_id="ACQ98323.1"
FT                   /translation="MSGRLDEPGARRAFETRLGVLLRQTRQAFAARRRVRNRRGARGAA
FT                   CAAPSAK"
FT   gene            complement(497325..497708)
FT                   /locus_tag="GBP346_A0540"
FT   CDS_pept        complement(497325..497708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97733"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPQ3"
FT                   /protein_id="ACQ97733.1"
FT                   /translation="MCFVLPTTTEQRTGMNRELLTHIRADQLDGSIFDASCHAVTVGPV
FT                   TVEFRTSAEPPSSTAELYISRQLVGGCTVNAAHPSGKFGGSVGKLKAEVDLTLDVPGGK
FT                   LDYKLTVCAPIIGGTSKSGTLGL"
FT   gene            complement(497726..498163)
FT                   /locus_tag="GBP346_A0541"
FT   CDS_pept        complement(497726..498163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97133"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPQ4"
FT                   /protein_id="ACQ97133.1"
FT                   /translation="MPPTTLLSTNDAAQGSAETNMSSSDLIQPRQVLVSIASATATYTA
FT                   LSPHVPGFLHVVAQGEAPLHVGNIHLAHDPGFVGGVLLEVVGIAGRPSPTVKQYRTPAY
FT                   SFESCYHREIFIRGANGIIPVKVGLFRREAAQAAEAALDAD"
FT   gene            complement(498390..498767)
FT                   /locus_tag="GBP346_A0542"
FT   CDS_pept        complement(498390..498767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98436"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPQ5"
FT                   /protein_id="ACQ98436.1"
FT                   /translation="MSSDIVESRIVLVPVTRAYATYTSFSLHLLGTFHVYAEGEKPLNI
FT                   RNPHLTPQMWYPPGGLAVVGVVGRPRLGPITSYRTPVYSYQGQYQDTIYVQGANGIVTV
FT                   KVRLLKDEEAESFLDTLDAAA"
FT   gene            complement(499009..499254)
FT                   /locus_tag="GBP346_A0543"
FT   CDS_pept        complement(499009..499254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95194"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPQ6"
FT                   /protein_id="ACQ95194.1"
FT                   /translation="MSAALPAEVKAGGRRAAGRTASRIVCMTTEDEFRRNEKIVAQQQA
FT                   NENARHPETDCRAFFIEYPTVRTPVGISRPNFEISV"
FT   gene            complement(499251..499604)
FT                   /locus_tag="GBP346_A0544"
FT   CDS_pept        complement(499251..499604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96616"
FT                   /db_xref="UniProtKB/TrEMBL:C4KPQ7"
FT                   /protein_id="ACQ96616.1"
FT                   /translation="MGFYGPEPFERATATYVWLGLRVPGALIVEVEGNAPRYTTGIQLV
FT                   RDPRFVGGLKIDVMGWTGPLSSGTQSYKVRHTFQGVFHPTIVVHGSNKTEVVEVKQIPH
FT                   EEADAFLQALDAA"
FT   gene            499864..500871
FT                   /locus_tag="GBP346_A0545"
FT   CDS_pept        499864..500871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0545"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96145"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ39"
FT                   /protein_id="ACQ96145.1"
FT                   /translation="MALLENGLSGEASLLRARHVLGRDPQRCDTVIADPYVSRIHASIC
FT                   WTAGRWELHDHGRNGTFVSGRFVGEGECVVLRDGDLIQFGSAGSVRWRARELGEPVDML
FT                   WPLRAPARPIALDRTHALPGAAFTVSRSAQGDWLCNDTTPARVLHDGDAVICGEFAWQL
FT                   VLAHRGVTAALPRATQVATLPQRIDFTVSRDEEHVTATLHTRGGAVDLGARAHHYCLVT
FT                   LARARFADAQAGYDTASRGWIELDVLARMLGLDESHINVQIHRARTQFLPLLSPGSAEL
FT                   VERRRGGVRFGALAFRVVRGDRLECQSADADASAPLPDPLARGAATFVSPAALG"
FT   gene            500882..504961
FT                   /locus_tag="GBP346_A0546"
FT   CDS_pept        500882..504961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0546"
FT                   /product="protein kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95657"
FT                   /db_xref="GOA:C4KQ40"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023889"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ40"
FT                   /protein_id="ACQ95657.1"
FT                   /translation="MSASVLAERARAGNRRAPRALAPPLPGDGDELQGEHRYRLGAVLG
FT                   EGGAGRVHEAIRLDTSARVAIKLLREDAPRGARERARLRARFRRETALCARLSHPHIVA
FT                   LLDSGETPDGLLFAVFEHVAGRTLRALLAADGALAAETTGALMAQVLDGLAHAHANGVV
FT                   HRDLKPQNVMVTTRDGEPCAKILDFGIGALLPDAHAADELTLTATTEVLGSPQYCAPEQ
FT                   LRGEPPTAKSDFYAWGLIVIECLTGHPVMQGASLADVLYQHLSPVDVALPPAIAAHPLG
FT                   DVLRDALNKDPRQRAESAQALANRFRAIHFPALVGGLRYGARHGRRALAEPGVAAREPG
FT                   GTIALDAPVGRRQVTALCCRVSVVSTLARPADAAADDEALDAFHAHWLTRCSDIAVRYG
FT                   GHVAGALGDTLLFYFGYPEGIDRPAQRACRAALEMTRHAGQPAGAPRSSDGDARACAPA
FT                   WRIDIAGAIHVGTAFATARGASGGVLASAALGLQRIAQPGGILLSDEAARALERHVDAA
FT                   PTALTFAAPGAAPQPVRELLGERYERGPFESLELGDATPIVGRDREQAALARAWRDAVR
FT                   AAAGGRRARRRATLVVGEPGIGKSRLVHALRELVRAQRGACAACVCLPEQTNHALFPIL
FT                   RFVRAHWQLDVGDPHALDRMLEAFDGDRASARATLAAWLGLPGGADTLRWSGARQQQAL
FT                   FDVLCQLLGSLGGGGPVLLIVDDVQWCDSATDDFLDALAHHPACAAVCVVLTSRPERLE
FT                   RWRRGAERLMLRRLSAAATRNLIVSLMPGAGTQRAALDFLVKRTGGVPLYVEETVRALA
FT                   EGGVAPGAGARLPDLAQAGRCPLPGSLRETLELALERADDALDTVQLAATIGLEVDARL
FT                   LAEASPHAGAELDERLRRLIEGRVLYAQHRIGGATYVFRHALLREAAYESMPAATRREY
FT                   HRRVAQALLACVAQGDPAARSASIADHFARAHAFAAAVPHGIEAARRALARALHDDAIR
FT                   YAGAVRGWLLHCDYPGQHEDAVSVDLTLAHAQMARDGWGDPRVREHTDRVLSRVGELSD
FT                   AKAAAGALWTIAVYHHVAGDRDAVRRIGGQLSALARASARADLGVAADTLHGMALWIDG
FT                   HYTLALDAFDAALAAYDPRRDGDHRHVFGLDTRAWAQSARACVLWGIDDDVARTLALAR
FT                   DAVQLATCTDHLPTIGLTMMYLARMQQCVGDREGARATADAVLRLSRCHGLNAVERYAA
FT                   VVRAWCDGDRDAARANVDALRASGCMLGLTYYASVAADIDAERGDARAALATLDECLAL
FT                   AESMDERHYVAELLLKKARCVRDAHGRRAADEAQALCARAAAVARRSGMARIERKAQAE
FT                   LRELQRELRSTTGEER"
FT   gene            504958..505320
FT                   /locus_tag="GBP346_A0547"
FT   CDS_pept        504958..505320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95187"
FT                   /db_xref="GOA:C4KQ41"
FT                   /db_xref="InterPro:IPR022261"
FT                   /db_xref="InterPro:IPR036648"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ41"
FT                   /protein_id="ACQ95187.1"
FT                   /translation="MTDRSPNVPTYDQFLEYRAVIVQAIAAAWHDAEFREELIAHPVDA
FT                   LHKRFDYRFPMKMHLKVHENSATWTPLTNGGWTTNEVNGLDLVLPPAPPPEQRAAALAA
FT                   YNARHISLFGPDRKEI"
FT   gene            505322..505684
FT                   /locus_tag="GBP346_A0548"
FT   CDS_pept        505322..505684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98454"
FT                   /db_xref="GOA:C4KQ42"
FT                   /db_xref="InterPro:IPR022261"
FT                   /db_xref="InterPro:IPR036648"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ42"
FT                   /protein_id="ACQ98454.1"
FT                   /translation="MAENNAVPTHQSLLDFPEVYLRAIALSWENEQFKRELLADPLDAL
FT                   ERYFDYRCPWILNLKVAEVPPDESHYGWDAKRQRWNLPVNTLRVGIPTPPKHLAEEGIA
FT                   LAAYNDAGPAYLFTCC"
FT   gene            505776..508076
FT                   /locus_tag="GBP346_A0549"
FT   CDS_pept        505776..508076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0549"
FT                   /product="AknN"
FT                   /note="identified by match to protein family HMM PF02624;
FT                   match to protein family HMM TIGR00702; match to protein
FT                   family HMM TIGR03604"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98086"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR022291"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ43"
FT                   /protein_id="ACQ98086.1"
FT                   /translation="MLDDFSRVLRFKPHLLVRDAGSGALYVVDEFRRSVLPGDVFPAIA
FT                   ACMRDRLTIAQTFAALAARFSQWEVLAALDQLVRRGYVRADAPGERDAELAFHERAGVD
FT                   GDAASGVASRLTVAVEAFGVDPRAQLDAFAACGIGVAPDAPLTVALTDGYDRAELIVAA
FT                   ERAAARGGALLVVVADRVEPLIGPLLGAAAGLAASAGSTAPTAPSTSPAPQDAADAPPC
FT                   IECVRYWTALNHPVETLLARLHGGDAARLPPARSRASAAAVAAVVASFVEQIAVNAQRR
FT                   RHAGSHIVSLRVDTLATAAHRVVRRPQCPRCAHAGWMREQAERPVTLASADAGARRDGG
FT                   YRTLAAAELFKRYGHLISPVSGPIAYLHPMPGRNAGMRHVYVAGYLVCPPSAPRENRFD
FT                   KLCSGKGASDAQARASALAEALERFSGVYQGDEAALRGSLAQLSAHAPPGSGPIDVNAL
FT                   QQYSDRQFERRERHNATTDDPRKQVPRRFTRDSVIDWTPAWSIATGARRLVPLAYCYAE
FT                   TPASSGADYCVHNPNGCAAGACIEEAILQGLLELVERDAVAIWWYNMLRRPAVDIESFG
FT                   DPYFDALAADYASLGWRLWALDITHDLRIPVFVALARETATGRFSIGFGCHPDSRIALQ
FT                   RALTEVNQLLDVGAAAPPPWDVDKLPDDAFLHPDPALPPVRAPARAPHGRCDLKRDIED
FT                   CVARLAAAGIDTLVVDKTRPDIGLPVVQVIAPGLCHFWPRFGAPRLYSVPVAQRWRERP
FT                   RDEDALNRALLFL"
FT   gene            508146..508922
FT                   /locus_tag="GBP346_A0550"
FT   CDS_pept        508146..508922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0550"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97518"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ44"
FT                   /protein_id="ACQ97518.1"
FT                   /translation="MTNRTPNQPFARPARFAQAEWQARVQLAAAYRIFDHLGWSELIYN
FT                   HISLRVPGEDTHFLINPFGLHYREVCASNLVKVDVDGHSVGHADWPFNPAGVTFHAAIH
FT                   AALPDAHCVMHVHTTPTMAVCATRRGLSFSNFYAAQLHGRVAYHDFEGITVRPDEGRRI
FT                   VDSAAGRPVLLLRNHGPVAIGRTLAHAFSLMWLLHRACEVQVATHALGEPLEIDAPILD
FT                   ACARDSLNLDPRHGAGQDAFDALQRIVDRIDPGYRS"
FT   gene            complement(509030..509206)
FT                   /locus_tag="GBP346_A0551"
FT   CDS_pept        complement(509030..509206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96676"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ45"
FT                   /protein_id="ACQ96676.1"
FT                   /translation="MGWMTQFISHWRAPDAARTFPALALQACRSALPRMKTKCRITASR
FT                   IPENNRTQSKFKT"
FT   gene            509221..509340
FT                   /locus_tag="GBP346_A0552"
FT   CDS_pept        509221..509340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ46"
FT                   /protein_id="ACQ96058.1"
FT                   /translation="MSEMIASDRIGANGNRFGIRILGRLIECVLEMFAACRFR"
FT   gene            509405..511768
FT                   /locus_tag="GBP346_A0553"
FT   CDS_pept        509405..511768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0553"
FT                   /product="eal/ggdef domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98129"
FT                   /db_xref="GOA:C4KQ47"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ47"
FT                   /protein_id="ACQ98129.1"
FT                   /translation="MRSAVAVALAVALLGAALLSVERFGAARSRASAAIPASIGARLSG
FT                   CAFIAVRIGAALSRRVPSPAHAAAPGVARPDFDAIERVFGPIRMRERRAHGATCTADAP
FT                   DASHVGWIEPARACSAAAHAAPGRGAEGAPNTMPRPSEAGAAAVPQSQPYLDMIDSTFR
FT                   EPAAIVLALSLLGMIALALLPVFRIRRLALRLGEAQGALEMSEARARAALVAVGDGVIF
FT                   TGRAGRVECLNPAAERLIGMLADDCRGRPLVSTLRLSRTATSASSGAFAASAGLDAPDS
FT                   PGSAASPDAPLGDLEDGGSCDATLYRADGGAIAVRATASSIAPPPGHARRACGSGRVLV
FT                   LKSLATEHELVRRLAWQTTHDPLTGLASRAEFERHVGFALAADVREPVALLFVDLDRFR
FT                   IVNDTCGYAAGDAMLAALAARLVSCAASADVVARLGGDEFCVLLDARDEASAVSAAERL
FT                   RASVDGFVFVWDGQPFSVTASVGVALLGGPGRAPRVEDAVRLAGIACDVAKARGRNRVQ
FT                   LADPHDHELAHHISDVSWCARVRQALEYDDFRLYVQPIVDTATQGATGLPRARRGELLL
FT                   RMGALGEREGVAPPGLFIRAAERYGLVTDIDRWVVRTVLDALARTRSRRFSEYAINLSG
FT                   ISIGDERFLDYVLEQFARTRVAPALICFEITETAAIANLAGALRFMHELKALGCRFALD
FT                   DFGSGMASLSYLKQLPVEYLKIDGSFVTGIANDAASLDIVASINDIGHAMNCKTIAEYV
FT                   DSAATLQKLAALGVDYAQGYYIGRPVPWCEAARA"
FT   gene            complement(511959..513227)
FT                   /locus_tag="GBP346_A0554"
FT   CDS_pept        complement(511959..513227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0554"
FT                   /product="transporter, polysaccharide transporter"
FT                   /note="identified by match to protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97657"
FT                   /db_xref="GOA:C4KQ48"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ48"
FT                   /protein_id="ACQ97657.1"
FT                   /translation="MTTVRKNFLLLMTLQISTYVVPLVTLPLLTRVLGPEAYGQLSFVL
FT                   AVITYFINFTNYSFDLTATPRIALAHDDLAARSKIFWATFAAQAAITVAGFAILLALTF
FT                   AIERFAIDRTLLVIGFGITVGAALTPGWYFQGIQKLRIYSMTLFACRALSVPAMYLCVR
FT                   SPADLIDAVAINAAVPLVCGVLVFGYLIVQREVVFVRIGAADVAASLKGGWQVFLASTS
FT                   VAFYASTNTVLLGFVSGNVAAGYFAAGDKLIRSAISLLQPLKAAAYPHVSYLMHHARED
FT                   AMSFLRKLLVVQGAMVLAISLAIFALAPLAVHILYGSTYEPTVGVLRCMALIPFMAGMT
FT                   DLFGVQTMLPLGMKTAFSRVLISSGVLNVALLPPLAKCFAEQGAAAAVLIAETAVAATL
FT                   AYVLYRKRVSIFARPAPRPASRG"
FT   gene            complement(513304..514500)
FT                   /locus_tag="GBP346_A0555"
FT   CDS_pept        complement(513304..514500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0555"
FT                   /product="glycosyl transferase, group 1 family"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96127"
FT                   /db_xref="GOA:C4KQ49"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ49"
FT                   /protein_id="ACQ96127.1"
FT                   /translation="MKVLVINDFARKGGAEEVYRTSVDVLRAQPGVEVATFDERAFALT
FT                   QGGAARAWNAPAARALAAVLEREAPQRMLVHNYHNLLSPSIVPVIARYKRRTGCRAYLT
FT                   CHDYHLVFYNPNLLTYPRGRATPLPLDALARGARLFERSSPRGALHDAIKKLHWHAIDA
FT                   LVQPADAFDLLLCPSPYMRDALARRGIARTALLHNPVSTALTPREPKCAERERLDLAFV
FT                   GRIDPEKGLDEFLELARASRFERIASVTVYGDGGQRALLERKYAALIAAGQLRFAGRLD
FT                   HARLFVALREHDALVLPSVWAENAPLVIVEAAMIGLPVLVHDIGSLSSFGDEIGNKIRY
FT                   AHNGASLAHALDALRAHLREPRRRYDWSLYTRRHYADRLAALLELSAREARELAPQCD"
FT   gene            complement(514535..516127)
FT                   /locus_tag="GBP346_A0556"
FT   CDS_pept        complement(514535..516127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0556"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM PF01050; match to protein
FT                   family HMM PF07883; match to protein family HMM TIGR01479"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96485"
FT                   /db_xref="GOA:C4KQ50"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ50"
FT                   /protein_id="ACQ96485.1"
FT                   /translation="MTDLATKPTPAASHGTLPRILPVILAGGSGTRLWPLSREHHPKQL
FT                   IDLIADESPLSATARRLTGIANAELADTLLLVCGEQHRFTSAAQVSARGLDARILLEPA
FT                   ARNTAPALTLAALEALAHHGDPVLAAMPADHAVSDTRAFQETVALAARYAQDGAIVTLG
FT                   VLPRRAETGYGYIKVGAPLAGANGDTGGYAIDSFVEKPHQELAQQYLQSGDYWWNSGIF
FT                   VVRASTWLAAIRALQPDMHAACEAAWRGGTSEGAFFKADAAAFAACPSDSIDYAVMERL
FT                   TGARALGIPGVIVPLTAGWSDVGSWDAIWELLPKDEAGNVARGEVLFEGTEDSFARSEG
FT                   RLVACVGLKDVVVVETPDAVLVANKHRVQDVKTVVARLKSGRHEQVRDHRKVQRPWGYY
FT                   DSIDRGERFQVKRIVVDPGKQLSLQMHYHRAEHWIVVRGTAKVTRGDETFLLSENESTY
FT                   IAVGAVHRLENPGRIPLEIIEVQSGDYLGEDDIVRFDDRYGRASAQHAPDAAKPADAEL
FT                   APAAGPARALGAQ"
FT   gene            complement(516124..516774)
FT                   /locus_tag="GBP346_A0557"
FT   CDS_pept        complement(516124..516774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0557"
FT                   /product="ElaA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97061"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ51"
FT                   /protein_id="ACQ97061.1"
FT                   /translation="MDWTCCEFRHLSSNELYMILRTRNAVLVVEDAHTHLDIDGKDEFA
FT                   IHVFATDKRGEQPAIAAYARLLPGDDIDPETTIDKILTSAAHRDDRTIDALIEHVLAAA
FT                   HARWPDAPVRVQAPAPREGFYNRFGFRKVDGPYLEHGAPYVGMLRAASAPSKAVRNLLD
FT                   LVGNATSANPGTSAGAVPASAARKPRKANAESTTEGERYAFAGRLPADSGMNR"
FT   gene            complement(516741..517133)
FT                   /locus_tag="GBP346_A0558"
FT   CDS_pept        complement(516741..517133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95869"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ52"
FT                   /protein_id="ACQ95869.1"
FT                   /translation="MRLGASNRTRIASSASGAGGTAARRHRMAAIIRTSARPLCAQAHI
FT                   TQGSARRLVCTAHIGGAPHAAPRSSRARYAFEQNGAGSARIFATIGRIGNISHVAAHQT
FT                   RAARRGTRPRNEESPSWTGHAANSGI"
FT   gene            517152..518393
FT                   /locus_tag="GBP346_A0559"
FT   CDS_pept        517152..518393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0559"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98399"
FT                   /db_xref="GOA:C4KQ53"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ53"
FT                   /protein_id="ACQ98399.1"
FT                   /translation="MKVAIVHDWLVVYGGAERVLAQMIDCFAQADIYSLVDFLDDRSCL
FT                   RGRPVHTSFIQKLPFARSKYRSYLPLFPLAIEQFDLSGYDLILSSSYAVAKGVLNGPDQ
FT                   LHASYVHSPVRYAWDLQHQYLNEAGLARGVKSALARTLLHYIRNWDARSANGVDLLAAN
FT                   SRFVARRIRKTYRRDATVIYPPVDVDHLALRDTKDDFYLTASRLVPYKRIDLIVEAFSH
FT                   MPSRRLVVIGDGPEAAKIRALAGPNVTLLGYQPFDVLHDHLQRAKAFVFAAEEDFGISP
FT                   VEAQACGTPVIAYGKGGVCESVRAAGAAPTGLFYAKQTCDALIDAIDRFEAMPAGTFDP
FT                   HACRANAERFSAARFRSTFSRFVLEGYAALQAEMGETMQDAPLEPGGAPDGAPVERDAA
FT                   APHGACRNETLARI"
FT   gene            518421..519155
FT                   /locus_tag="GBP346_A0560"
FT   CDS_pept        518421..519155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0560"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99082"
FT                   /db_xref="GOA:C4KQ54"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ54"
FT                   /protein_id="ACQ99082.1"
FT                   /translation="MRLLFFLTNFGDPMLTAPLAFAVLSWLAASRRRRAALVWALGFAC
FT                   AVGVVALTKFVYAGWGIGIAAWRFTGVSGHTMLGAAVYPLVATICVRDAYPRRALAAGL
FT                   AFALAIGMSRVLLGFHSWSEIVSGWLLGAAVAASTARCLHGIGGARASQAQARGMHAAR
FT                   NVPMARRAHGGGAVGAHPHAAAGAAAVRRAARAPRSTLMFVAAACAIAVSCYGRSAPVS
FT                   AWISDAAPKVAEWGRVWFDDAR"
FT   gene            519205..519330
FT                   /locus_tag="GBP346_A0561"
FT   CDS_pept        519205..519330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97454"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ55"
FT                   /protein_id="ACQ97454.1"
FT                   /translation="MHAATQFRTRLISIMPGGMRPVWRNLFHSYTNITARLRDNE"
FT   gene            519957..521288
FT                   /locus_tag="GBP346_A0562"
FT   CDS_pept        519957..521288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0562"
FT                   /product="sigma-54 dependent transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96163"
FT                   /db_xref="GOA:C4KQ56"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ56"
FT                   /protein_id="ACQ96163.1"
FT                   /translation="MIYWTHQPSTLLRKELARRDWKISVVTSANQVRTTAGEVTGGILD
FT                   LSAVSIDEMNAVAAVCASLRNVAWVALVEAQQANVPNVRTLLRDYCFDYITLPTSHQRI
FT                   ADAVGHAYGMECLFAPSTAPIASADQGMIGTCDAMLQLFDTVRRIARTDAPVLVSGETG
FT                   TGKELTAAAIHQHSARRAGPFVAVNCGAIPPHLLQSELFGYERGAFTGASTRKIGHVES
FT                   ANGGTLLLDEIGDLPLESQASLLRFLQERTIHRLGGSEPVPVDVRIVSATHVDLRGAMN
FT                   EGRFRADLYHRLCVLRVDQPPLRARGKDIELLARHMLERFRADARHRVRGFSTDAISAL
FT                   YKHDWPGNVRELINRVRRALVMAEGRLITAHDLELDHCTEVAPLSVAAIRKSIEREVIE
FT                   LALLRNRGRLAGTARELGISRATLYRWMEAYGIERPRSTASPAN"
FT   gene            complement(521312..523288)
FT                   /locus_tag="GBP346_A0563"
FT   CDS_pept        complement(521312..523288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98984"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ57"
FT                   /protein_id="ACQ98984.1"
FT                   /translation="MRPVRFDDCLGWLHEGRTRRGAVICEALGHEALWTHKVVRTLAER
FT                   LADDGMWVLRFHYPCAGDSAGDDLAPGRQPASVASVRRALAALRDLAPVDQVTLVGLRA
FT                   GAAFAMLALAGEDAPDVDAFVALAPVVRGRAYLRELSVVQKRWLDTAPPAIREQHHEEP
FT                   WLNILGHRYPADFVADLRTIDLSAAVAATASPPRAALLVDTDYGDSPALRDALAARGVP
FT                   AHVEPFPEWPNALQEGARSRVPLAALESVARWIGHGERATPGTSAAARTGDDARAAAHA
FT                   AAERIEKRTDRLAEKCAEKHTEQHDERLAESRAARAPQASPPITFAFDGVAETLVHVGA
FT                   KRLVGTLCEPIVPARAGMPCLLIANTAANPRSADGRIGVRLARTLAQRGIASLRIDIEG
FT                   IGDSGARAPDDQADVLYSDPAIADVAAATDWLGAHCRRPVVAFGVCSGAFAALHAAAHA
FT                   PAAAGVIAVNLPRFIWPRGLTIAEARRQQTNSARGYLASMRDWSKWRRLLREGRDLRPV
FT                   LSALRRHVTSRLSEPASRLAERFGRRPSPDTPRGLLRTLTERNVHTMLVYGEFDPGVDE
FT                   LSRYFGSPRRAFRRSPLVSVEMIRLLDHSVYGTSAADMIIELCIDTLTQWNDRTRGSRP
FT                   RPRPAGARRGAAHAASADAAASS"
FT   gene            complement(523285..525804)
FT                   /locus_tag="GBP346_A0564"
FT   CDS_pept        complement(523285..525804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0564"
FT                   /product="glycosyl hydrolase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98730"
FT                   /db_xref="GOA:C4KQ58"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ58"
FT                   /protein_id="ACQ98730.1"
FT                   /translation="MKSAPDRVARGAAQWTLIATPAGAIARPSELGEAGWCAASVPGTV
FT                   AQALAAARRFDPAHPYPLGDSDYWYRTTLHGAGPRIVRLNGLATIAEVWLDDTLLLCSD
FT                   NMYVAHDLPVTLGGAHRLALCFRSLDRHLAEHPPRGRARWRTRLVDTPALRGVRATFLG
FT                   RMPGWFPAIEPVGPWRPIDIVNPAGAPTIVHDTLRATLDGRDGVLDATLEFAAPLSRTA
FT                   HAQLVCGEHAAPLEATGPRTARATLRIANVTPWWPHTHGEPALYDVGVAIGDATIALAK
FT                   TGFRTLAVERGADGRGFALSVNGTPLFARGACWTSADPVGLHADAPAYRRALALARDAG
FT                   CNMIRVGGTMIYEADAFYALCDELGLLVWQDFMLANFDYPSNDPRFAESLKREAEQFLG
FT                   RHMARPSIAVLCGGSEIAQQAAMVGLAPDERRVPATEQWLAELCAAHRPDAAYVSDSPH
FT                   GGVLPFAPREGVTHYYGVGAYLRPPEDARRAGVRFASECLAFANVPCDATLASIGSPAA
FT                   HEPAWKRAVPRDPGAPWDFDDVRDHYLRALYGVEPARLRSIDPARYLTLSRAVVADLVG
FT                   ETLAEWRRVGSSCAGALVWQFQDVMPGAGWGLVDAHGRPKSAWHALRRVSQPRQILLTD
FT                   EGLNGLDVHVLNDAPAPLEARIELVALRDGKTPIARAARTVHVAAHAGQCVNSADLLGR
FT                   FFDFTYAYRFGPREHDVVIASLYASDGALLSQAFHFPERTAPTVFERGDIGLEASAAYR
FT                   DGRWCVQVQTRTFARYVHVCAPGLLPDIDWFHLAPGAAARIEFAADPHSPAPDHRPPEA
FT                   DAAHCAPPAIEVRALNSNKTIRPRIEN"
FT   gene            complement(525801..526889)
FT                   /locus_tag="GBP346_A0565"
FT   CDS_pept        complement(525801..526889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08893"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98272"
FT                   /db_xref="InterPro:IPR014989"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ59"
FT                   /protein_id="ACQ98272.1"
FT                   /translation="MSSILLDAPGNGASLEDIFTDIRHRVRHYRPHALHGPQMVWKQTN
FT                   CYVDLWIEVLGWWGLNPYAALPFTITLDFEGDQFSFFKFPFEDLETLYGIVVQEHAIFE
FT                   PVDVHVEHQVARGNLMLVEVDAWYLPDTRGNSYQSEHTKTTIGIDAIDRERRRVGYFHN
FT                   SGYYLAEGVDYDGLFGKHGPAHLVPYVERAKRQFKPLEERELCDASLALLARHLKRRPA
FT                   SNPIAAFREQLARDAKTIASQPISYFHAYSFNTLRQLGANFELFGRYLRWLEASGCGGP
FT                   IDTLVAACDTIASEAMVLEFRLARASARGKEERGESSLDILERAHASLIDGVARIAPPG
FT                   RVEPNPPFGTLYVPPRPVTAVR"
FT   gene            complement(526886..527860)
FT                   /locus_tag="GBP346_A0566"
FT   CDS_pept        complement(526886..527860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0566"
FT                   /product="serine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97773"
FT                   /db_xref="GOA:C4KQ60"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ60"
FT                   /protein_id="ACQ97773.1"
FT                   /translation="MNDMTQPSVRAAETADAPIDRSGVNKLRDELVEAGLLISTGIQGL
FT                   FGRSERFERVVDALDAYITRLGADQHAEVLRFPPAMSRPEFERSEYLKSFPQLAGTVHS
FT                   FCGNEHDHQRVLQCLDRGDDWTESQKPTYVVMTPAACYPVYPVLAQRGALPENGRIVDA
FT                   FSYCFRHEPSLDPTRMQLFRMREYIRVGTPEQILAFRQDWIERGTRMIDALQLPNSIDL
FT                   ANDPFFGRGGKIVASSQRDQNLKFELLIPIEYDARLTACLSFNYHMDHFGLLWGIKTAD
FT                   AAVAHTGCVGFGLERLTLGLFRHHGLDPHAWPQAVRDVLWGHR"
FT   gene            complement(527857..529080)
FT                   /locus_tag="GBP346_A0567"
FT   CDS_pept        complement(527857..529080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0567"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF02771;
FT                   match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97321"
FT                   /db_xref="GOA:C4KQ61"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ61"
FT                   /protein_id="ACQ97321.1"
FT                   /translation="MKRFDAETGNARVAAVESLLADDHTLNEAARRVAQVAARFADTVD
FT                   RDARFPTEAVDAMREERLLGALVPIELGGRGASLAAVAAACRIIGQACSSAAMIYAMHQ
FT                   TQVASIVDHALSSDWHRRFAEQLAEREWLLASATSEEEVGGNLRNSRCAIEADGDMFTL
FT                   AKLAPTISYGAQADAILVTARRDRDAPAAEQVLVTLLKENATLTRRSGWDTFGMRGTCS
FT                   EGFALDARGYCEQIFPVPFAQIAERTMVPTSHILWAAVWTGIANDAFLRAHQFFRAQMQ
FT                   KQGGALPPSGRRIADALALLQAMQARIDGALRLHEHSASRSWSATMAQAAEINTLKTYV
FT                   STTALEVVKHATMICGMASYKNGTPYTLGRHIRDLHSAPLMISNDRIEANTANLLLALR
FT                   PATLEREI"
FT   gene            complement(529077..529328)
FT                   /locus_tag="GBP346_A0568"
FT   CDS_pept        complement(529077..529328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0568"
FT                   /product="acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95201"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ62"
FT                   /protein_id="ACQ95201.1"
FT                   /translation="MKNELRTIIKDVAHLEASIDHIADGDDLYEAGLSSLNTIQLMLAI
FT                   EKHFNIEIPDEMLNRQLFQSIDSLAGAVTQLQRAEQSA"
FT   gene            complement(529573..530367)
FT                   /locus_tag="GBP346_A0569"
FT   CDS_pept        complement(529573..530367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0569"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96348"
FT                   /db_xref="GOA:C4KQ63"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ63"
FT                   /protein_id="ACQ96348.1"
FT                   /translation="MTYREYKEPATRAGGIIELPHRTDANRFLASLGVAERATLASHLQ
FT                   LVHVKSGQVLCEPGMALEHVYLPVTTVISIQYASSDGMTLEIAEIGNEGIVSPQLVGTD
FT                   GASPCRVITCRDGFSYRLGARVLSNLLEESAQTRQAIFRCTHLLMAQAKQISFCSRHHV
FT                   LKNQLCRWFLLAYDRSRSVEIQVTHSMLAQMLGVRRETVTDAAGDIQKMGLIRQYRSSI
FT                   ILVDLPGLDAQSCGCHAIIREEMKKIQAAPTSASGTLTELRS"
FT   gene            complement(530364..530564)
FT                   /locus_tag="GBP346_A0570"
FT   CDS_pept        complement(530364..530564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95904"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ64"
FT                   /protein_id="ACQ95904.1"
FT                   /translation="MSKFVKYASRANLKKIRRDNLKLQFQRQVELTNKNRTCLARQERL
FT                   RAAPFRRGAAAPDRRSGKDKP"
FT   gene            530531..530761
FT                   /locus_tag="GBP346_A0571"
FT   CDS_pept        530531..530761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0571"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95363"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ65"
FT                   /protein_id="ACQ95363.1"
FT                   /translation="MHAMRISQILTFRNFPKNFLREDLSGGKKIIGAEVFNAPVTRISV
FT                   SISESVKVLGKFFLRTGRASGQDFVFLLNPF"
FT   gene            531292..532101
FT                   /locus_tag="GBP346_A0572"
FT   CDS_pept        531292..532101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97606"
FT                   /db_xref="GOA:C4KQ66"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ66"
FT                   /protein_id="ACQ97606.1"
FT                   /translation="MLHQNNGFHANALLGSLADDSLRALAPHLELVKIKSAQLLCETDE
FT                   PMRHLYFPTTAMMSVLYLMEDGAMVEVAAVGSEGVVGVSTLADYACGGASGRIEVRSGG
FT                   YAYRVPTQVFRREFDRSIYTFQLMLRYWQAAMTQIARGALCNRHHSVSEQLSRWLLLAH
FT                   DRVEGDELAVTQQTIANMLGVRREGITEAAGKLQEAGLIRQRRGHITVLDREGLEARAC
FT                   ECYGVIRGEFNRLILEARRDAHAPQPIPAEGRPLRVAGYHGAVRSAA"
FT   gene            532134..533516
FT                   /locus_tag="GBP346_A0573"
FT   CDS_pept        532134..533516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0573"
FT                   /product="undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by match to protein family HMM PF02397;
FT                   match to protein family HMM TIGR03023; match to protein
FT                   family HMM TIGR03025"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97947"
FT                   /db_xref="GOA:C4KQ67"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ67"
FT                   /protein_id="ACQ97947.1"
FT                   /translation="MVGLLNKLLDVALVAVGALLAQMLYDGGLFDVSDAQRTAIALLCA
FT                   LTLLVFTAIGVYDGAREQMSYRTLSRVLLGWLGVAAAAAAFTLLLQRDADVSLAWLGRT
FT                   MLMSGAVLLLGRASIHGVLNGLRRTGAKPRAVAIVGSEVYGRAVIEQLRASSLHGYEAV
FT                   CVFDDSARAADAELRVGGVPVVSDLREFKRRVRAGAIKEIWLALPLSHERRIQRIVREF
FT                   RHDFVNLRFLPDVRGITFFNRSVAQVAGMPAINLATSPLSIPQLWPKFIFDRLFALAVL
FT                   IPLSPILAALALAVKLSSPGPVLFRQKRKGVDGREFEILKFRTMRVHAEETGVVRQASR
FT                   NDSRITKVGAFLRRTSLDELPQFFNVLFGQMSVVGPRPHAIEHDDLYKELVDGYMYRYR
FT                   VRPGITGWAQVNGYRGETRKVEKMAARVKFDLFYMQNWTFWFDIKIILITLVKGFVGRN
FT                   AF"
FT   gene            533588..534877
FT                   /locus_tag="GBP346_A0574"
FT   CDS_pept        533588..534877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0574"
FT                   /product="capsular polysaccharide biosynthesis/export
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02563"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96182"
FT                   /db_xref="GOA:C4KQ68"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ68"
FT                   /protein_id="ACQ96182.1"
FT                   /translation="MFKPLAWASATALALSGCALAPGPALDSSRMNDNLSAPTDSTVYD
FT                   VKLITPQLVYTLKQADEADTRAKEAGLAQSLPAASADYRVGPDDVLGIVVWDHPELTRG
FT                   GGNGTGADTSPLADIGTLQASGGLGGVLPQQVSAFGANGQGEVDSPGQRVAANGTIFFP
FT                   TLGRVRVEGMSPVQIAALLARRLDKQIRNPQIDVRVMQYRSQRVQVTGDVKNPGQLSLT
FT                   GSHLRVVDAINRAGGGNPDADLQRVLLTRGDQVMTIDVNRILNRGDLRQNIVLQANDIV
FT                   HVPDRTQNRVFVMGEVPKPQTVYMNQGQLSLADALSAAGSIDPMGANPRQVIVIRHPNP
FT                   PLAQAPGVQSGLQEGLKKVSYAPERNKPEVFRLDMTQVDALMLATEFDMKPLDVVYVGT
FT                   APAARFNRMLSQILPTAESFYLIWSVSRGR"
FT   gene            535058..536302
FT                   /locus_tag="GBP346_A0575"
FT   CDS_pept        535058..536302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0575"
FT                   /product="glycosyl transferase, group 1 family"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96392"
FT                   /db_xref="GOA:C4KQ69"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ69"
FT                   /protein_id="ACQ96392.1"
FT                   /translation="MNLSSPLSKPSPRVRRDRQDFDVTTPSVSQAAGALRDAPPHAAFA
FT                   GDHAGVSALPRPVAINGKFTSQRLTGVQRVAHEFTSALARLLPGERNPTLVVPRDHASD
FT                   TLPPTVARRVVPRLRGALWEQLALPFATRGQTLVSLCNIGPLFKRNQVVMIHDVAVLDF
FT                   PQGYSLKFRLWYRFAFWMLKRRARHILTVSRFSKERIVARLGVAPTDVSTIVSGVDHFG
FT                   RIEGDPSVLDRLGLAYDGYVLIVGSLAPGKNLARTLEAIARLERMRPELRFVIAGGSNV
FT                   RIFGASALGERASAGNVTWAGYVSDGELKALYENAGCFVFPSLYEGFGLPPLEAMYCGC
FT                   PVIVSREASLPEACGDAALYCDAHDAVDIAATIAQLMGDAELRRELREKGRARASRYRW
FT                   DAAAKQLIGVLRALD"
FT   gene            complement(536331..537353)
FT                   /locus_tag="GBP346_A0576"
FT   CDS_pept        complement(536331..537353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99052"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ70"
FT                   /protein_id="ACQ99052.1"
FT                   /translation="MPFPCSRSPLSHVAASRRLLLAGAFCACALAAAPARAQEFALFGG
FT                   LLAGGGGRSYAWAFDYQEGLGRYAAAGFAWYNEGHIPNHHRDGQAVQLWGRLPLRENRF
FT                   VISAGVGPYRYFDTVAATEGRGYSNSHGWGMLMSVRAAYYTSHRWLAQLQVNRTQVFSG
FT                   PNTTSLMFGIGYQLDAPDTPGPRDRAAGRAGRVTANEVTAMLGETILNSRRSPTALGGS
FT                   LEYRRGIAKYVDWTATYLYEGAKQSVRRNGIASQVWLTRAFLDDKIALSAGAGAYLTLN
FT                   ERDIRGRPGEGDGRVSGIVSISASYRFDDRWLARVTWNRVVTRYDRDTDVIQAGLGYRF
FT                   "
FT   gene            complement(537375..537662)
FT                   /locus_tag="GBP346_A0577"
FT   CDS_pept        complement(537375..537662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97547"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ71"
FT                   /protein_id="ACQ97547.1"
FT                   /translation="MEAAFGPLFFCSPHTCVRTAITRRLPRHPAIARRLTWRAAHPHTA
FT                   SPPDASSHARPRGFAASHANPPFSTRDDRDQPGRGRVTTHFIDLRDNLPV"
FT   gene            537948..538382
FT                   /locus_tag="GBP346_A0578"
FT   CDS_pept        537948..538382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0578"
FT                   /product="chrd domain protein"
FT                   /note="identified by match to protein family HMM PF07452"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98587"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ72"
FT                   /protein_id="ACQ98587.1"
FT                   /translation="MLTLRKIGVGMLVCALATGIAHAETVKLVANLQPSSEVPPTTSKG
FT                   AGALDATYDTATRTLRWHATYRDLTGPATAAHFHGPAPVGQNAGVQVPIPKDALASPIV
FT                   GEKALTDEQVGDLMAGKWYFNVHTKAHPAGEIRGQVLPAN"
FT   gene            538474..539439
FT                   /locus_tag="GBP346_A0580"
FT   CDS_pept        538474..539439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0580"
FT                   /product="lipolytic enzyme"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95071"
FT                   /db_xref="GOA:C4KQ73"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ73"
FT                   /protein_id="ACQ95071.1"
FT                   /translation="MSWQSKVACWLLRRQFRPETLRPVIDPARARRLTKLRVRVPRRAP
FT                   AGWRLRERYGPAAAPLRGEWLERADVAPGRAQRGRMLLYFHGGGYYFCSPQTHRPLVFA
FT                   LTKLAGVRSFSLDYRLAPEHPFPAALDDALAAYRQLVSAGTPPESIVFGGDSAGGGLAL
FT                   ATLVALRDAGDPLPSGAVLFSPWTDLAATGDTLRTHDGLDPMFAGAALGRAARLYLGDT
FT                   PGTHPHASPLYADFAGLPPLFIQAGSTEVLLDDSRRVAEKARAAGVHVELEIWPQMPHV
FT                   WQIFVPFVPESARALERAAAFVRRTAVERATQRTADASIA"
FT   gene            complement(539409..540323)
FT                   /locus_tag="GBP346_A0579"
FT   CDS_pept        complement(539409..540323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99166"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ74"
FT                   /protein_id="ACQ99166.1"
FT                   /translation="MEPLTLVAGPPLSAEDLDTLRRAKLALESPSLTIKLTSVVGAPVE
FT                   KMIGKLPGFATDKINDATQLALRKCLHIALRTLGKSGGVASAGETPGKPSNLLHKLAVA
FT                   TTGAAGGAFGLFALPVELPVTTTLMFRSICDIARSEGEDLSSAETQLQCLAVLGMGGGF
FT                   GPLPGAGKDDGQADGDAGGERDKKEEDADIGYFVLRGALAQAVSKASSEIASKGFATHG
FT                   SAALLRLVQSIASRFSVQVTEQIAAKSIPAIGAVLGATVNTLFIDHFQQAAHGHFAVRR
FT                   LERKYGQPAVKAAYQAIDASAVR"
FT   gene            540430..542025
FT                   /locus_tag="GBP346_A0581"
FT   CDS_pept        540430..542025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0581"
FT                   /product="drug resistance MFS transporter, drug:H+
FT                   antiporter-1 family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95680"
FT                   /db_xref="GOA:C4KQ75"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ75"
FT                   /protein_id="ACQ95680.1"
FT                   /translation="MAVHTAAHHSSGQVLPFRESLLAMLGISFVTMLVALDQTVVGTAL
FT                   PTIVAELRGFDLYAWVATSYLLASVITVPIFGRLGDYYGRKPFVIASLVVFTGASVLCA
FT                   MAQDMLSLVLARGLQGIGGGMLVGTAFACIPDLFPDSVVRLRWQVLMSSAFGIANAVGP
FT                   SLGGVLTQNYGWRAVFYVNLPVGLLSIFFVWRYLPHMRHVEHTRKMRLDWPGALLIAVT
FT                   LGAMQLFVEWLPKYGIGGWPTLLLVAALAGGVALWRWEKRCAQPILPFDMFSNRALSTL
FT                   FILAILAGFAMFSLLFYAPLLFQGGFGMSPQQAGVVITPLVVFITIGSIMNGRVITRIR
FT                   RPNAMLYVGFLLFALACAGVVASTHATPGWALMALMVAGGVGLGFVLPNLTVFAQQTAG
FT                   REHLGIATALLQSLRMVGGMLGTALTGTLVNQLYANGVRDALAADGALRWQARLADPQV
FT                   LIDRAAQSRVVDELVRAGHHGAHLLEAARESLVGAIHIGIGVGAFVALAAVWQSRCVPP
FT                   VELRRKLEPAVLAE"
FT   gene            542074..542508
FT                   /locus_tag="GBP346_A0582"
FT   CDS_pept        542074..542508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0582"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97775"
FT                   /db_xref="GOA:C4KQ76"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ76"
FT                   /protein_id="ACQ97775.1"
FT                   /translation="MEEQDRIAILQQFGRTYRAFMSAFEAHVGQPLPRWRIMVALEQHG
FT                   GASSQKRLVELLRVDPGALTRQLKTLETLGWIEREADARDNRVTNVKLTQAGRAAFEAC
FT                   LPRRNAFLHDTMASLPDDVLNALSGALSMLEARVAEAGAK"
FT   gene            complement(542626..543207)
FT                   /locus_tag="GBP346_A0583"
FT   CDS_pept        complement(542626..543207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0583"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM TIGR01382"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97391"
FT                   /db_xref="GOA:C4KQ77"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ77"
FT                   /protein_id="ACQ97391.1"
FT                   /translation="MAAKKILFLTGDFAEDYETMVPFQALLAIGHHVDAVCPGKRAGEK
FT                   VKTAIHDFEGDQTYTEKPGHQFTLNATFDEVDATGYDALAIAGGRAPEYLRLDPKVIAL
FT                   VRAFAEAKKPIAAICHAAQLLAAADVIRGKRISAYPACAPEVRLAGGEFADIPVDAAVT
FT                   DAPFVTAPAWPAHPAWLSQFLALLGTRIEL"
FT   gene            complement(543357..544637)
FT                   /locus_tag="GBP346_A0584"
FT   CDS_pept        complement(543357..544637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0584"
FT                   /product="D-serine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95523"
FT                   /db_xref="GOA:C4KQ78"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ78"
FT                   /protein_id="ACQ95523.1"
FT                   /translation="MKVTNYQEATIDPFGKGLGNVPSASVPLSDAGRLEWNLLAEDVSL
FT                   PAAVLYADRIEHNLKWMQAFVAEYGVKLAPHGKTTMAPQLFRRQLDTGAWGITLATAHQ
FT                   TRAAYHGGVRRVLLANQLVGRHNMAMIAELLTDPDFEFFCLVDSVDGVEQLARFFGAAG
FT                   KPLNVLLELGVPGGRTGVRDDAQRDAVLAAIARHAGVLELAGIELYEGVLKEEGEIRAF
FT                   LRRAVKLVHELASAGRFARAPALLSGAGSAWYDVVADEFAQAAAAGVIDVVLRPGCYLT
FT                   HDVGIYRKAQTDIFARNPIARKMGEGLLPALQLWAYVQSIPEPERAIVALGKRDAAFDA
FT                   GLPEPARHFRPGAGGLPREIAPGEGWEVTGMMDQHAYLKIPTGADLKVGDMVSFDISHP
FT                   CLTFDKWRQLLVVDPQYRVTEVIETYF"
FT   gene            544775..545668
FT                   /locus_tag="GBP346_A0585"
FT   CDS_pept        544775..545668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0585"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95103"
FT                   /db_xref="GOA:C4KQ79"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ79"
FT                   /protein_id="ACQ95103.1"
FT                   /translation="MTPFAEQPAFDIVARIAECAPELRDAERKVAALILGDLAQAAHAS
FT                   IGALAARADVSVATVTRFAKAVGCRDVRELKLRLAQAAAVGQRFLAPAAADAQRDETPV
FT                   SRVYEDVRIALEHNHRLLRQTSFDAAAAALAAANMIYVYGQGGGSTALADELRFRLVRF
FT                   GRPVASYQDALLQRMVAATAAPGCVVVALSVSGRVPEQLESCALAKRYGATLVALTAPA
FT                   SPLAQLADHLIPVVAFETDFIFKPSTSRYAMLMALDVLVTEVALRLGDDCRELLRRMKH
FT                   ALDMHRGGGERQPLGD"
FT   gene            545670..547151
FT                   /locus_tag="GBP346_A0586"
FT   CDS_pept        545670..547151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0586"
FT                   /product="N-acyl-D-aspartate deacylase"
FT                   /EC_number="3.5.1.83"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07908; match to protein
FT                   family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99095"
FT                   /db_xref="GOA:C4KQ80"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ80"
FT                   /protein_id="ACQ99095.1"
FT                   /translation="MHSHPEVADTLIVGAQLYDGTGAPSVERDVAIRGDRIVAIGNLTN
FT                   WLAEQVVEANGRALAPGFVDVHTHDDTHVIDAPQMLPKISQGVTTVIVGNCGISASPVA
FT                   LKGDPPDPMNLLGARAAFRYPTFAAYVDALGAAKPAVNVAALVGHTALRSNQMDRLDRA
FT                   ATGAEIAAMRAQLEEALAHGALGLSSGLAYGSAFAAPTEEVMALAEPLANAGAVYTTHM
FT                   RTEFDAILEAMDEAYRVGRHARVPVVISHLKCAGPSNWGRSAEVLASLERARRIQPVGC
FT                   DCYPYSRSSSTLDIKQATGDIDITITWSDPHPEMAGKLLRTIAAEWRVSEQDAARRLQP
FT                   AGAVYHNMSEDDVRRILSHPATMVGSDGLPNDPLPHPRLWGAFPRVLGYYARDERLISL
FT                   EDAVRKMTALSARRFGLVRRGEVRVGYHADLVLFDAARVRDAATFEQPQQPAHGIEAVW
FT                   VNGALSYRDGAPTGVRAGRFVARGERAPATPGDAF"
FT   gene            547162..547281
FT                   /locus_tag="GBP346_A0587"
FT   CDS_pept        547162..547281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98642"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ81"
FT                   /protein_id="ACQ98642.1"
FT                   /translation="MKDSARAIERMRGPAIERRAPSRIARAARVVKRNEGVKR"
FT   gene            547278..547664
FT                   /locus_tag="GBP346_A0588"
FT   CDS_pept        547278..547664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0588"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97611"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ82"
FT                   /protein_id="ACQ97611.1"
FT                   /translation="MKRYGVGEAKGTGGQVMPFARAVEADGWLYVSGQTPMVNGEVVEG
FT                   GIVTQSKQAIENVIAILKEAGYGLEHVVRCGVWLDDARDFASFNKVFISYFGEHPPARA
FT                   CVQSSMVIDCKVEVDCIAYKAPAK"
FT   gene            complement(548025..548849)
FT                   /gene="queF"
FT                   /locus_tag="GBP346_A0589"
FT   CDS_pept        complement(548025..548849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queF"
FT                   /locus_tag="GBP346_A0589"
FT                   /product="queuine synthase"
FT                   /EC_number="1.7.1.13"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR03138"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98965"
FT                   /db_xref="GOA:C4KQ83"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ83"
FT                   /protein_id="ACQ98965.1"
FT                   /translation="MNPEHSPLGKATVYANQYDASLLFPIPRAGAREQIGIGAPLPFFG
FT                   TDIWNAYELSWLNARGKPQIAIATFYVPAESPNIVESKSFKLYLGSFAQTAFESADAVR
FT                   DALKRDVSAACDASVTVRLATPAEFRKLQMDELDGLSLDRLDLDAHVYETDPSFLTASH
FT                   GEAPVEETLVTDLLKSNCPVTGQPDWGSVQIHYVGAPIDHAGLLRYIISFRNHTGFHEQ
FT                   CVERIFVDILRACQPVKLAVYARYTRRGGLDINPFRTNYNQPMPDNARTARQ"
FT   gene            complement(548869..550392)
FT                   /gene="ilvA_1"
FT                   /locus_tag="GBP346_A0590"
FT   CDS_pept        complement(548869..550392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA_1"
FT                   /locus_tag="GBP346_A0590"
FT                   /product="threonine ammonia-lyase, biosynthetic"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM PF00585; match to protein
FT                   family HMM TIGR01124"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96754"
FT                   /db_xref="GOA:C4KQ84"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ84"
FT                   /protein_id="ACQ96754.1"
FT                   /translation="MASHDYLKKILTARVYDVALETELERARNLSARLNNAVYLKREDN
FT                   QPVFSFKLRGAYNKMAHIPADALARGVITASAGNHAQGVAFSAARMNVKAVIVVPVTTP
FT                   QVKVDAVRAHGGPTVEVIQAGESYSDAYAHAVKVQAERGLTFVHPFDDPYVIAGQGTVA
FT                   MEILRQHQGPIHAIFVPIGGGGLAAGVAAYVKAVRPEIKVIGVQTDDSCAMKQSLAAGR
FT                   RIELTEVGLFSDGTAVKLVGEETFRLCAAYLDEVVTVDTDALCAAIKDVFQDTRSVLEP
FT                   AGSLAVAGAKRYAEQAGIEGETLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIP
FT                   EERGSFKRFCALVGERNVTEFNYRIADARSAHLFVGVQIRRRDESDEIAANFAAHGFTS
FT                   VDLSGDELSKQHIRYMVGGRSPLAHDERLFRFEFPERPGALMKFLSSMAPDWNISLFHY
FT                   RNQGADYSSILVGLQVPQADHAAFDRFLAALGYPFWEESGNPAYRLFLS"
FT   gene            complement(550667..550900)
FT                   /locus_tag="GBP346_A0591"
FT   CDS_pept        complement(550667..550900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96264"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ85"
FT                   /protein_id="ACQ96264.1"
FT                   /translation="MFGRFGGRRAAKEREAGKRVVRDFGEIFCYQARGGLAALGTVTTI
FT                   ARSARAVALQDMLRAATASKGRSETAFASSDP"
FT   gene            550899..554927
FT                   /locus_tag="GBP346_A0592"
FT   CDS_pept        550899..554927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0592"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02754; match to protein
FT                   family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98045"
FT                   /db_xref="GOA:C4KQ86"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ86"
FT                   /protein_id="ACQ98045.1"
FT                   /translation="MNAPQVFDPHGAAAAVAADPAPRLREIPYNYTSFSDREIVIRLLG
FT                   DEAWAALDELRGERRTGRSARMLYEVLGDVWVVRRNPYLQDDLLDNPKRRALLIEALNH
FT                   RLSEIEKRRRADLSEHGDAAGRERAARVEMLAAAAQRAVDEFAQEFEKMAELRRRATKV
FT                   LGRCTQKDNVRFDGLARVSHVTDATDWRVEYPFVVLTPDTEAEIAGLVKACFGLGLTVI
FT                   PRGGGTGYTGGAVPLTPFSAVINTEKLEQLGAVELTELPGVARKVPTIFSGAGVVTRRV
FT                   TEAAEAAGYVFAVDPTSLDASCIGGNVAMNAGGKKAVLWGTALDNLAWWRMVDPDGNWL
FT                   EVTRIEHNLGKIHDIPVARFELKWFDGARAPGEKLLRTETLDIEGRRFRKEGLGKDVTD
FT                   KFLAGLPGVQKEGCDGLITSARWVLHKMPAHTRTVCLEFFGQAREAIPSIVEIKDYLFE
FT                   TSKQGGAILAGLEHLDERYLRAVGYATKSKRQAFPKMVLIGDIVGDDADAVAHATSEVV
FT                   RMANGKSGEGFVAVSAEARKRFWLDRSRTAAIAKHTNAFKINEDVVIPLNRMGEYTDGI
FT                   ERINIELSIKNKLQLVDALEAFFAAGNLPLGKSDDASEIPSAELLEDRVQQALELLKRV
FT                   RARWSFLREKLDMSLREAQHYLVTLGYAALAEKFADRVDAQPDATVFHVTQDRTVRVSW
FT                   KQEIRAELRQIFNGGAFKPILDEAQAIHRQVLRGRVFVALHMHAGDGNVHTNIPVNSDN
FT                   YAMLQDAHAAVARIMTLARSLDGVISGEHGIGITKLEFLTDDEIAEFRAYKQRVDPQGR
FT                   FNKGKLLEGADLRNAYTPSFGLMGYESLIMQQSDIGAIAESVKDCLRCGKCKPVCATHV
FT                   PRANLLYSPRNKILATSLLVEAFLYEEQTRRGVSIKHWDEFNDVADHCTVCHKCATPCP
FT                   VKIDFGDVTMNMRNLLRKMGKKKFNPGSAAGMFFLNATNPQTINATRAVMMGLGYKAQR
FT                   FANDVLKKVAQKQTAHPPSTTGKRPAVEQVIHFVNKKMPGNLPKKTARALLDIEDNKIV
FT                   PIIRDPKTTTVDSEAVFYFPGCGSERLFSQVGLATQAMLWEAGVQTVLPPGYLCCGYPQ
FT                   RGSGQYDKAEKIVTDNRVLFHRVANTLNYLDIKTVVVSCGTCYDQLAGYEFDKIFPGCR
FT                   IIDIHEFLLEKGLKLDGVTGTRYMYHDPCHTPIKTMDPVKLVNDLMGAHNGGYRIEKND
FT                   RCCGESGTLAVARPDVSTQVRFRKEEEIKKGAAKLRNIPVVSGNGANGPEGAAAGASDV
FT                   KILTSCPACLQGLSRYNEDADIEADYIVVEIARHMLGENWMADYVARANNGGIERVLV"
FT   gene            554947..555405
FT                   /locus_tag="GBP346_A0593"
FT   CDS_pept        554947..555405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0593"
FT                   /product="HIT domain protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97262"
FT                   /db_xref="GOA:C4KQ87"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ87"
FT                   /protein_id="ACQ97262.1"
FT                   /translation="MKELTMDCVFCREDGGEVLWKDDAVRVVLATTETDYPGFCRVIWH
FT                   AHVAEFSDLDEAERAHLMRIVYAVEKAVRRVMQPTKVNLASLGNQVPHVHWHVIPRFSN
FT                   DAHYPQPIWAPRQRSVSDALLRLRAAQATLLHNAVHEEIEQAVSGGRA"
FT   gene            555402..555815
FT                   /locus_tag="GBP346_A0594"
FT   CDS_pept        555402..555815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06155"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95570"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ88"
FT                   /protein_id="ACQ95570.1"
FT                   /translation="MSGQAAAAPVPSGIVVHAVSRVLELQYPSGECFRVPFELMRVYSP
FT                   SAEVRGHGPGQETLQTGKREVTVTALEPVGNYALKPTFSDGHSTGIYSWALLYELATRQ
FT                   DALWREYFDKLKAAGVERDAPMPADSLPRGHHH"
FT   gene            555863..556594
FT                   /locus_tag="GBP346_A0595"
FT   CDS_pept        555863..556594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0595"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242; match to protein family HMM TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95069"
FT                   /db_xref="GOA:C4KQ89"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ89"
FT                   /protein_id="ACQ95069.1"
FT                   /translation="MSKTHFGFETVEENEKAKKVAGVFHSVASNYDLMNDLMSAGLHRA
FT                   WKAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAGPTGEVWHTDINESMLRVGRDRLL
FT                   DKGVVTPSLLCDAEKLPFPDNYFDVVTVAFGLRNMTHKDSALAEMRRVAKPGGRVMVLE
FT                   FSKVWEPLKKAYDVYSFKVLPWLGDKFAKDADSYRYLAESIRMHPDQETLKTMMEQAGL
FT                   DAVKYYNLSGGVVALHVGTKY"
FT   gene            556684..557655
FT                   /locus_tag="GBP346_A0596"
FT   CDS_pept        556684..557655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0596"
FT                   /product="Tim44 domain protein"
FT                   /note="identified by match to protein family HMM PF04280"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96797"
FT                   /db_xref="GOA:C4KQ90"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ90"
FT                   /protein_id="ACQ96797.1"
FT                   /translation="MARRIGTFLMVGLLAAGTFASLDAEAKRMGGGRSVGRQSQSLQQR
FT                   QATPPAQQPMQQAAPTQAPRQQPTPAAQPNRSRWLGPIAGLAAGLGIAALLSHLGLGGA
FT                   FAGMMANVIVIALLAMAGIWLVRKFMNRRGAQQPAYAGGQPTLNRGHDGYSQDAGVQRQ
FT                   AAPGGAFPGSGSAYAGEAQRVFGGAAAATAAAAAPAVPAGFDTEAFLRNAKVYFVRLQA
FT                   AWDEGNLADIREFTTPEMFAEVKIDLDGRGAGANQTDVVQLDAELLAVEDRGGEHLASV
FT                   RFHGLIRETQGAAAEPFDEVWNLSKSGSQGWLLAGIQQASTH"
FT   gene            557736..558410
FT                   /locus_tag="GBP346_A0597"
FT   CDS_pept        557736..558410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0597"
FT                   /product="sterol-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96315"
FT                   /db_xref="GOA:C4KQ91"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ91"
FT                   /protein_id="ACQ96315.1"
FT                   /translation="MRGFFIASPMTLAAKPFAAAVNHLLARESWARDRLIPYAGKTARL
FT                   EISPVTLVLLVQPDGYLAAVEAHDARRFDVSIALSSGADGGAFDAAAAFLQGGQAAVMK
FT                   HVKIDGDAEFATQIAKLAEHLRWEPEEDLSSVVGDAAAHRIATVVRSAGARARRTGRNV
FT                   LDSIAEYWLDENPQVVRKSALADFDAGLARARDTLARVEKRIERLEQKIDVRAGGSSRR
FT                   AQ"
FT   gene            558423..560000
FT                   /gene="ubiB"
FT                   /locus_tag="GBP346_A0598"
FT   CDS_pept        558423..560000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="GBP346_A0598"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF03109;
FT                   match to protein family HMM TIGR01982"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97904"
FT                   /db_xref="GOA:C4KQ92"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ92"
FT                   /protein_id="ACQ97904.1"
FT                   /translation="MRIFRFVKIVFTVIRFGLDEVMLSRIENPRVKLLLRITTIGRRFA
FT                   DPPAVRLRRALESLGPIFVKFGQVLSTRRDLLPVDFANELAKLQDQVPPFDSAVAIAIV
FT                   EKSLGARIDVLFDEFERVPVASASIAQVHFAKLKQGEHKGKAVAVKVLRPNMLPVIDSD
FT                   LALMRDIATWAERLWADGRRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDL
FT                   LLVPEMFWDYSTPAVLVMERMTGVPISQVDTLRAAGVDIPKLAREGVEIFFTQVFRDGF
FT                   FHADMHPGNIQVSLDPKHFGRYIALDFGIVGALSDFDKNYLAQNFLAFFKRDYHRVATL
FT                   HLESGWVPPDTRVEELESAIRAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQL
FT                   VLLQKTMLNVEGLGRSLDPELDLWKTAKPYLERWMTEQIGLRGWYERFKVEAPQWSKTL
FT                   PQLPRLVHQALISHHEAPRAISDDLIRQMLVEQRRTNRLLQALLVFGLAVGAGAVIARV
FT                   LIVLAYGG"
FT   gene            559997..560164
FT                   /locus_tag="GBP346_A0599"
FT   CDS_pept        559997..560164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96796"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ93"
FT                   /protein_id="ACQ96796.1"
FT                   /translation="MRRRRRRRRLRGPVPRRPVSAHDAGRCGREVGLKRVRSGFERRPD
FT                   TVHGRREACG"
FT   gene            560190..560969
FT                   /locus_tag="GBP346_A0600"
FT   CDS_pept        560190..560969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0600"
FT                   /product="thiopurine S-methyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF05724;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99087"
FT                   /db_xref="GOA:C4KQ94"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ94"
FT                   /protein_id="ACQ99087.1"
FT                   /translation="MSQGDGVTNEANQPEAAGQATGDAQPASPAGPAHIANPANPANPP
FT                   ALPSFSPPAAASSSASSAAPFSSRDPGDASFWDERFEQGVTPWDSARVPDAFAAFAARH
FT                   ARVPVLIPGCGSAYEARWLARAGWLVRAIDFSAQAVAAARRELGEDAGLVEQADFFTYA
FT                   PPFVPQWIYERAFLCAIPRSRRADYARRMAELLPPGGFLAGFFFIGATPKGPPFGIERA
FT                   ELDALLCPHFALVEDEPVADSLPVFAGRERWLAWRRS"
FT   gene            561070..561411
FT                   /locus_tag="GBP346_A0601"
FT   CDS_pept        561070..561411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0601"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="identified by match to protein family HMM PF09723;
FT                   match to protein family HMM TIGR02605"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98611"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ95"
FT                   /protein_id="ACQ98611.1"
FT                   /translation="MPIYAYRCEACGYAKDVLQKMSDAPLSQCPECGKDAFRKQVTAAG
FT                   FQLKGSGWYVTDFRGGASGSSAPAAGGEKAGGEKAGGETAAAPAAADSTASAPAASTPA
FT                   PAAAPASST"
FT   gene            561482..562129
FT                   /locus_tag="GBP346_A0602"
FT   CDS_pept        561482..562129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0602"
FT                   /product="transmembrane protein"
FT                   /note="identified by match to protein family HMM PF04367"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98545"
FT                   /db_xref="GOA:C4KQ96"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ96"
FT                   /protein_id="ACQ98545.1"
FT                   /translation="MKKTTLKSVFLTGLLVLVPLAITLWVLGLIIGTMDQTLLLLPASW
FT                   QPERLFGFRLPGIGAVLTLAFIFVVGLATQNFIGQKLVTWWNAVVRHIPVVGPIYTSVK
FT                   QVSDTLLSSSGNAFRKALLIEYPRRGSYTIAFLTGTPGGDVVNHLKEEHVSVYVPTTPN
FT                   PTSGFFLMVPKSEVVELDMSVDAALKYIVSMGVVAPPAPVAAPARRPVEPPM"
FT   gene            562186..563988
FT                   /gene="aspS"
FT                   /locus_tag="GBP346_A0603"
FT   CDS_pept        562186..563988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="GBP346_A0603"
FT                   /product="aspartate--tRNA ligase"
FT                   /EC_number="6.1.1.12"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM PF02938; match to protein family HMM TIGR00459"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96082"
FT                   /db_xref="GOA:C4KQ97"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ97"
FT                   /protein_id="ACQ96082.1"
FT                   /translation="MSMRTEYCGLVTEHLLGQTVSLCGWVHRRRDHGGVIFIDLRDREG
FT                   LVQVVCDPDRAEMFAAAEGVRNEFCIQVKGLVRGRPEGTINAGLKSGRIEVLCHELNVL
FT                   NASVTPPFQLDDDNLSETTRLTHRVLDLRRPQMQHNLRLRYRVAIEARKYLDEQGFIDI
FT                   ETPMLTKSTPEGARDYLVPSRVNAGQFFALPQSPQLFKQLLMVANFDRYYQITKCFRDE
FT                   DLRADRQPEFTQIDCETSFLGEQEIRDLFEDMIRHIFKTTIGVELDATFPVMPYSEAMA
FT                   RFGSDKPDLRVKLEFTELTDAMKDVDFKVFSTPANTKDGRVAALRVPKGGELTRGDIDG
FT                   YTEFVRIYGAKGLAWIKVNERAKGRDGLQSPIVKNLHDASIAAILERTGAQDGDIIFFA
FT                   ADRAKVVNDSLGALRLKIGHSEFGKANGLVEAGWKPLWVVDFPMFEYDDEEARYVAAHH
FT                   PFTSPKDEHLEYLETDPGRCLAKAYDMVLNGWEIGGGSVRIHREEVQSKVFRALKIGPE
FT                   EAQAKFGFLLDALQYGAPPHGGIAFGLDRIVTMMAGADSIRDVIAFPKTQRAQCLLTQA
FT                   PSPVDERQLRELHIRLRQPEQPKA"
FT   gene            564198..564674
FT                   /gene="nudB"
FT                   /locus_tag="GBP346_A0604"
FT   CDS_pept        564198..564674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudB"
FT                   /locus_tag="GBP346_A0604"
FT                   /product="dATP pyrophosphohydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98054"
FT                   /db_xref="GOA:C4KQ98"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ98"
FT                   /protein_id="ACQ98054.1"
FT                   /translation="MTKPPKIPESVLVVIHTPALDVLVIKRADQPDFWQSVTGSKDALD
FT                   EPIAQVAAREVAEETGIVVGGPGLAPAALVDWHHAIEYTIYPQYLHRYAPGVTRNVEHW
FT                   FSLEVPARVDVTLSPREHTDYLWLPYREAAARCYSPSNAEAILQLPERLASRAA"
FT   gene            564671..565945
FT                   /locus_tag="GBP346_A0605"
FT   CDS_pept        564671..565945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0605"
FT                   /product="cardiolipin synthetase YbhO"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95825"
FT                   /db_xref="GOA:C4KQ99"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQ99"
FT                   /protein_id="ACQ95825.1"
FT                   /translation="MSGETRHRLAQLRQMFLQERGSASRLAFTSGNAVRLCDGGAAFFP
FT                   ALIERIDAARERVALETYIFCDDAVGRAVSDALVRAAARGVHVRVITDGIGTERLPLFG
FT                   TWPDAGVEHRIYNPYLFGRFGFSRTHRKLAVIDDACAFCGGINIVDDFEQNGERLPHPR
FT                   WDFAVELAGPAVADVRAAFEVQWHRIAAGHKRYAQYLPHDVDGPAFAARFRRWMRSHRW
FT                   VKAGALRVVTEPSVAFVARDNIVNRRAIEKAYLAAIGRARQSILLANPYFMPGRKLRRA
FT                   LAGAARRGVDVRILLGRNEFASLDMAVPFLYHALLRSGVRVAEYDKTMLHGKVAVIDDH
FT                   WATVGSSNLDALSLMLNNEANVVLVRHREETAALRDAIAAAFADGREIDPALYAARPAA
FT                   ERFLNWFAYNAYRSAMKLLTVGGYD"
FT   gene            566135..566734
FT                   /locus_tag="GBP346_A0606"
FT   CDS_pept        566135..566734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0606"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95751"
FT                   /db_xref="GOA:C4KQA0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQA0"
FT                   /protein_id="ACQ95751.1"
FT                   /translation="MRKGEQTRAAILEAALDLASRDGLEGLTIGLLAERMQMSKSGVFA
FT                   HFGSRDDLQVEVVREYHHRFENEVFFPSLREPRGLPRLRAMLARWIEKRIQEVTTGCIY
FT                   ISGAVEYDDRPDSAVREQLIASVKAWRAALLRAISQAKEEGHLRPDTDPNLMLFELYSF
FT                   TLGLHHDARFLHQPDAVRLTWAALEKTIVSYQSESR"
FT   gene            566792..568579
FT                   /locus_tag="GBP346_A0607"
FT   CDS_pept        566792..568579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0607"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97465"
FT                   /db_xref="GOA:C4KQA1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQA1"
FT                   /protein_id="ACQ97465.1"
FT                   /translation="MGQYAAPLRDMQFVLHELLNVEAEVKQMPKHADLDADTINQVLEE
FT                   AGKFCSEVLFPLNQVGDREGCTYVGDGVVKTPTGFKEAYQQYIDAGWPALGCDPDYGGQ
FT                   GLPAFVNNALYEMLNSANQAWTMYPGLSHGAYECLHAHGAPELQKLYLPKLVSGEWTGT
FT                   MCLTEPHCGTDLGILRTKAEPNGDGTYSISGTKIFISSGEHDFSKNIVHLVLARLPDAP
FT                   KGTKGISLFIVPKFVPDASGEPGERNGVKCGSIEHKMGIHGNATCVMNLDNAKGWLIGE
FT                   PNKGLNAMFVMMNAARLGVGMQGLGLTEVAYQNSLTYAKERLQMRSLTGPKAPDKPADP
FT                   IIVHPDVRRMLLTQKAYAEGARAFTYWSALQIDKALSHADEAVRKEAEDLVALLTPIIK
FT                   AFLTDNAFECTNHAMQIYGGHGFISEWGMEQYVRDARINMIYEGTNSVQALDLLGRKVL
FT                   GDMGAKLKKFGKIVAEFAEAEGVKPEMSEFITPLADIGEKVQKLTMEIGMKAMQNPDEV
FT                   GAAAVPYLRTVGHLVFSYFWARMARIALDNEASGDPFYKSKLATARFYFARLLPETAAS
FT                   IRLARAGAKSMMDVDEALF"
FT   gene            568737..571172
FT                   /locus_tag="GBP346_A0608"
FT   CDS_pept        568737..571172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0608"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00378;
FT                   match to protein family HMM PF00725; match to protein
FT                   family HMM PF02737"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99121"
FT                   /db_xref="GOA:C4KQA2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQA2"
FT                   /protein_id="ACQ99121.1"
FT                   /translation="MSNFNIRKVAVLGAGVMGAQIAAHLVNARVPVLLFDLPAKEGPKN
FT                   GIALKAIENLKKLSPAPFGVKDDAKYLEAANYEDDIAKLAECDLVIEAIAERMDWKHDL
FT                   YKKVAPHIASHAIFATNTSGLSITTLSDGFADELKARFCGVHFFNPPRYMHLVELIPTA
FT                   HTRPQILDQLETFLTSVVGKGVVRAKDTPNFIANRVGIFSILAVITEAEKFGLRFDEVD
FT                   DLTGSRLGRAKSATFRTADVVGLDTMAHVIKTMQDNLADDPFFPVYKTPAVLAKLVEQG
FT                   ALGQKTGGGFYKKEGKAIKVLDAKTGAYVDSGAKADETVGRILKRPPAERLKLLRETQH
FT                   PHAQFLWSIFRDVFHYIAFHLESIADNARDVDLAIRWGFGWNEGPFEGWQAASWKQVAE
FT                   WVQEDIAAGRALANVPLPAWVLDGVVAEKGGVHTAEGSWAPAAQRFAPRPDLAVYDKQV
FT                   FRAPVFGEAGRDPKTFGKTLFETDSVRAWVDDRAGEDDVVIVSFKSKMNTIGPGVIDGL
FT                   AQAIELAEKDYKAVVIWQPSSLKLGNPGGPFSAGANLEEAMPAFMMGGAKGIEPFVKKF
FT                   QQGMLRVKYANVPVVAAVSGLALGGGCELMLHSAKRVVHVESYIGLVEVGVGLVPAGGG
FT                   LKEAALRSADAATAAGMTSELLKFLTKPFENAAMAKVSMSAHEARAMGYVKPSDTIVFN
FT                   VFELLDVAKKEARGLAAAGYRAPLKAKEIPVAGRSAIATIKAQLVNMRDGRFISDHDFL
FT                   IASRIAEAVCGGDVEAGSTVDEEWLLALERRAFVELLGTQKTQERIMGMLQTGKPVRN"
FT   gene            571352..572551
FT                   /locus_tag="GBP346_A0609"
FT   CDS_pept        571352..572551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0609"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97689"
FT                   /db_xref="GOA:C4KQA3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQA3"
FT                   /protein_id="ACQ97689.1"
FT                   /translation="MSKQLQDAYIVAASRTPIGKAPRGAFKNTRPDELLVHAIKSAIAQ
FT                   VPEFDTKLIEDAIVGCAIPEAEQGLNVARMGALLAGLPNTVGGVTVNRFCASGITALAM
FT                   AADRIRVGESDALLAAGVESMSMVPMMGNKPSMSPHIFDRSEDFGIAYGMGLTAERVAE
FT                   QWKVSREDQDAFSVESHRKAIAAQQAGEFKDEIAPYAIVERFPNLATGEIDTKTREIAL
FT                   DEGPRAETSLEGLAKLKTVFANKGSVTAGNSSQTSDGSGALLVVSEKVLKQFNLTPLAR
FT                   FVSFAVRGVPPEIMGIGPKEAIPAALKAAGLKQDDIDWIELNEAFAAQSLAVIRDLGLD
FT                   PSKINPLGGAIALGHPLGATGAIRAATVVHGLRRRNLKYGMVTMCVGTGMGAAGIIERL
FT                   "
FT   gene            572568..573410
FT                   /locus_tag="GBP346_A0610"
FT   CDS_pept        572568..573410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0610"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97220"
FT                   /db_xref="GOA:C4KQA4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQA4"
FT                   /protein_id="ACQ97220.1"
FT                   /translation="MTTVRGRRARAPFFVDRMKPATETAQMDIQIENAGGVLTITLARP
FT                   AKKNAITAAMYQTMADALAAAQDDKSVRAILIRGSDGNFSAGNDLDDFMKAPPKDEHAP
FT                   VFQFLRQIAGAHKPIVAAVAGVAVGIGVTMLLHCDLVYAADTAQLSLPFAQLGLCPEAA
FT                   SSLLLPRVAGHQVAAEKLLLGEPFDALEAHRIGLVNRVLPAADLDAFAAQQAAKLVALP
FT                   ASSLRATKAFLKKGSAADIAARMSEEGDQFGKMLRSPEVREAITAFFEKRKPDFRQFD"
FT   gene            complement(573524..574348)
FT                   /locus_tag="GBP346_A0611"
FT   CDS_pept        complement(573524..574348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0611"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="identified by match to protein family HMM PF02634;
FT                   match to protein family HMM TIGR00129"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97023"
FT                   /db_xref="GOA:C4KQA5"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQA5"
FT                   /protein_id="ACQ97023.1"
FT                   /translation="MSLSETVEPSGIVELAVRRRRGDAAETAVDRVGQEWPVALVFNGI
FT                   SHAVMMCTPRDLEAFAVGFAVSEGIVERGSDVKDIEVALHGAGPLPHAEVQLTVVQQAF
FT                   AALKEKRRALAGRTGCGVCGIESIGLLDLVPQRLPDTGFLARLAPDAIARAARELPAHQ
FT                   ALTRQTGGLHAAAWCDASGAIVHAFEDIGRHNALDKLIGTLTLTRADMANGFVFLSSRA
FT                   SYELVRKSARVGIPMVATISAPSSLAIEIARQAGLRLVSFCREAGYVDYGTA"
FT   gene            574504..574962
FT                   /locus_tag="GBP346_A0612"
FT   CDS_pept        574504..574962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09655;
FT                   match to protein family HMM TIGR02664"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96558"
FT                   /db_xref="InterPro:IPR013481"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQA6"
FT                   /protein_id="ACQ96558.1"
FT                   /translation="MLFNFEIESSEDLTYIPMIVRFNLDRFGLRISLEQWQILPLEDRR
FT                   LLARFPADEDVVIEPNFDHALFEMLRTHANVEPSWFQPDEHPAWRSVDAVPDALVAQSG
FT                   LAGLPAPSASQWATLTPFQRYVLTKLSRKPKLNHDFVPAMREFGLAAH"
FT   gene            complement(575022..575420)
FT                   /locus_tag="GBP346_A0613"
FT   CDS_pept        complement(575022..575420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0613"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95685"
FT                   /db_xref="GOA:C4KQA7"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQA7"
FT                   /protein_id="ACQ95685.1"
FT                   /translation="MTDSPMQLPQKPPALRVVPQPSDANVHGDVFGGWIMAQVDIAGSI
FT                   PASRRANGRVATVAVNSFLFKQPVFVGDLLSFYASIVKTGNTSVTVDVEVYAQRMSLMS
FT                   EIVKVTEATLTYVATDSDRRPRALPPLE"
FT   gene            complement(575466..575702)
FT                   /locus_tag="GBP346_A0614"
FT   CDS_pept        complement(575466..575702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0614"
FT                   /product="thioesterase domain protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain
FT                   one or more premature stops and/or frameshifts"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95075"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQA8"
FT                   /protein_id="ACQ95075.1"
FT                   /translation="MSGRPGRPSLRRAARSGHAARSTPRLRGANGSARPARLDLHGPGG
FT                   AAGLLGPAPFHTFSYNFRTLHCLRSRFMPLHAA"
FT   gene            575742..577613
FT                   /locus_tag="GBP346_A0615"
FT   CDS_pept        575742..577613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0615"
FT                   /product="efflux ABC transporter, heavy metal transporter
FT                   (HMT) family, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98676"
FT                   /db_xref="GOA:C4KQA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQA9"
FT                   /protein_id="ACQ98676.1"
FT                   /translation="MRRYPASSEPAPAATGPRNDWQTIRSLLPYLSAYKWRVAFALACL
FT                   IGAKVANLGVPVVMKRIVDSLAAVQHLTALGRAEQSATVVLAGGVGLLVIAYALARLST
FT                   SLFTELREILFSKVTESAVRRLALQVFRHLHGLSLRFHLERQTGGMSRDIERGTRGIQQ
FT                   LISYSLYSILPTLVEVGLVLGFFVVKYEAYYAYVTFAALITYIVFTVKVTNWRTHLRRT
FT                   MNELDSRANSRAIDSLINYETVKYFGNEEWEAQRYDENLKRYRKAAIRSQNSLSFLNFG
FT                   QQAIIGTGLVFILWRATQGVLAGRLTLGDLVLINTFMLQLYIPLNFLGVVYRELKQSLT
FT                   DMDRMFGLLSAAREVDDAPGAGALKVSGARVRFERVDFSYEPSRQILHDVDFTIEAGST
FT                   TAVVGHSGSGKSTLSRLLFRFYDLDRATGGAITIDGQDIRDVKQETLRASIGIVPQDTV
FT                   LFNDTIYYNIAYGRPSATRDEVIAAARAAHIHAFIESLPKGYDTPVGERGLKLSGGEKQ
FT                   RVAIARTILKNPPILVFDEATSALDSRSERAIQHELDQIARHRTTLVIAHRLSTVVHAD
FT                   QIIVMDHGRIVERGTHAQLLRADGLYAQMWALQQQRAAADGAAAEEV"
FT   gene            577625..577813
FT                   /locus_tag="GBP346_A0616"
FT   CDS_pept        577625..577813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98203"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQB0"
FT                   /protein_id="ACQ98203.1"
FT                   /translation="MTLGDAARLGRRAGRNVGRPISRAGSLRMRASEKTARSIARGACS
FT                   AAGRLRKDHRRSRLRRD"
FT   gene            complement(578106..578825)
FT                   /locus_tag="GBP346_A0617"
FT   CDS_pept        complement(578106..578825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0617"
FT                   /product="nucleotidyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97753"
FT                   /db_xref="GOA:C4KQB1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQB1"
FT                   /protein_id="ACQ97753.1"
FT                   /translation="MTHTLDTAMIFAAGRGERMRPLTDTTPKPLLAAGGKPLIVWQIER
FT                   LAAAGIRTIVVNHAWLGAQIEAALGDGARWGVRLRYSAEREALETAGGIARALPLIEDG
FT                   AGAKVFVGVSGDIYTGFDYAALSARADALAGAREPGMHLVMVPNPPFHPAGDFALGDDG
FT                   VLSLDGAPRATFGNIGLYDTRMFRDLPAGTRRALTPYYRKTIAARRATGELYTGAWENV
FT                   GTPAQLGELDAALKAGR"
FT   gene            complement(578829..579863)
FT                   /locus_tag="GBP346_A0618"
FT   CDS_pept        complement(578829..579863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0618"
FT                   /product="phosphotransferase family protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97350"
FT                   /db_xref="GOA:C4KQB2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQB2"
FT                   /protein_id="ACQ97350.1"
FT                   /translation="MTQPPADPRLARLTAWLATFADRYALELASLAPASADASFRRYFR
FT                   VASAAAPGGAAIAVDAPPPEKCREFAQIAQLLDAAGVHVPKVLEHDFDAGFMLVTDLGT
FT                   RPYISALDPAAPAAARPLMRDALDALIRWQLASREGVLPPFDEAFLRREMALMPEWYVG
FT                   RHLGKALSDDARGVLDRTFALLAASAKAQPQGYMLRDFMPRNLMIAEPNPGVLDFQDAV
FT                   YGPLTYDVVSLLRDAFISWDEEFELDCFAYYWEQAKKAGLPVEPDFGEFYRQLEWMGLQ
FT                   RHIKVLGLFARINYRDHKPHYLADLPRFLGYARRVALRYRPLAPFAKLLDDLEGKTADV
FT                   GYTF"
FT   gene            580076..582439
FT                   /locus_tag="GBP346_A0619"
FT   CDS_pept        580076..582439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0619"
FT                   /product="organic solvent tolerance protein"
FT                   /note="identified by match to protein family HMM PF04453"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95329"
FT                   /db_xref="GOA:C4KQB3"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQB3"
FT                   /protein_id="ACQ95329.1"
FT                   /translation="MPPKTLFPLVPACDAAPRKKRLAVALLAVPGLVPAVSQAQLSGAA
FT                   AEPQAFGSPWDLRLAPQLDEHPQKQGGKPATFVLADHTNGTAEQDLAAKGAAEIRRGNA
FT                   AVKADAIHYDQDTDMADAYGKVTVANGGTTFSGPEAHLKVEANQGFMTTPKYRFTATGG
FT                   TGSAERVQLLDSERSVFTNGTYTGCQCSTNPAWYIKGSEFDFDTGADEGVARNGVLFFQ
FT                   GVPLFGSPWLTFPLSGDRRSGFLPPTFSPFSSTNGFELSLPYYFNIAPNRDLTITPHII
FT                   SKRGIFTQATFRYLSTNYSGTLTGEYLPDDRVAHRNRYAIFWQHQQNFGNGFGGYVYYN
FT                   KVSDNLYPEELGSTNQFVNGVQTVYQQEAGLTYNNGPWSVLGRYQHWQTLPPSAAPYGR
FT                   EPQLNVKYTKYNVGGFDFGAEADYSRFRITTADQPEGDRVMFNPYVSYGLYGPGYFFVP
FT                   KAQLHMASYDLTTTTGGVPGQPKRFTYSIPTLSLDTGLVFDRSVRLFGQDFIQTLEPRL
FT                   FYVYTPYRNQSNAPLFDTAVSDFGLAEIFTPNTFVGNDRIADANRLTAALTTRFINPTT
FT                   GDERARFVIAQQYYFTDQRVTLLPTEAPATARHSDLILGASVKLGAGFASETAFQYNVD
FT                   NNQLVKSSVGFGYSPGERRVINVGYRYTRQNPTLSNEPINQILMSAQWPLTRRLYAVGR
FT                   LNYDLASSRVVDGLVGFQYDADCWAFGVGVQRYANGLNSSGQQNSSTRVLAQLVLKGLT
FT                   SIDNGLVTAFRAGVQGYTPLPPAPAPLSRFSNYD"
FT   gene            582500..583852
FT                   /locus_tag="GBP346_A0620"
FT   CDS_pept        582500..583852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0620"
FT                   /product="chaperone SurA"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00639;
FT                   match to protein family HMM PF09312"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97020"
FT                   /db_xref="GOA:C4KQB4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQB4"
FT                   /protein_id="ACQ97020.1"
FT                   /translation="MAMKKTLRFAAVASGLVASLITVAPSASAQALRAQGASLADEVVA
FT                   VVNNDVITGRELDQRVGLIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGI
FT                   VVDNATVQATLGRLAQANGMQLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDS
FT                   KITVSDAEVASYIASQRGPNAGSQQDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQA
FT                   LASGANFERLAKNQSEADDAKKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIRVPD
FT                   GFEIVRLVERRASQNPAASPKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIESGGD
FT                   FEKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNTLQDGQVSNPVRTEYGYHLIQV
FT                   LGRRDAEGSVQQQMDIARQAIGQRKAEQAYSDWLRELRDSSYVQIKLPVAQ"
FT   gene            583874..584923
FT                   /gene="pdxA"
FT                   /locus_tag="GBP346_A0621"
FT   CDS_pept        583874..584923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="GBP346_A0621"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98700"
FT                   /db_xref="GOA:C4KQB5"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQB5"
FT                   /protein_id="ACQ98700.1"
FT                   /translation="MSDRPQPLRIAITTGEPAGVGPELTARALADAATRWPDARFTVLG
FT                   DAGLIAARAAAVGLDWTRMTAAGGGAHVADAHVANAHVANAHVAVAHRALAAPAEAGKL
FT                   NPANGRYVLDLLDAAIDGALAGEYDAIVTAPLQKSTINDAGVPFTGHTEYLAERTRTPH
FT                   VVMMLAGTGERPLRVALATTHLPLRDVSAALTIDGLADTLSIIDRDLRGSFGLAAPRIL
FT                   VTGLNPHAGEHGYLGREEIDVIEPALERARAAGIDARGPYPADTLFQPRYLEHADCVLA
FT                   MFHDQGLPVLKYATFGEGINVTLGLPIIRTSVDHGTALDLAGTGRADPGSLVAAIDTAV
FT                   TMARHRRAG"
FT   gene            584955..585782
FT                   /gene="ksgA"
FT                   /locus_tag="GBP346_A0622"
FT   CDS_pept        584955..585782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="GBP346_A0622"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98270"
FT                   /db_xref="GOA:C4KQB6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQB6"
FT                   /protein_id="ACQ98270.1"
FT                   /translation="MSNSRQHQGHFARKRFGQNFLVDHGVIDAIVAAIRPERGERMVEI
FT                   GPGLGALTGPVIARLATPGSPLHAVELDRDLIGRLEQRFGELLELHAGDALTFDFGSIA
FT                   RPGDEPSLRIIGNLPYNISSPLLFHLMSFAPVVIDQHFMLQNEVVERMVAEPGTKAFSR
FT                   LSVMLQYRYVMDKLIDVPPESFQPPPKVDSAIVRMIPHAPHELPAVDPAVLGEVVTAAF
FT                   SQRRKMLRNTLGGYRDLVDFDALGFDLARRAEDIGVDEYVRVAQAVASARASG"
FT   gene            complement(586049..586987)
FT                   /locus_tag="GBP346_A0623"
FT   CDS_pept        complement(586049..586987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0623"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95985"
FT                   /db_xref="GOA:C4KQB7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQB7"
FT                   /protein_id="ACQ95985.1"
FT                   /translation="MSAVACAPARPSLDLRAIGVMILLCAIWGFQQVAIKSATHAIPPM
FT                   LQAGLRSAIAAVGVWAWARARGTPIFRTDGTLGAGIVAGTLFAGEFVCLFFGLTLTSAA
FT                   RMAIFLYTAPCFTALGLHLFAPGETMRRQQWAGVAIAFAGIAVAFADGFARPAAGGASA
FT                   LAGLAGDALGVLGGVMWAATTVVVRSTSLAHASASKTLFYQLTVSSAVLLGLAVVTRQT
FT                   TFANVTPLAVASLAYQGVIVAFASYLAWYWLLTRYSAARLSVFTFLAPLFGVSFGVLLL
FT                   GDAIGPRFVAAAALVLAGIALVNAPPRGARK"
FT   gene            587038..587754
FT                   /locus_tag="GBP346_A0625"
FT   CDS_pept        587038..587754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0625"
FT                   /product="lactoylglutathione lyase
FT                   (Methylglyoxalase)(Aldoketomutase) (Glyoxalase I) (Glx I)
FT                   (Ketone-aldehyde mutase) (S-D-lactoylglutathione
FT                   methylglyoxal lyase)"
FT                   /EC_number="4.4.1.5"
FT                   /note="identified by match to protein family HMM PF00903;
FT                   match to protein family HMM TIGR00068"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95849"
FT                   /db_xref="GOA:C4KQB8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQB8"
FT                   /protein_id="ACQ95849.1"
FT                   /translation="MSGGQARRDEEQEEGSHGWQADGFGYRKCRKGRGRCVARARRRRR
FT                   VALRAERCASALPSRPATRHDDLNRSIRAPRIGPAARMGDAASGGNRVGLVHSHVQASP
FT                   HGVPIMRLLHTMLRVGDLDRSIKFYTELLGMKLLRRQDYPDGKFTLAFVGYGDERDHTV
FT                   IELTHNWDTKSYELGTGFGHLALEVEDAYKACEQIKAQGGKVTREAGPMKHGTTVIAFV
FT                   EDPDGYKIEFIQRNAH"
FT   gene            complement(587748..587882)
FT                   /locus_tag="GBP346_A0624"
FT   CDS_pept        complement(587748..587882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95508"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQB9"
FT                   /protein_id="ACQ95508.1"
FT                   /translation="MPVTRFAGHASCPGHATGRARPPEHIARPAAGRRGTPRRRDSAQ"
FT   gene            complement(587967..588845)
FT                   /locus_tag="GBP346_A0626"
FT   CDS_pept        complement(587967..588845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0626"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01863"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96352"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQC0"
FT                   /protein_id="ACQ96352.1"
FT                   /translation="MPKRPRPRPAVVALDHRQLDLPLFDGPAASPSPASPPAAPPASSA
FT                   TPPEADRSRRRTLALDGRALEYKLKRSARRTIGFAIDGSGLTITAPRWVTLADIEAAIA
FT                   EKRRWIFNKLAEWQTRAEQRALPQIDWKEGAQIPYLGKPVSIALASAKGALSFDPLAAT
FT                   LELGLPAHASEQQIKDRVQGWLQGEAKRIFGERLVVYAEKLGVTYSMYALSSAATRWGS
FT                   CSSDGKIRLNWRLIHFPMSIVDYVVAHELSHLREMNHSPAFWQTVESIFPEFREARHTL
FT                   KHHPPELLPAL"
FT   gene            complement(588893..589672)
FT                   /locus_tag="GBP346_A0627"
FT   CDS_pept        complement(588893..589672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0627"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96808"
FT                   /db_xref="GOA:C4KQC1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQC1"
FT                   /protein_id="ACQ96808.1"
FT                   /translation="MRFVRSLLLFVYFIVYTVPYATACFIAFPFMRPNARYWMAVGWCK
FT                   STLFVARWLTGIRYRVEGYENLPDGPAVLLPKHQSAWETIALPALMPKPLCYVFKRELL
FT                   YVPFFGWALGMLHMVHINRKDGKNAFDSVIRQGRKRMAEGAWVIMFPEGTRTPVGSQGK
FT                   YKTGGARFAIGAGAPVVPIAHNAGRVWPRNSFTKYPGTVTVSIGQPIDTQGLTPDQLNE
FT                   RVENWIEAEMRRIDPHAYRHERDGARGAARASDAAHP"
FT   gene            complement(589715..590278)
FT                   /locus_tag="GBP346_A0628"
FT   CDS_pept        complement(589715..590278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0628"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF08645;
FT                   match to protein family HMM TIGR01656; match to protein
FT                   family HMM TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98701"
FT                   /db_xref="GOA:C4KQC2"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQC2"
FT                   /protein_id="ACQ98701.1"
FT                   /translation="MPTSLSKKLVVLDRDGVINVDSDAFIKSPDEWIPLPGSLEAIARL
FT                   NHAGYRVVVATNQSGIGRGLFDMATLNAMHLKMHRAAAAVGGRIDAVFFCPHTADDHCD
FT                   CRKPKPGMMKLIAERFEIDPADTPVVGDSLRDLQAGEALGFRPHLVLTGKGKKALAAGG
FT                   LPEGTRVHDDLRAFALDFLSEEHE"
FT   gene            complement(590296..592395)
FT                   /gene="glyS"
FT                   /locus_tag="GBP346_A0629"
FT   CDS_pept        complement(590296..592395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="GBP346_A0629"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97229"
FT                   /db_xref="GOA:C4KQC3"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQC3"
FT                   /protein_id="ACQ97229.1"
FT                   /translation="MTQNHSASLLVELLTEELPPKALARLGDAFAEGIAQRLAARDLIE
FT                   GELAFERYATPRRLAVVVQNVRAVAPERQVREKVLPVSVALDAQGAPSAPLAKKLAALG
FT                   HPNLSIADLERAHDGKAEAFFVNYAAPGATLADGLQAALDETLAKLPIPKVMTYQRPDG
FT                   TDVQFVRPVHRLTVLHGDRIVPVAAFGIDAGDTTLGHRFLSDGLVAIRHANAYADTLRE
FT                   KGRVLAHFAQRRETIRTQLEANANGDQVVMPEALLDEVTSLVEWPVVYPCRFEDEFLQV
FT                   PQECLILTMQTNQKYFALTDAAGKLRSRFLIVSNIETKTPGEIVEGNERVVRPRLADAK
FT                   FFFEQDKKKPLAERVPLLANVVYHNKLGSQLARVERLETLAGEIAPAIGADATVAIRAA
FT                   RLAKADLLTDMVGEFPELQGTMGTYYARHDGEPEDVAIACSEHYQPRFSGDALPTTPVS
FT                   TAVALADKLETIVGIWGIGLAPTGEKDPFALRRHALGVLRLLLEKQLPLDLVWLLRTAY
FT                   ERFAAVPGVAESTDAIHAFFIDRLRGLLRERGYTAGEIDAVLSLNPTRLDDIVARLNAV
FT                   REFTRLAEAEALAAANKRISNILKKSESGANGAVQPALFVEAAEKALAEQLAEVTPRVQ
FT                   SQLEARAYTGALTALAALRAPVDAFFDGVMVNADDPALRANRLALLSALHQQMNCVADI
FT                   SKLAA"
FT   gene            complement(592412..593419)
FT                   /gene="glyQ"
FT                   /locus_tag="GBP346_A0630"
FT   CDS_pept        complement(592412..593419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="GBP346_A0630"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95379"
FT                   /db_xref="GOA:C4KQC4"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQC4"
FT                   /protein_id="ACQ95379.1"
FT                   /translation="MLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIG
FT                   PEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDL
FT                   KQNDVRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLE
FT                   RLAMYLQKVENVYDLVWTEWEEPGPNGPELRRLTYGDVYHQNEVEQSTYNFEQANVELL
FT                   FTFFNSYEAEAKRMIEAQLALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALS
FT                   RLVAQAYYDSREKLGFPMIGNPVPGVPGLTTDAQEAAQPAWAPPLKAERKIDQD"
FT   gene            complement(593675..595381)
FT                   /gene="lnt"
FT                   /locus_tag="GBP346_A0631"
FT   CDS_pept        complement(593675..595381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="GBP346_A0631"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00795;
FT                   match to protein family HMM TIGR00546"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96052"
FT                   /db_xref="GOA:C4KQC5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQC5"
FT                   /protein_id="ACQ96052.1"
FT                   /translation="MAEPISTRSQSSVSSTAAGRALPIWHYPAALLAGAANTLTFAPTP
FT                   HGGWLQLVVFAWLFAQLTRTTSWKHAAATGGAFGFGNFITGIWWLYISMHVYGEMAAPL
FT                   AGGALVLFCLYLSIYPAFSAGLWSLCAGHARNGKAVDARPFSPTWHGAFAFASAWAVGE
FT                   WLRGTVLTGFPWLASGYAQVDGPLAGYASIVGVYGIGWVLALVAALVVQAIVRAREGGG
FT                   GHGRLRDNGGGNGRAAAGAGAAPRASRVAAPALAALAALALGPLLALVSWTVPANAPLT
FT                   VRLLQGNVKQDIKFEEAGIKAAIEMYQKMITEKPADLVVTPETAIAVLIQELPEPFARA
FT                   VRNFSDATDTAVLFGAVGGTVTADGRIVDYTNSLYGVTPHSRDIYRYDKHHLVPFGEFI
FT                   PWGFHWFVDLMKMPLGDFARGAPVQQPFIVRNQPVMADVCYEDIFGEEIAATIRDNPVS
FT                   PGVLVNVTNLAWFGDTIALDQHLQIARMRSLETGRPMLRATNTGMTAAIDAQGRVIGRL
FT                   KPFTIGSLDVRIEGTAGRTPYVTSGNATVLALSLLLLAFGFAFGPGLRRRG"
FT   gene            complement(595424..596311)
FT                   /locus_tag="GBP346_A0632"
FT   CDS_pept        complement(595424..596311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0632"
FT                   /product="magnesium and cobalt efflux protein CorC"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99083"
FT                   /db_xref="GOA:C4KQC6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQC6"
FT                   /protein_id="ACQ99083.1"
FT                   /translation="MNDSYPSRKSSDKPHEKRSLLERLTDIISPEPDSRAELLEILQDA
FT                   HERNLIDADSLSMIEGVFQVSDLCARDIMVPRAQMDALNIADKPEDFIPFVLEKAHSRY
FT                   PVYEDNRDNVIGVLLAKDLLRFYAEEEFDVRGMLRPAVFIPESKRLNVLLHDFRVNRNH
FT                   LAIVVDEYGGVAGLITIEDVLEQIVGDIEDEYDFDEEAGNIIAAPDGRYRVRALTEIEQ
FT                   FNETFGTDFSDDEVDTIGGLITHHFGRVPHRGEKVRLGELLFEIQRGDARQIHVLLVRR
FT                   APLAGRRSGSAGED"
FT   gene            complement(596814..597446)
FT                   /locus_tag="GBP346_A0633"
FT   CDS_pept        complement(596814..597446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0633"
FT                   /product="ChaC family protein"
FT                   /note="identified by match to protein family HMM PF04752;
FT                   match to protein family HMM PF06094"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95323"
FT                   /db_xref="GOA:C4KQC7"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQC7"
FT                   /protein_id="ACQ95323.1"
FT                   /translation="MSRPAPARRAYPPSLGEARYLSDAELAASLGATLERWDRTSDLWL
FT                   FGYGSLIWNPGMPAVEALRAKVHGYHRGLYLWSRVNRGTPEQPGLVLALDRGGSCTGLA
FT                   FRLAGRTAMPHLEALWRREMAMGSYRPAWLPCALAGGERVNALAFVMRRDVPTYTGKLT
FT                   DDVVKAVFGCASGRYGTTLDYVSRTVEALRDSGMPDRALEALLARCR"
FT   gene            complement(597467..598291)
FT                   /locus_tag="GBP346_A0634"
FT   CDS_pept        complement(597467..598291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0634"
FT                   /product="putative conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02130;
FT                   match to protein family HMM TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98721"
FT                   /db_xref="GOA:C4KQC8"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQC8"
FT                   /protein_id="ACQ98721.1"
FT                   /translation="MMKSSRSSKPARAEAAQPAFPRLSLFDAKGKVKTVEAQALRIDFA
FT                   DGRSLMFDLSGSSGDAAVAIVAQHAAPSLRATITLRPEHYDSVTVEVGADENPDFAHDE
FT                   TDGAGDESDESDDDDAQGRDPELDLAVQYGDEIGDAQRKSLPKRKVIAEWLEPAIFSDA
FT                   QFTVRFVGADEGRALNHSYRHKDYATNVLTFAYGEEPDGVTVADLVLCCPVVEKEAREQ
FT                   GKTLVAHYAHLLVHGALHAQGYDHERGEEDAAEMEALEIDILAKLGFPNPYR"
FT   gene            598304..598621
FT                   /locus_tag="GBP346_A0635"
FT   CDS_pept        598304..598621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95236"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQC9"
FT                   /protein_id="ACQ95236.1"
FT                   /translation="MNAVEDTPNGRASGRAFRGAARARRGRRAAVPGDGGRRLGRWSAR
FT                   GVGRAWATGDRRLADGRRMCRPAAGRCRASTAVPAPRRPAQSACGGRRGGARGVEWFGL
FT                   R"
FT   gene            598740..598895
FT                   /locus_tag="GBP346_A0636"
FT   CDS_pept        598740..598895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97833"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQD0"
FT                   /protein_id="ACQ97833.1"
FT                   /translation="MNDRVSRRPNWLNGSTAQRLNGSTAQRLDGSTARRLKRPADSTNH
FT                   PPPRGD"
FT   gene            complement(599020..600084)
FT                   /locus_tag="GBP346_A0637"
FT   CDS_pept        complement(599020..600084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0637"
FT                   /product="PhoH family protein"
FT                   /note="identified by match to protein family HMM PF02562"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98158"
FT                   /db_xref="GOA:C4KQD1"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQD1"
FT                   /protein_id="ACQ98158.1"
FT                   /translation="MKTAQALEFTAPRDDNARLANLCGPLDENLRQIEQALDVTLSRRG
FT                   HRIAIRGRGAKIALAALEDFYNRAREPLSVDDIQLALVEARHPGNPRRNGNGDGEPEID
FT                   VRFRGDPDHPFDEPVVRLGDEPPADEAAPKLYTRRADLRGRTPAQREYLKQILSHDVTF
FT                   GVGPAGTGKTYLAVACAVDALERDQVKRIVLTRPAVEAGERLGFLPGDLAQKVDPYLRP
FT                   LYDALYDLLGFDKTAKMFERQMIEIAPLAYMRGRTLNHAFIILDEAQNTTPEQMKMFLT
FT                   RIGFGSKAVVTGDTSQVDLPRGHKSGLVEAQQVLGGVRGIALTRFTSADVVRHPLVARI
FT                   VEAYDEFHAQHKDE"
FT   gene            complement(600108..601481)
FT                   /gene="miaB"
FT                   /locus_tag="GBP346_A0638"
FT   CDS_pept        complement(600108..601481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="GBP346_A0638"
FT                   /product="tRNA-I(6)A37 thiotransferase enzyme MiaB"
FT                   /note="identified by match to protein family HMM PF00919;
FT                   match to protein family HMM PF01938; match to protein
FT                   family HMM PF04055; match to protein family HMM TIGR00089;
FT                   match to protein family HMM TIGR01574"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97483"
FT                   /db_xref="GOA:C4KQD2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQD2"
FT                   /protein_id="ACQ97483.1"
FT                   /translation="MTKKVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIIL
FT                   FNTCSVREKAQEKVFSDLGRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFG
FT                   PQTLHRLPQMIDARRESGRAQVDITFPEIEKFDHLPPARVEGPSAFVSIMEGCSKYCSY
FT                   CVVPYTRGDEVSRPLDDVLTEVAGLADQGVREVTLLGQNVNAYRGAIAAGSAEIADFAT
FT                   LIEYVADIPGIERIRYTTSHPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKR
FT                   GYTVLEYKSVIRKLRAIRPNLSLSTDIIVGFPGETDADFDKTMALVHEMSYDTSFSFIY
FT                   SPRPGTPAANLADDTPRELKLKRLQHLQATIEENVARISQSMLGKVERILVEGPSRKDP
FT                   NELAGRTENNRVVNFPAPSAAHPRLIGQMIDVKINHAYPHSLRGELVLAHGDASAATH"
FT   gene            complement(601533..601646)
FT                   /locus_tag="GBP346_A0639"
FT   CDS_pept        complement(601533..601646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0639"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97803"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQD3"
FT                   /protein_id="ACQ97803.1"
FT                   /translation="MSRPARAARKAIMESFPGGIFPYAARIARLAARRSVP"
FT   gene            complement(601739..601945)
FT                   /locus_tag="GBP346_A0640"
FT   CDS_pept        complement(601739..601945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96330"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQD4"
FT                   /protein_id="ACQ96330.1"
FT                   /translation="MTTGAIDAHGFAAHRPTGSVRRVAAPRNPACANAHARVLPPVSRK
FT                   ACDGAGSNAARENPHALPRVIAA"
FT   gene            complement(601942..602874)
FT                   /locus_tag="GBP346_A0641"
FT   CDS_pept        complement(601942..602874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0641"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97045"
FT                   /db_xref="GOA:C4KQD5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQD5"
FT                   /protein_id="ACQ97045.1"
FT                   /translation="MDRLGDIRLFVEAAELGSLSAAGRKLNLTPAAASARLAKLEAQVS
FT                   TRLFERSTRRLRLTDEGRLYLNCCRQALQALDDADAMLQEGRNVVSGKVRLSSTADFGR
FT                   HQLLDWLDEFNTRHPEVTFAVTASDSSSNLWQDEIDLAIRFAAPPDGALIARRLAANRR
FT                   VLCASPAFVDRYGTPKDPLDLARFPCNVITVASGPLNVWRFTRGDDTQTYTVPLANAHE
FT                   TNDGGLTREWTIRGYGIALKSIWDIAADVRAGRLRVLLPDWRHHDAPLHAIYHSKRYMA
FT                   PRVRVLLDFLVERFAREEKALEDLLNACR"
FT   gene            603020..604192
FT                   /locus_tag="GBP346_A0642"
FT   CDS_pept        603020..604192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0642"
FT                   /product="inner membrane transport protein YdhP"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96006"
FT                   /db_xref="GOA:C4KQD6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQD6"
FT                   /protein_id="ACQ96006.1"
FT                   /translation="MPLPLLALAISAFAIGTTEFVIMGLLPDIARELAVTLPSAGLLVS
FT                   GYALGVAAGAPLLAVLTSRMPRKAALQLLMAIFIAGNVLCALAQSYGMLMVARVVTSFA
FT                   HGSFFGIGAVVAASLVSADKRASAIALMFTGLTLANVLGVPFGTFVGQTLGWRATFWIV
FT                   AALGVASFAGVAALVPKRRDAAGAALSRELRVLRQPQVWLALAMTVLGFGGVFVVFTYI
FT                   APILEDVTGFAPRAVSLVLVLFGAGLTIGNTIGGRLADRALMPSLVAILVALIAVMAAF
FT                   AKTSHMPAAAAVTVFVWGIAAFATVPPLQSRVVEKAAHAPNLASTLNIGAFNVGNAGGA
FT                   WLGGVALSHGVPLDALPWVAAVVTLAALAVTALAARLDTRVSSGAATAAQ"
FT   gene            604326..604994
FT                   /locus_tag="GBP346_A0643"
FT   CDS_pept        604326..604994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0643"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96606"
FT                   /db_xref="GOA:C4KQD7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQD7"
FT                   /protein_id="ACQ96606.1"
FT                   /translation="MHSPLALVRDVSSQDAAAAADADASHAPFDALERLVGVNLARLRA
FT                   ERQLSLDALARLSGVSRAMLAQIESARSVPSIKVLCKVAAALKVSVAAFLRRHAVNGFE
FT                   HLSAERAVRVVSSNGRFSARALYPEGEPAVAEFHELRIAPLHTEHGAPRAPGTSVNLVV
FT                   SEGTLEVSIHERRQLLATGDAIVFDADQPYTLRNPGDTEARAFRVTVNAEVPPRWHVPA
FT                   "
FT   misc_binding    605127..605278
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element)"
FT   gene            605418..606140
FT                   /gene="ribB"
FT                   /locus_tag="GBP346_A0645"
FT   CDS_pept        605418..606140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="GBP346_A0645"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="identified by match to protein family HMM PF00926;
FT                   match to protein family HMM TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95181"
FT                   /db_xref="GOA:C4KQD8"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQD8"
FT                   /protein_id="ACQ95181.1"
FT                   /translation="MSFPLPSKSAPADAFSDFPLLDAEPVPPRIAAALAALREGRAVVL
FT                   QDDHDRENEADLIVAAERLTDETMALLIRECSGIVCLCLTDEKVRALELPPMAQLNESK
FT                   NGTAFTVSIEARAGVTTGVSAADRVTTIRAAIADNASPHDIVRPGHVFPLRAAPGGVLA
FT                   RRGHTEGTVDLAILAGLKPAGVLCELMNPDGTMARGADVERFAAQHGLPMLTIAELVAF
FT                   RERLASLRERDACCADLA"
FT   gene            complement(606208..606894)
FT                   /locus_tag="GBP346_A0646"
FT   CDS_pept        complement(606208..606894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0646"
FT                   /product="haloacid dehalogenase, IA family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96738"
FT                   /db_xref="GOA:C4KQD9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQD9"
FT                   /protein_id="ACQ96738.1"
FT                   /translation="MLDHLICDCDGVLVDSEVIADRVLFDTLSATFPAIDFTADAKAAF
FT                   GQQTSRFLADLEARHGIAMPANFLDTIEHNIELGLAQWLAPIAGVRDALTRIALPAAVV
FT                   SNSRLARVRNSLKRAALTDVFGERVFSAEQVARPKPYPDVYLHAARTLGVEPARCVVVE
FT                   DSVSGLNAARAAGMKTIAFVGASHIPGGYEDALRKMGITRIMRSMGELPALVEAGMRGE
FT                   FGSQQS"
FT   gene            complement(607024..607890)
FT                   /locus_tag="GBP346_A0647"
FT   CDS_pept        complement(607024..607890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0647"
FT                   /product="integral membrane protein DUF6"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98554"
FT                   /db_xref="GOA:C4KQE0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQE0"
FT                   /protein_id="ACQ98554.1"
FT                   /translation="MAILMGLLSALCWGSTDFLAGHAARRVGVTKSLFYSQSFGFLILT
FT                   ASLALHPSSLRITAIDMGFAVGILAAVCNLIAMAALLRALAIGKASVVAPIVSLYGAVT
FT                   TILSLATGQSITRLAIAGLVLCIVGASLASISKAADGRTESPASIGFALLSAAMFGLGF
FT                   WLQGAFAVKSLGVVSALWIYYLTAVVILFATLARARNLSAPPGSIVLLILSISVFSLVG
FT                   FFSLAYGSTTGHVAIVTVLSSLASGVTALLGFFVRGERPSALQWAGIATIIVGVVMLKI
FT                   TPQALAA"
FT   gene            complement(607967..609187)
FT                   /locus_tag="GBP346_A0648"
FT   CDS_pept        complement(607967..609187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0648"
FT                   /product="ATP-grasp domain protein"
FT                   /note="identified by match to protein family HMM PF02655"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95789"
FT                   /db_xref="GOA:C4KQE1"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQE1"
FT                   /protein_id="ACQ95789.1"
FT                   /translation="MKIFLFVEARPIECAGIGYIRALGYAPVLFTSMQSRNKVLFDDLD
FT                   LNLFDAVHHVDTLDARAMRERIDALRLPVGAVLGCYDDVMIPASELADALGLPHPSLAG
FT                   LRRAYGKERVRDTLRGRGYRQPAYQVLSAERAAPRPDIGFPCVVKPLRDAGAYGVSLCA
FT                   NEADYRAAVERFRSGDGVSMLGSRHREFLAEAFVEGPFYGAELLHNGGRWHVLGINRIF
FT                   VSPRDSLCMTGISHPSDLPAADADAIADEIVEWVNLLGLAGGALNVEFILAETGPVLVE
FT                   INLRIAGARAVRQIALTTGIDMVEHLIDFVCGIDRPIAPREPARYGFVADAFVFAPAAG
FT                   VVRGVAFAPNGAHYVASGFRKLPLESARAAKNFGSVIGYVLAHGRTCDEAMRHARTLAD
FT                   GVRVELG"
FT   gene            complement(609231..610763)
FT                   /gene="asnB_1"
FT                   /locus_tag="GBP346_A0649"
FT   CDS_pept        complement(609231..610763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB_1"
FT                   /locus_tag="GBP346_A0649"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF00733; match to protein
FT                   family HMM TIGR01536"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98687"
FT                   /db_xref="GOA:C4KQE2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQE2"
FT                   /protein_id="ACQ98687.1"
FT                   /translation="MCGIGAIFSTQRASVDGIERSLSALMSKIAHRGDASRFNENLIRE
FT                   RFGLATNRLAIVERDHARQPVSDHERDLHVVLNGQIYNYKELRDELAARGHRFSHAGDA
FT                   EVLLRAYLEYGPSFATKLDGMFSFVLFDNLNGKFLIGRDHVGIKPLYYAQRDGVWYVAS
FT                   ELKALTHVNARIETLAPGTLFDGKETIRYVSYDASRPVSRDSFDEAKARVRTLLEESVR
FT                   RRVDTDLPICVMFSGGIDSAIVLRLAHRYHPDVTAISFGLPGSNDIEIAHRYCAEHGIR
FT                   HVIYTFTKQDLLENIDDAVYYGEFFEKIDAIDSAIAHFGYYIANKLGLKVALCGEGSDE
FT                   IFGGYDLFKTHAQPGALSLYRLNNLHRTDLQRVDRASMRNTVEARVPFMDAELIDYVLS
FT                   LDFSYKLHGGVEKHILREAFRDVLPGYIIDRPKIRMPDGSGVKNVIIDHIDSLGDAPPD
FT                   DAARRLGEIGLSDRSALFFARKYLECNFPFPTQRFKQAGKDFSESGYFDFIS"
FT   gene            complement(610807..612162)
FT                   /locus_tag="GBP346_A0650"
FT   CDS_pept        complement(610807..612162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0650"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="identified by match to protein family HMM PF00275"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ99133"
FT                   /db_xref="GOA:C4KQE3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQE3"
FT                   /protein_id="ACQ99133.1"
FT                   /translation="MTTSDRLQPSFVEVKNTSTLSGTIDLPASKSSSTRALLTAALTPG
FT                   ISTIRNVATGFNSNAMKHNCERLGASFSSEGDTTVVKGVDVMHVDREIVFDPGNSGVVL
FT                   RLLMGVAGYLPDTQFVTQYRYSLGVRSQAEMVAALRRLNVECEAVGPEARLPISMRSTR
FT                   ALGKHTEVSCKKSSQFLSGLLYLGAIGERDLEIDVVDHITAPSMVHTTINNLAHAGVAV
FT                   EYDAAFRRFFVPGRDRFKPSEFTVGADPASTAAILALCGSLASDVTLNGFFEEELGSGA
FT                   VIRYLTDTGTLIDELPGNRIRIRGGASIRAQDFDGSLAPDAVPALAGRAAFAEGTSTFY
FT                   NIEHIRYKESDRISDFRRELDKLGVRSEEKLDQLIIHGNPRGYRGGAVVDGHYDHGLIM
FT                   ALTTIGLHCEHPVLIKEPHHVGQTYPDYFADIGSIGANVDELIYPNVAAARA"
FT   gene            complement(612201..613508)
FT                   /locus_tag="GBP346_A0651"
FT   CDS_pept        complement(612201..613508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0651"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="identified by match to protein family HMM PF00275"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97851"
FT                   /db_xref="GOA:C4KQE4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQE4"
FT                   /protein_id="ACQ97851.1"
FT                   /translation="MSHATVHPSGALKGTVTLPASKPHVQRALLVALLNGATTRIENVS
FT                   WCAETELQFAALRQFGLTVVERGDASLTLRGAGAGVEATGTIDAAGSGMLFRMSAALAS
FT                   LSERPVTIRCNDSLFSRDSVFDDGFFSHLGIDARRRAGNLVTISRKPHPERIALTTRKS
FT                   TQFISFALFVAPFSADRTLRVADDGSQAGYIDMTIKAMSLLHATVTRAPGRLLAGEYRA
FT                   DDIVIGIPTDFTSLSYLASAALSVGARSAIDIANYRPGDTLNEAALFDVYRALGVRLTR
FT                   DDARHALRIECERDRAARRAPRELSLRELPSAATNIIAAASNLGDSIRFGGVDGINNHK
FT                   CQRAFVIHENLRAMGGRSALVFNDVGRFDKIDVMSDGPLQGGAELPSYRDHRICAANIV
FT                   AALGARRKTVVCDTDKLDDGFPKFIDTLRALGAEIA"
FT   gene            complement(613530..614144)
FT                   /locus_tag="GBP346_A0652"
FT   CDS_pept        complement(613530..614144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0652"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97283"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQE5"
FT                   /protein_id="ACQ97283.1"
FT                   /translation="MTNRLPVSFNRPAPTRGQAVLALDDLTDAPRKPDILKSSREAHSS
FT                   HRVNQAISRSSIPVFHAIYLRAKTMSTIDTSEFRKTVFSPSFWEDKMGYARGKRVGNHV
FT                   YIAGCVASDGNAAVIGNDAYEQTAFIIAKIEKYLNELGAELSDVVSTVTHLTGFEHFDD
FT                   YCRAFSERFRDIRPVNTTVAVKSLVEPRHYVEITATAIVGD"
FT   gene            614143..614634
FT                   /locus_tag="GBP346_A0653"
FT   CDS_pept        614143..614634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96228"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQE6"
FT                   /protein_id="ACQ96228.1"
FT                   /translation="MRPRRPRGSGSARRDAACRSRLRERRGEAGRNGRNQDGGRPVRRE
FT                   AARVRATCGAPARGGSHGEPMAEQITFDATGLAIMAILRIGVTGSSRHWNRCDTDFVWA
FT                   DSHRPAQVDRLERAGNIGIDWFADYFDVEGSVQLGKLTTDKNIIIIFNSDGFCVFYLAT
FT                   "
FT   gene            complement(614868..615584)
FT                   /locus_tag="GBP346_A0654"
FT   CDS_pept        complement(614868..615584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0654"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="identified by match to protein family HMM PF00230"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95679"
FT                   /db_xref="GOA:C4KQE7"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQE7"
FT                   /protein_id="ACQ95679.1"
FT                   /translation="MSPYIAEFIGTALLVLLGNGAVANVLLAKTKGKGADLIVIVMGWA
FT                   MAVFVAVYVTASFSGAHLNPIVTISLALAGKFAWAKVGGYVASQMLGGMAGAFLVWLAY
FT                   RQHFAKEADPDLKLAVFCTAPAIRSVTHNVLTEAICTFVLILGVLYLASPQVGLGALDA
FT                   LPVGLLVLGIGISLGGPTGYAMSPARDLSPRIMHALLPIPGKRDSDWRYAWVPVLGPLV
FT                   GGVLAANLYLYLHTTH"
FT   gene            complement(615697..617253)
FT                   /gene="glpK"
FT                   /locus_tag="GBP346_A0655"
FT   CDS_pept        complement(615697..617253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="GBP346_A0655"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97201"
FT                   /db_xref="GOA:C4KQE8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQE8"
FT                   /protein_id="ACQ97201.1"
FT                   /translation="MRRARGANHNYVRMEMRQMQDQYILALDQGTTSSRAMLFDRQGNI
FT                   VSIAQKEFEQIYPQPGWVEHDPQEIWSTQAGVAAEAVTRVGLNGTAIAAIGITNQRETT
FT                   IVWDRETGHPIYNAIVWQDRRTADFCDKLKAQGLSEKVRAKTGLPIDSYFSATKIRWIL
FT                   DNVEGAREKARQGKLAFGTVDSWLVWNFTKHELHVTDVTNASRTMLFNIHTLDWDDELL
FT                   DALEIPRSMLPQVRASSEIYGPTKTTVFASKIPLAGIAGDQQAALFGQMCTSSGMVKNT
FT                   YGTGCFLMMNTGETPIESRNNLVTTIAWQVDGKVSYALEGSIFIAGAVVQWLRDGLGII
FT                   KSASEIEALAAGVPHTDGVYLVPAFAGLGAPHWNARARGSLFGVTRGTTSAHLARAALD
FT                   SIAYQSLDVLKAMEADSGIRIGELRVDGGASANNLLMQFQADLLGVDAVRPRITETTAL
FT                   GAAYLAGLAIGYWQNVDELHSQWQLERRFAPSMQAEQVGSCLAGWQRAVRAAKAWADDT
FT                   Q"
FT   gene            complement(617305..618837)
FT                   /locus_tag="GBP346_A0656"
FT   CDS_pept        complement(617305..618837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0656"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96622"
FT                   /db_xref="GOA:C4KQE9"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQE9"
FT                   /protein_id="ACQ96622.1"
FT                   /translation="MTQQNRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLASHTS
FT                   SSSTKLIHGGLRYLEYKEFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPNLRPAWLI
FT                   RIGLFLYDHLAKRELLPGSRGIDMRRHPAGAPLVDSIKRGFVYSDGWVDDARLVVLNAL
FT                   DAQERGARILTRTKLVSAERRDGQWHARLQRADGSTLDVRARAIANAAGPWVGEVLHGA
FT                   LGRGAQHSVRLVKGSHIITPRLFDHDHAYIFQNPDKRIIFAIPYERDFTLIGTTDVEYR
FT                   DDPSRVAIDRDETRYLCESINRYFKRKISPADVCWTYSGVRPLLEDENADNPSAVTRDY
FT                   RLELDDGEGAPLLSVFGGKITTFRKLAEEATDMLGGALGAARGAWTAGVPLPGGDIANA
FT                   RFAPFAEAFAKRHPWLPAALARRYARAYGTRAERVIGRARSLAELGAQLAPGLYEAELR
FT                   YLRDVEWAGCADDVLWRRSKLGLHVAPGTLEPVTAALDAWFGAAREAASAAH"
FT   gene            619005..619376
FT                   /locus_tag="GBP346_A0657"
FT   CDS_pept        619005..619376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0657"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98100"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQF0"
FT                   /protein_id="ACQ98100.1"
FT                   /translation="MRTMIAAGALALLAGCAGGPAGFGSWGGPSFAQLQRGCGDVRDYG
FT                   DDARSVYSAVFDAWVAKRHGKLTDARFCAFENELAQRHAALGTNADAAARGRWVSYLND
FT                   ARAQALSWRAAVDPSLRGG"
FT   gene            complement(619443..619640)
FT                   /locus_tag="GBP346_A0658"
FT   CDS_pept        complement(619443..619640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97531"
FT                   /db_xref="InterPro:IPR019056"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQF1"
FT                   /protein_id="ACQ97531.1"
FT                   /translation="MLSPHEFATLLLVKDAPDQADMDRDELDALLERQLVKLEALGSGR
FT                   KYCVTEIGDAALRSIKLRYS"
FT   gene            619761..619976
FT                   /locus_tag="GBP346_A0660"
FT   CDS_pept        619761..619976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95458"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQF2"
FT                   /protein_id="ACQ95458.1"
FT                   /translation="MHEARATAPGIWSVVKRAGIYKSHPDNFVIDIKEILRRLHRCGHS
FT                   VISLEVRGATQHRAAPRARAAAQSAT"
FT   gene            complement(619961..620893)
FT                   /gene="glpR"
FT                   /locus_tag="GBP346_A0659"
FT   CDS_pept        complement(619961..620893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpR"
FT                   /locus_tag="GBP346_A0659"
FT                   /product="glycerol-3-phosphate regulon repressor"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220; match to protein
FT                   family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95962"
FT                   /db_xref="GOA:C4KQF3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQF3"
FT                   /protein_id="ACQ95962.1"
FT                   /translation="MRARHESSLAEIGAHARRRAGAPGAGPRTALTMRIRRPRLPSHRA
FT                   EPTPANMTRDPRLTLNARQQELLEWVQRDGFVTVDDLAAHFNVTPQTIRRDVNWLADLN
FT                   LLRRYHGGASLPTSSENVSYTARQRMFHDEKRRIAALAASHIPDQASLFINLGTTTEEV
FT                   ARALNRHHGLRVITNNLNVASMMSGYPECEVLITGGIVRPWDKGIVGELAIDFIRQFKV
FT                   DYAIIGTSSIESDGTLRDFDTREVRVAEAIIQHARTVYLVTDHSKFGRPALVRQGHLSQ
FT                   IHALFTDKPLPDDMAETLVQAGTQVYVAD"
FT   gene            620968..622641
FT                   /locus_tag="GBP346_A0661"
FT   CDS_pept        620968..622641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0661"
FT                   /product="putative gamma-glutamyltransferase"
FT                   /note="identified by match to protein family HMM PF01019"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96879"
FT                   /db_xref="GOA:C4KQF4"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQF4"
FT                   /protein_id="ACQ96879.1"
FT                   /translation="MPVMNLHSNLSGAPFSWRNPYPTTRVPVFARNVVSTSHPLAAQAG
FT                   LRMLWKGGNAVDAAIAAAAAITVVEPVSCGLGGDAFALVWDGAKLHGLNASGVAPAAWS
FT                   VDYFRRRHGEAGNGLARQPVRGWDTVTVPGVIAGWEALHAKFGTLPFADLLEPAIELAE
FT                   RGHAVAAVVAHKWAAAVPELSGQPGFAQTFMPHGRAPEVSERVRLPGHARTLRTIAAEG
FT                   ARAFYEGSLAESIAAFFRDGGGALTLDDLRAYRPEWVEPIGKDFRGYTVHEIPPNGQGI
FT                   AALIALGIVERFGLDDLPLDSAQAQHVQIEAMKLAFADVYRYVADPRAMELTPAQMLDD
FT                   AYLAARAKLIDPRRATHFSFGMPRAGGTIYLSAADERGMMVSFIQSNYMGFGSGLVVPG
FT                   TGIALQNRGCGFSMDPASPNVVAGGKRPFHTIIPAFVTQQAGSARHAVMSFGVMGGDMQ
FT                   PQGHLQTIVRMLGYGQQPQAACDAPRWKVSRSFTLDVEATFDASVVEALAARGHTIQAI
FT                   DDPYMDFGSGQFIWRLDRDEPDRGYVAASDSRRDGLAAGF"
FT   gene            complement(622830..622946)
FT                   /locus_tag="GBP346_A0662"
FT   CDS_pept        complement(622830..622946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0662"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96428"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQF5"
FT                   /protein_id="ACQ96428.1"
FT                   /translation="MFALPNAASHPDGPRGASARDPAACGALKSVIRHVRPS"
FT   gene            622945..623778
FT                   /locus_tag="GBP346_A0663"
FT   CDS_pept        622945..623778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0663"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ96583"
FT                   /db_xref="GOA:C4KQF6"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQF6"
FT                   /protein_id="ACQ96583.1"
FT                   /translation="MLADSNTTHEMPWRIEDIDLTRIDRQRAAANEDLLLLLCAASFIE
FT                   SGSDLYTSNLSQFFDDDPEVSAWLNAEWEHEELQHGRALKAYIAYVWPEFDWDLAFANF
FT                   FEEYSKTCSLEAFEKTRALEMVARCVVETGTATLYRAINECSDEPVLKEITDNIRTDEV
FT                   RHYKHFFRYFKKYNKVEGNGRLAVLGALTRRVLEIKNEDSEIALRHVFAVRYPERAGDS
FT                   AYCRERTARVNALVRRNLSADMCVKMLLKPLELPAKIQPGLHYPLTKLTQHVFFR"
FT   gene            623848..624348
FT                   /locus_tag="GBP346_A0664"
FT   CDS_pept        623848..624348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0664"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95049"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQF7"
FT                   /protein_id="ACQ95049.1"
FT                   /translation="MTDPDRRTLERTTYDAWPRAARALFDGGDLAGKAGFTASLVVVDR
FT                   GVDPPQPRTTLLSVGELYAPDARSLRFSLWPQSRAARALAAHPDATLAFVAGDAFHQAR
FT                   LRVDSSDSTEDGLARFAATLVGGEAQRVGYARLTAGIAFELAEADAPAVLARWARQVAQ
FT                   LRR"
FT   gene            complement(624486..625952)
FT                   /gene="rhlE"
FT                   /locus_tag="GBP346_A0665"
FT   CDS_pept        complement(624486..625952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlE"
FT                   /locus_tag="GBP346_A0665"
FT                   /product="ATP-dependent RNA helicase RhlE"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ95692"
FT                   /db_xref="GOA:C4KQF8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQF8"
FT                   /protein_id="ACQ95692.1"
FT                   /translation="MSFASLGLAEPLVRAVNELGYTQPTPIQAQAIPAVLGGGDLLAGA
FT                   QTGTGKTAGFTLPILQRLHAFYAENRSARRAVRALILTPTRELAAQVEESVRAYSKYVK
FT                   LRSTVMFGGVSINPQIDALKRGVDIVVATPGRLLDHMQQKTIDVSSLDILVLDEADRML
FT                   DMGFIHDIKRVLAKLPAKRQNLLFSATFSDEIKSLADSLLDSPALIEVARRNTTAETIA
FT                   QKIHPVDRDRKRELLTHLIREHNWFQVLVFTRTKHGANRLAEQLTKDGISAMAIHGNKS
FT                   QSARTRALSEFKSSTLQVLVATDIAARGIDIDQLPHVVNFDLPNVPEDYVHRIGRTGRA
FT                   GANGEAVSLVCVDEKQLLRDIERLIKREIPQQVIPGFEPDPNAKPEPIQRRGQRGAVAG
FT                   NGGNGGSGNGNSGGAGNGGRGNRAPRAASQPQAQQGQAAARRDGGTQAKAAKPQQARGG
FT                   NSRPASNGNSNGGGAHANRSRSSRSGQRGR"
FT   gene            complement(626080..627378)
FT                   /locus_tag="GBP346_A0666"
FT   CDS_pept        complement(626080..627378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0666"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98235"
FT                   /db_xref="GOA:C4KQF9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQF9"
FT                   /protein_id="ACQ98235.1"
FT                   /translation="MKRKSLFALSAVAIVAAAALVPVLWPGNDTLHGNAAVAATPADQA
FT                   ALIKKGEYLARVGDCIACHTVRGGKPFAGGLPMATPFGTMYTPNITPDDQAGIGKWTSD
FT                   DFYRAMHTGRSKDGSLLYPGFPFASYTKVTRADSDAIYAYLRSVAPVSTPSRPHELRFP
FT                   FNNRNLLIGWRTLFFKEGEYKPDPTKSVEWNRGAYLVEGLGHCSMCHTSINMMGGPVSS
FT                   AAFAGGLIPLQNWYAPSLTNDKELGLGDWHVQELSDLLQAGVSHKGAVFGPMADVVHNS
FT                   LQYMTDEDTRAMSTYLKSIPQKAEAPKNMQYEPSKQFGTALLEQGKKIYADNCATCHGP
FT                   QGEGKPTAYPPLAQNRSIMMESAVNPIRMVLNGGYPPSTFKNPRPYGMPPFAQSLSNQE
FT                   VAAVVTYIRMSWGNNGSPVSPQQVSDLRSAPLD"
FT   gene            complement(627398..628147)
FT                   /locus_tag="GBP346_A0667"
FT   CDS_pept        complement(627398..628147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0667"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98994"
FT                   /db_xref="GOA:C4KQG0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQG0"
FT                   /protein_id="ACQ98994.1"
FT                   /translation="MSSRRLFRPLLAVVLMGAAGLLSTAHAQTKPTEPAAAKAPLKAPD
FT                   TMAERVRGCTACHGTHGQGTDNDYFPRLAGKPAEYLYNQLVNFRDGRRKYPPMNYLLTY
FT                   LSDDYLREIAQHFSDERPPYPAPTKPTVPAAVVERGKQLALHGDPARKLPACVACHGNG
FT                   LTGMQPAIPGLVGLHSDYLSAQIGAWRSGTRHAKAPDCMHDVASKLSDEDVTAVTAWLA
FT                   AQPAPANPVPAPARSMKTPLACGSEPQ"
FT   gene            628336..628587
FT                   /locus_tag="GBP346_A0668"
FT   CDS_pept        628336..628587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0668"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ97945"
FT                   /db_xref="UniProtKB/TrEMBL:C4KQG1"
FT                   /protein_id="ACQ97945.1"
FT                   /translation="MDGAPQRAEGPTKLRSGRRSPYTCGGAASGHIADARPPLSFLSCE
FT                   SMKSSFSYLPENNGRSFHALRAPRAGAASGARGAGGAR"
FT   gene            628584..629510
FT                   /locus_tag="GBP346_A0669"
FT   CDS_pept        628584..629510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBP346_A0669"
FT                   /product="copper resistance D"
FT                   /note="identified by match to protein family HMM PF05425"
FT                   /db_xref="EnsemblGenomes-Gn:GBP346_A0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ98028"
FT                   /db_xref="GOA:C4KQG2"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL: