(data stored in ACNUC8465 zone)

EMBL: CP001503

ID   CP001503; SV 2; circular; genomic DNA; STD; PRO; 3906507 BP.
XX
AC   CP001503;
XX
PR   Project:PRJNA33901;
XX
DT   03-JUN-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Burkholderia glumae BGR1 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Burkholderia glumae BGR1
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia.
XX
RN   [1]
RP   1-3906507
RX   DOI; 10.1128/JB.00349-09.
RX   PUBMED; 19329631.
RA   Lim J., Lee T.H., Nahm B.H., Choi Y.D., Kim M., Hwang I.;
RT   "Complete genome sequence of Burkholderia glumae BGR1";
RL   J. Bacteriol. 191(11):3758-3759(2009).
XX
RN   [2]
RP   1-3906507
RG   Crop Functional Genomics Center
RA   Hwang I., Lim J., Lee T.H., Nahm B.H., Choi Y.D., Kim M.;
RT   ;
RL   Submitted (10-MAR-2009) to the INSDC.
RL   Department of Agricultural Biotechnology, Seoul National University, Seoul
RL   151-921, Republic of Korea
XX
RN   [3]
RC   Sequence update by submitter
RP   1-3906507
RG   Crop Functional Genomics Center
RA   Hwang I., Lim J., Lee T.H., Nahm B.H., Choi Y.D., Kim M.;
RT   ;
RL   Submitted (05-JUL-2011) to the INSDC.
RL   Department of Agricultural Biotechnology, Seoul National University, Seoul
RL   151-921, Republic of Korea
XX
DR   MD5; e223e43b9717125d9d570f029f72e795.
DR   BioSample; SAMN02603166.
DR   EnsemblGenomes-Gn; EBG00001034905.
DR   EnsemblGenomes-Gn; EBG00001034906.
DR   EnsemblGenomes-Gn; EBG00001034907.
DR   EnsemblGenomes-Gn; EBG00001034908.
DR   EnsemblGenomes-Gn; EBG00001034909.
DR   EnsemblGenomes-Gn; EBG00001034910.
DR   EnsemblGenomes-Gn; EBG00001034911.
DR   EnsemblGenomes-Gn; EBG00001034912.
DR   EnsemblGenomes-Gn; EBG00001034913.
DR   EnsemblGenomes-Gn; EBG00001034914.
DR   EnsemblGenomes-Gn; EBG00001034915.
DR   EnsemblGenomes-Gn; EBG00001034916.
DR   EnsemblGenomes-Gn; EBG00001034917.
DR   EnsemblGenomes-Gn; EBG00001034918.
DR   EnsemblGenomes-Gn; EBG00001034919.
DR   EnsemblGenomes-Gn; EBG00001034920.
DR   EnsemblGenomes-Gn; EBG00001034921.
DR   EnsemblGenomes-Gn; EBG00001034922.
DR   EnsemblGenomes-Gn; EBG00001034923.
DR   EnsemblGenomes-Gn; EBG00001034924.
DR   EnsemblGenomes-Gn; EBG00001034925.
DR   EnsemblGenomes-Gn; EBG00001034926.
DR   EnsemblGenomes-Gn; EBG00001034927.
DR   EnsemblGenomes-Gn; EBG00001034928.
DR   EnsemblGenomes-Gn; EBG00001034929.
DR   EnsemblGenomes-Gn; EBG00001034930.
DR   EnsemblGenomes-Gn; EBG00001034931.
DR   EnsemblGenomes-Gn; EBG00001034932.
DR   EnsemblGenomes-Gn; EBG00001034933.
DR   EnsemblGenomes-Gn; EBG00001034934.
DR   EnsemblGenomes-Gn; EBG00001034935.
DR   EnsemblGenomes-Gn; EBG00001034936.
DR   EnsemblGenomes-Gn; EBG00001034937.
DR   EnsemblGenomes-Gn; EBG00001034938.
DR   EnsemblGenomes-Gn; EBG00001034939.
DR   EnsemblGenomes-Gn; EBG00001034940.
DR   EnsemblGenomes-Gn; EBG00001034941.
DR   EnsemblGenomes-Gn; EBG00001034942.
DR   EnsemblGenomes-Gn; EBG00001034943.
DR   EnsemblGenomes-Gn; EBG00001034944.
DR   EnsemblGenomes-Gn; EBG00001034945.
DR   EnsemblGenomes-Gn; EBG00001034946.
DR   EnsemblGenomes-Gn; EBG00001034947.
DR   EnsemblGenomes-Gn; EBG00001034948.
DR   EnsemblGenomes-Gn; EBG00001034949.
DR   EnsemblGenomes-Gn; EBG00001034950.
DR   EnsemblGenomes-Gn; EBG00001034951.
DR   EnsemblGenomes-Gn; EBG00001034952.
DR   EnsemblGenomes-Gn; EBG00001034953.
DR   EnsemblGenomes-Gn; EBG00001034954.
DR   EnsemblGenomes-Gn; EBG00001034955.
DR   EnsemblGenomes-Gn; EBG00001034956.
DR   EnsemblGenomes-Gn; EBG00001034957.
DR   EnsemblGenomes-Gn; EBG00001034958.
DR   EnsemblGenomes-Gn; EBG00001034959.
DR   EnsemblGenomes-Gn; EBG00001034960.
DR   EnsemblGenomes-Gn; EBG00001034961.
DR   EnsemblGenomes-Gn; EBG00001034962.
DR   EnsemblGenomes-Gn; EBG00001034963.
DR   EnsemblGenomes-Gn; EBG00001034964.
DR   EnsemblGenomes-Gn; EBG00001034965.
DR   EnsemblGenomes-Gn; EBG00001034966.
DR   EnsemblGenomes-Gn; EBG00001034967.
DR   EnsemblGenomes-Gn; EBG00001034968.
DR   EnsemblGenomes-Gn; EBG00001034969.
DR   EnsemblGenomes-Gn; EBG00001034970.
DR   EnsemblGenomes-Gn; EBG00001034971.
DR   EnsemblGenomes-Gn; EBG00001034972.
DR   EnsemblGenomes-Gn; EBG00001034973.
DR   EnsemblGenomes-Gn; EBG00001034974.
DR   EnsemblGenomes-Gn; EBG00001034975.
DR   EnsemblGenomes-Gn; EBG00001034976.
DR   EnsemblGenomes-Gn; EBG00001034977.
DR   EnsemblGenomes-Gn; EBG00001034978.
DR   EnsemblGenomes-Gn; EBG00001034979.
DR   EnsemblGenomes-Gn; EBG00001034980.
DR   EnsemblGenomes-Gn; EBG00001034981.
DR   EnsemblGenomes-Gn; EBG00001034982.
DR   EnsemblGenomes-Gn; EBG00001034983.
DR   EnsemblGenomes-Gn; EBG00001034984.
DR   EnsemblGenomes-Gn; EBG00001034985.
DR   EnsemblGenomes-Gn; EBG00001034986.
DR   EnsemblGenomes-Gn; EBG00001034987.
DR   EnsemblGenomes-Gn; EBG00001034988.
DR   EnsemblGenomes-Gn; EBG00001034989.
DR   EnsemblGenomes-Gn; EBG00001034990.
DR   EnsemblGenomes-Gn; EBG00001034991.
DR   EnsemblGenomes-Gn; EBG00001034992.
DR   EnsemblGenomes-Gn; EBG00001034993.
DR   EnsemblGenomes-Gn; EBG00001034994.
DR   EnsemblGenomes-Gn; EBG00001034995.
DR   EnsemblGenomes-Gn; EBG00001034996.
DR   EnsemblGenomes-Gn; EBG00001034997.
DR   EnsemblGenomes-Gn; EBG00001034998.
DR   EnsemblGenomes-Gn; EBG00001034999.
DR   EnsemblGenomes-Gn; EBG00001035000.
DR   EnsemblGenomes-Gn; EBG00001035001.
DR   EnsemblGenomes-Gn; EBG00001035002.
DR   EnsemblGenomes-Gn; EBG00001035003.
DR   EnsemblGenomes-Gn; EBG00001035004.
DR   EnsemblGenomes-Gn; bglu_1gr01.
DR   EnsemblGenomes-Gn; bglu_1gr02.
DR   EnsemblGenomes-Gn; bglu_1gr03.
DR   EnsemblGenomes-Gn; bglu_1gr04.
DR   EnsemblGenomes-Gn; bglu_1gr05.
DR   EnsemblGenomes-Gn; bglu_1gr06.
DR   EnsemblGenomes-Gn; bglu_1gr07.
DR   EnsemblGenomes-Gn; bglu_1gr08.
DR   EnsemblGenomes-Gn; bglu_1gr09.
DR   EnsemblGenomes-Gn; bglu_1gt01.
DR   EnsemblGenomes-Gn; bglu_1gt02.
DR   EnsemblGenomes-Gn; bglu_1gt03.
DR   EnsemblGenomes-Gn; bglu_1gt04.
DR   EnsemblGenomes-Gn; bglu_1gt05.
DR   EnsemblGenomes-Gn; bglu_1gt06.
DR   EnsemblGenomes-Gn; bglu_1gt07.
DR   EnsemblGenomes-Gn; bglu_1gt08.
DR   EnsemblGenomes-Gn; bglu_1gt09.
DR   EnsemblGenomes-Gn; bglu_1gt10.
DR   EnsemblGenomes-Gn; bglu_1gt11.
DR   EnsemblGenomes-Gn; bglu_1gt12.
DR   EnsemblGenomes-Gn; bglu_1gt13.
DR   EnsemblGenomes-Gn; bglu_1gt14.
DR   EnsemblGenomes-Gn; bglu_1gt15.
DR   EnsemblGenomes-Gn; bglu_1gt16.
DR   EnsemblGenomes-Gn; bglu_1gt17.
DR   EnsemblGenomes-Gn; bglu_1gt18.
DR   EnsemblGenomes-Gn; bglu_1gt19.
DR   EnsemblGenomes-Gn; bglu_1gt20.
DR   EnsemblGenomes-Gn; bglu_1gt21.
DR   EnsemblGenomes-Gn; bglu_1gt22.
DR   EnsemblGenomes-Gn; bglu_1gt23.
DR   EnsemblGenomes-Gn; bglu_1gt24.
DR   EnsemblGenomes-Gn; bglu_1gt25.
DR   EnsemblGenomes-Gn; bglu_1gt26.
DR   EnsemblGenomes-Gn; bglu_1gt27.
DR   EnsemblGenomes-Gn; bglu_1gt28.
DR   EnsemblGenomes-Gn; bglu_1gt29.
DR   EnsemblGenomes-Gn; bglu_1gt30.
DR   EnsemblGenomes-Gn; bglu_1gt31.
DR   EnsemblGenomes-Gn; bglu_1gt32.
DR   EnsemblGenomes-Gn; bglu_1gt33.
DR   EnsemblGenomes-Gn; bglu_1gt34.
DR   EnsemblGenomes-Gn; bglu_1gt35.
DR   EnsemblGenomes-Gn; bglu_1gt36.
DR   EnsemblGenomes-Gn; bglu_1gt37.
DR   EnsemblGenomes-Gn; bglu_1gt38.
DR   EnsemblGenomes-Gn; bglu_1gt39.
DR   EnsemblGenomes-Gn; bglu_1gt40.
DR   EnsemblGenomes-Gn; bglu_1gt41.
DR   EnsemblGenomes-Gn; bglu_1gt42.
DR   EnsemblGenomes-Gn; bglu_1gt43.
DR   EnsemblGenomes-Gn; bglu_1gt44.
DR   EnsemblGenomes-Gn; bglu_1gt45.
DR   EnsemblGenomes-Gn; bglu_1gt46.
DR   EnsemblGenomes-Gn; bglu_1gt47.
DR   EnsemblGenomes-Gn; bglu_1gt48.
DR   EnsemblGenomes-Gn; bglu_1gt49.
DR   EnsemblGenomes-Gn; bglu_1gt50.
DR   EnsemblGenomes-Gn; bglu_1gt51.
DR   EnsemblGenomes-Gn; bglu_1gt52.
DR   EnsemblGenomes-Gn; bglu_1gt53.
DR   EnsemblGenomes-Gn; bglu_1gt54.
DR   EnsemblGenomes-Gn; bglu_1gt55.
DR   EnsemblGenomes-Gn; bglu_1gt56.
DR   EnsemblGenomes-Tr; EBT00001637697.
DR   EnsemblGenomes-Tr; EBT00001637698.
DR   EnsemblGenomes-Tr; EBT00001637699.
DR   EnsemblGenomes-Tr; EBT00001637700.
DR   EnsemblGenomes-Tr; EBT00001637701.
DR   EnsemblGenomes-Tr; EBT00001637702.
DR   EnsemblGenomes-Tr; EBT00001637703.
DR   EnsemblGenomes-Tr; EBT00001637704.
DR   EnsemblGenomes-Tr; EBT00001637705.
DR   EnsemblGenomes-Tr; EBT00001637706.
DR   EnsemblGenomes-Tr; EBT00001637707.
DR   EnsemblGenomes-Tr; EBT00001637708.
DR   EnsemblGenomes-Tr; EBT00001637709.
DR   EnsemblGenomes-Tr; EBT00001637710.
DR   EnsemblGenomes-Tr; EBT00001637711.
DR   EnsemblGenomes-Tr; EBT00001637712.
DR   EnsemblGenomes-Tr; EBT00001637713.
DR   EnsemblGenomes-Tr; EBT00001637714.
DR   EnsemblGenomes-Tr; EBT00001637715.
DR   EnsemblGenomes-Tr; EBT00001637716.
DR   EnsemblGenomes-Tr; EBT00001637717.
DR   EnsemblGenomes-Tr; EBT00001637718.
DR   EnsemblGenomes-Tr; EBT00001637719.
DR   EnsemblGenomes-Tr; EBT00001637720.
DR   EnsemblGenomes-Tr; EBT00001637721.
DR   EnsemblGenomes-Tr; EBT00001637722.
DR   EnsemblGenomes-Tr; EBT00001637723.
DR   EnsemblGenomes-Tr; EBT00001637724.
DR   EnsemblGenomes-Tr; EBT00001637725.
DR   EnsemblGenomes-Tr; EBT00001637726.
DR   EnsemblGenomes-Tr; EBT00001637727.
DR   EnsemblGenomes-Tr; EBT00001637728.
DR   EnsemblGenomes-Tr; EBT00001637729.
DR   EnsemblGenomes-Tr; EBT00001637730.
DR   EnsemblGenomes-Tr; EBT00001637731.
DR   EnsemblGenomes-Tr; EBT00001637732.
DR   EnsemblGenomes-Tr; EBT00001637733.
DR   EnsemblGenomes-Tr; EBT00001637734.
DR   EnsemblGenomes-Tr; EBT00001637735.
DR   EnsemblGenomes-Tr; EBT00001637736.
DR   EnsemblGenomes-Tr; EBT00001637737.
DR   EnsemblGenomes-Tr; EBT00001637738.
DR   EnsemblGenomes-Tr; EBT00001637739.
DR   EnsemblGenomes-Tr; EBT00001637740.
DR   EnsemblGenomes-Tr; EBT00001637741.
DR   EnsemblGenomes-Tr; EBT00001637742.
DR   EnsemblGenomes-Tr; EBT00001637743.
DR   EnsemblGenomes-Tr; EBT00001637744.
DR   EnsemblGenomes-Tr; EBT00001637745.
DR   EnsemblGenomes-Tr; EBT00001637746.
DR   EnsemblGenomes-Tr; EBT00001637747.
DR   EnsemblGenomes-Tr; EBT00001637748.
DR   EnsemblGenomes-Tr; EBT00001637749.
DR   EnsemblGenomes-Tr; EBT00001637750.
DR   EnsemblGenomes-Tr; EBT00001637751.
DR   EnsemblGenomes-Tr; EBT00001637752.
DR   EnsemblGenomes-Tr; EBT00001637753.
DR   EnsemblGenomes-Tr; EBT00001637754.
DR   EnsemblGenomes-Tr; EBT00001637755.
DR   EnsemblGenomes-Tr; EBT00001637756.
DR   EnsemblGenomes-Tr; EBT00001637757.
DR   EnsemblGenomes-Tr; EBT00001637758.
DR   EnsemblGenomes-Tr; EBT00001637759.
DR   EnsemblGenomes-Tr; EBT00001637760.
DR   EnsemblGenomes-Tr; EBT00001637761.
DR   EnsemblGenomes-Tr; EBT00001637762.
DR   EnsemblGenomes-Tr; EBT00001637763.
DR   EnsemblGenomes-Tr; EBT00001637764.
DR   EnsemblGenomes-Tr; EBT00001637765.
DR   EnsemblGenomes-Tr; EBT00001637766.
DR   EnsemblGenomes-Tr; EBT00001637767.
DR   EnsemblGenomes-Tr; EBT00001637768.
DR   EnsemblGenomes-Tr; EBT00001637769.
DR   EnsemblGenomes-Tr; EBT00001637770.
DR   EnsemblGenomes-Tr; EBT00001637771.
DR   EnsemblGenomes-Tr; EBT00001637772.
DR   EnsemblGenomes-Tr; EBT00001637773.
DR   EnsemblGenomes-Tr; EBT00001637774.
DR   EnsemblGenomes-Tr; EBT00001637775.
DR   EnsemblGenomes-Tr; EBT00001637776.
DR   EnsemblGenomes-Tr; EBT00001637777.
DR   EnsemblGenomes-Tr; EBT00001637778.
DR   EnsemblGenomes-Tr; EBT00001637779.
DR   EnsemblGenomes-Tr; EBT00001637780.
DR   EnsemblGenomes-Tr; EBT00001637781.
DR   EnsemblGenomes-Tr; EBT00001637782.
DR   EnsemblGenomes-Tr; EBT00001637783.
DR   EnsemblGenomes-Tr; EBT00001637784.
DR   EnsemblGenomes-Tr; EBT00001637785.
DR   EnsemblGenomes-Tr; EBT00001637786.
DR   EnsemblGenomes-Tr; EBT00001637787.
DR   EnsemblGenomes-Tr; EBT00001637788.
DR   EnsemblGenomes-Tr; EBT00001637789.
DR   EnsemblGenomes-Tr; EBT00001637790.
DR   EnsemblGenomes-Tr; EBT00001637791.
DR   EnsemblGenomes-Tr; EBT00001637792.
DR   EnsemblGenomes-Tr; EBT00001637793.
DR   EnsemblGenomes-Tr; EBT00001637794.
DR   EnsemblGenomes-Tr; EBT00001637795.
DR   EnsemblGenomes-Tr; EBT00001637796.
DR   EnsemblGenomes-Tr; bglu_1gr01-1.
DR   EnsemblGenomes-Tr; bglu_1gr02-1.
DR   EnsemblGenomes-Tr; bglu_1gr03-1.
DR   EnsemblGenomes-Tr; bglu_1gr04-1.
DR   EnsemblGenomes-Tr; bglu_1gr05-1.
DR   EnsemblGenomes-Tr; bglu_1gr06-1.
DR   EnsemblGenomes-Tr; bglu_1gr07-1.
DR   EnsemblGenomes-Tr; bglu_1gr08-1.
DR   EnsemblGenomes-Tr; bglu_1gr09-1.
DR   EnsemblGenomes-Tr; bglu_1gt01-1.
DR   EnsemblGenomes-Tr; bglu_1gt02-1.
DR   EnsemblGenomes-Tr; bglu_1gt03-1.
DR   EnsemblGenomes-Tr; bglu_1gt04-1.
DR   EnsemblGenomes-Tr; bglu_1gt05-1.
DR   EnsemblGenomes-Tr; bglu_1gt06-1.
DR   EnsemblGenomes-Tr; bglu_1gt07-1.
DR   EnsemblGenomes-Tr; bglu_1gt08-1.
DR   EnsemblGenomes-Tr; bglu_1gt09-1.
DR   EnsemblGenomes-Tr; bglu_1gt10-1.
DR   EnsemblGenomes-Tr; bglu_1gt11-1.
DR   EnsemblGenomes-Tr; bglu_1gt12-1.
DR   EnsemblGenomes-Tr; bglu_1gt13-1.
DR   EnsemblGenomes-Tr; bglu_1gt14-1.
DR   EnsemblGenomes-Tr; bglu_1gt15-1.
DR   EnsemblGenomes-Tr; bglu_1gt16-1.
DR   EnsemblGenomes-Tr; bglu_1gt17-1.
DR   EnsemblGenomes-Tr; bglu_1gt18-1.
DR   EnsemblGenomes-Tr; bglu_1gt19-1.
DR   EnsemblGenomes-Tr; bglu_1gt20-1.
DR   EnsemblGenomes-Tr; bglu_1gt21-1.
DR   EnsemblGenomes-Tr; bglu_1gt22-1.
DR   EnsemblGenomes-Tr; bglu_1gt23-1.
DR   EnsemblGenomes-Tr; bglu_1gt24-1.
DR   EnsemblGenomes-Tr; bglu_1gt25-1.
DR   EnsemblGenomes-Tr; bglu_1gt26-1.
DR   EnsemblGenomes-Tr; bglu_1gt27-1.
DR   EnsemblGenomes-Tr; bglu_1gt28-1.
DR   EnsemblGenomes-Tr; bglu_1gt29-1.
DR   EnsemblGenomes-Tr; bglu_1gt30-1.
DR   EnsemblGenomes-Tr; bglu_1gt31-1.
DR   EnsemblGenomes-Tr; bglu_1gt32-1.
DR   EnsemblGenomes-Tr; bglu_1gt33-1.
DR   EnsemblGenomes-Tr; bglu_1gt34-1.
DR   EnsemblGenomes-Tr; bglu_1gt35-1.
DR   EnsemblGenomes-Tr; bglu_1gt36-1.
DR   EnsemblGenomes-Tr; bglu_1gt37-1.
DR   EnsemblGenomes-Tr; bglu_1gt38-1.
DR   EnsemblGenomes-Tr; bglu_1gt39-1.
DR   EnsemblGenomes-Tr; bglu_1gt40-1.
DR   EnsemblGenomes-Tr; bglu_1gt41-1.
DR   EnsemblGenomes-Tr; bglu_1gt42-1.
DR   EnsemblGenomes-Tr; bglu_1gt43-1.
DR   EnsemblGenomes-Tr; bglu_1gt44-1.
DR   EnsemblGenomes-Tr; bglu_1gt45-1.
DR   EnsemblGenomes-Tr; bglu_1gt46-1.
DR   EnsemblGenomes-Tr; bglu_1gt47-1.
DR   EnsemblGenomes-Tr; bglu_1gt48-1.
DR   EnsemblGenomes-Tr; bglu_1gt49-1.
DR   EnsemblGenomes-Tr; bglu_1gt50-1.
DR   EnsemblGenomes-Tr; bglu_1gt51-1.
DR   EnsemblGenomes-Tr; bglu_1gt52-1.
DR   EnsemblGenomes-Tr; bglu_1gt53-1.
DR   EnsemblGenomes-Tr; bglu_1gt54-1.
DR   EnsemblGenomes-Tr; bglu_1gt55-1.
DR   EnsemblGenomes-Tr; bglu_1gt56-1.
DR   EuropePMC; PMC2681909; 19329631.
DR   EuropePMC; PMC4029289; 24883196.
DR   EuropePMC; PMC5341150; 28272446.
DR   EuropePMC; PMC5749808; 29293672.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001503.
DR   SILVA-SSU; CP001503.
XX
CC   On Jul 5, 2011 this sequence version replaced gi:237874878.
CC   Source DNA and bacteria available from Ingyu Hwang
CC   (ingyu@snu.ac.kr).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3906507
FT                   /organism="Burkholderia glumae BGR1"
FT                   /chromosome="1"
FT                   /strain="BGR1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:626418"
FT   gene            100..1704
FT                   /locus_tag="bglu_1g00010"
FT   CDS_pept        100..1704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00010"
FT                   /product="Chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27212"
FT                   /db_xref="GOA:C5A803"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C5A803"
FT                   /protein_id="ACR27212.1"
FT                   /translation="MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDATAQTLSIAAP
FT                   NRFKLDWVKSQFSGRISDLARDFWKAPIDVQFVLDPKAGARGSAPAVAPRPSVGATAAA
FT                   TGMAPAAPAAKPAAAPEVIAQAAPNPAVAAAQAAQAAAHAAAQAAALNADDAADLDLPS
FT                   LTAHEAAAGRRTWRPGSGAPAAGGDAADSTYERSKLNPVLTFDNFVTGKANQLARAAAI
FT                   QVADNPGVSYNPLFLYGGVGLGKTHLIHAIGNQLLLDKSGARIRYIHAEQYVSDVVKAY
FT                   QRKAFDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPK
FT                   EISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVSLSEDVAFFVAKHLRSN
FT                   VRELEGALRKILAYSKFHGREISIELTKEALKDLLTVQNRQISVENIQKTVADFYNIKV
FT                   ADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGK
FT                   DAQLNHELHVLEQTLKG"
FT   gene            1890..2996
FT                   /locus_tag="bglu_1g00020"
FT   CDS_pept        1890..2996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00020"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27213"
FT                   /db_xref="GOA:C5A804"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C5A804"
FT                   /protein_id="ACR27213.1"
FT                   /translation="MQLVKTERDTLLRPLQTVSGIVERRHTLPILANLLITKTGSDVSF
FT                   LSTDLELQITTRADFGVGGEQVATTVAARKLLDILRAMPDGQVTLSLADKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQSKDFGASLAVPQKAFRQLLGMVYFAMAQQDIRYYLNGMLLVV
FT                   DGDQLMAVATDGHRLAYSSMKIDGGTFPRQEVIVPRKTILELQRLLEDIDDVVNIDIAQ
FT                   TQAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFTIGREELQRSLQRAAILTSDKFK
FT                   GVRCIVAPGQLKIMSTNADQEEAQEELEIAYQGDTVDIGFNVTYLLDVLANLKVENIQV
FT                   SLGDASSSALITIPEIDEFKYVVMPMRI"
FT   gene            3234..5711
FT                   /locus_tag="bglu_1g00030"
FT   CDS_pept        3234..5711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00030"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27214"
FT                   /db_xref="GOA:C5A805"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C5A805"
FT                   /protein_id="ACR27214.1"
FT                   /translation="MTEQHNSQPDNSSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGL
FT                   HHLVFEVLDNSIDEALAGYCNDIHVTIHADNSISITDNGRGIPTDVKLDDKHEPKRSAA
FT                   EIVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSSWLRLVVRRNGKKHFMEFHRGVA
FT                   QNRVLETRDGVEVSPMEVVGETENRGTEVHFMADPTIFGTVEYHYDILAKRIRELSFLN
FT                   NGVRIRLTDQRSGKEDDFAFVGGVKGFVEYINKTKSVLHPTIFHIIGEKDGVGVEVAMQ
FT                   WNDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIVDNEIAKKAKVETSGDDMR
FT                   EGLSCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEEVVAKALEEFLLETPNDAKIICSKI
FT                   VEAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKCEIYIVEGDSAGGSAKQ
FT                   GRDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLVTALGCGIGKDDYNLEKLRYHRI
FT                   IIMTDADVDGAHIRTLLLTFLYRQMPDMIERGYVYIAQPPLFKVKAGKDERYLKDEGEL
FT                   NAHMLRLALHGSELQPGGEAAAISGDALGALARSYLLSRGVVERLGRLYDPAALEAIMD
FT                   GVAIDLAGEQAATASAEALQAAMLAGDSMKNEVRVKTRYDEAREHWSLRIERPHHGNVR
FT                   ISVIDEEFLLTADYKQLVSTADTFKDLIGEGALIKRGERSQAVKDFKSAMQWLMADAER
FT                   NVSKQRYKGLGEMNPEQLWETTMDPNVRRLLRVQIEDAIAADGIFTTLMGDEVEPRRAF
FT                   IESNALRAGNIDV"
FT   gene            complement(6160..6441)
FT                   /pseudo
FT                   /locus_tag="bglu_1g00040"
FT                   /note="disrupted gene"
FT   gene            complement(6484..6711)
FT                   /pseudo
FT                   /locus_tag="bglu_1g00050"
FT                   /note="disrupted gene"
FT   gene            6732..6994
FT                   /pseudo
FT                   /locus_tag="bglu_1g00060"
FT                   /note="disrupted gene"
FT   gene            7249..7695
FT                   /pseudo
FT                   /locus_tag="bglu_1g00070"
FT                   /note="disrupted gene"
FT   gene            7770..8594
FT                   /pseudo
FT                   /locus_tag="bglu_1g00080"
FT                   /note="disrupted gene"
FT   gene            complement(8673..8894)
FT                   /pseudo
FT                   /locus_tag="bglu_1g00090"
FT                   /note="disrupted gene"
FT   gene            9189..9545
FT                   /locus_tag="bglu_1g00100"
FT   CDS_pept        9189..9545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00100"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27215"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:C5A806"
FT                   /protein_id="ACR27215.1"
FT                   /translation="MKKLILLIPLLTPIISFAGEFIGGGNVYNDLACTSRDLVASKKEL
FT                   NEIYRKIYASTQYKDELDRSQKAWLNYREKECNGYVAAEASQSQGAGPGLIVKDCLVTI
FT                   TRQRVDYLKRFLER"
FT   gene            complement(9599..10144)
FT                   /locus_tag="bglu_1g00110"
FT   CDS_pept        complement(9599..10144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00110"
FT                   /product="Cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27216"
FT                   /db_xref="GOA:C5A807"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C5A807"
FT                   /protein_id="ACR27216.1"
FT                   /translation="MMNPTSSPSGFSPLARALHWLMAMLIIAMLFIGVGMVGSVSARHT
FT                   VLVAIHKPLGIAILVLVIVRLVVRLRRGAPPLPDDLPWWQKAAAHLSHWVLYALMVAMP
FT                   LIGWAMLSAGGYPVVLGGGVRLPALVAADPVAFAWLRNAHEVLAFVLFATVLLHLAAAL
FT                   FHGLIRRDGVLRSMVRGR"
FT   gene            complement(10141..11214)
FT                   /locus_tag="bglu_1g00120"
FT   CDS_pept        complement(10141..11214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00120"
FT                   /product="Catalase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27217"
FT                   /db_xref="GOA:C5A808"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:C5A808"
FT                   /protein_id="ACR27217.1"
FT                   /translation="MTHPPPSSPRGGQVWRWAVIGGTVAAAAAAFGYTAGWLAPHRLTP
FT                   QRIVAALQANGGLHPGFRRNHAKGICVTGYFESNGDGAAWSSAPFFGAGVRTPVVGRFA
FT                   LPGGNPYAPDTSVPIRSLALRLTAPDGEQWRTGMNAMPVFPVATPRAFYEQTVATRPDP
FT                   ATGKPDPKKVGAFFAAHPETAAFRAWVKTAKPSASFATETYYGINAFYFVDAQGMKHAV
FT                   RWRVVPEQTDGAGVASGANVLQADLAERLGSGPQRWHWLVTFANPGDPVNDATRNWPAD
FT                   RKTLDIGTLVLDRAEAQDSGPCRDINYDPTVLPTGIEPSGDPLLAARSAAYADSYKLRT
FT                   SEEAGVPGYARAAPEAR"
FT   gene            11417..11932
FT                   /locus_tag="bglu_1g00130"
FT   CDS_pept        11417..11932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00130"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27218"
FT                   /db_xref="GOA:C5A809"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C5A809"
FT                   /protein_id="ACR27218.1"
FT                   /translation="MPSADLDDCLRELLPRLRRFALWLTRDAHTADDLVQASLERALTH
FT                   WADRRDDDALRSWLFTILYRQFLDSRRSAKRYAGLLGRIREDDEPQWPSAEDQAVARSM
FT                   LGAFGKLTAEQRSLLLLVAVEGFSYREVAELLEVPIGTVMSRLSRARAALRALGDGQSP
FT                   APSLRLMK"
FT   gene            11929..12717
FT                   /locus_tag="bglu_1g00140"
FT   CDS_pept        11929..12717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00140"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27219"
FT                   /db_xref="GOA:C5A810"
FT                   /db_xref="UniProtKB/TrEMBL:C5A810"
FT                   /protein_id="ACR27219.1"
FT                   /translation="MNIPPDDHDLHAYVDGRLDANERAALERWLDHHPERAGQVRQWRR
FT                   DTQQLRAALDGLALPPATRELDPAALRERRGARRRTRLAIAAALVLSVGLGGGAGWQMR
FT                   GWQMQGAGSQPLASLAMPAAPMGDALTAYRMVVERSARVDLATHRTADLQAWLDRAVGK
FT                   TVRLPDLSRAGFTPVGGRLFATEDGPSAMVLYEDGAGRAVSFYVRPPGGRRLLLKDGSR
FT                   RDGALVAQYGSQRGYNYALVAPTDGVDDAALANALAVTRG"
FT   gene            complement(13397..16441)
FT                   /locus_tag="bglu_1g00150"
FT   CDS_pept        complement(13397..16441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00150"
FT                   /product="Type III restriction system endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27220"
FT                   /db_xref="GOA:C5A811"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5A811"
FT                   /protein_id="ACR27220.1"
FT                   /translation="MELHFEADLDYQREAVDAVCDLFRGQDAPRAAFSVTAAGGGHDDG
FT                   EGTASAARQMPLGVAETALAVGNRLALEPAALARNLAEVQARGGLPPSGALVSTDFTVE
FT                   METGTGKTYVYLRTLFELHRRYGFTKFVIVVPSVAIKEGVHKTLDVTRSHFRRLYDGVP
FT                   FDYFLYDSTRLGQVRRFATSATVQIMVATVAAINRKDVNNLYKPSEKTGGEKPIDLIRA
FT                   TRPILIVDEPQSVDGGLDGRGKEALEAMAPLCTLRYSATHADPHQMVYRLDAVDAYERR
FT                   LVKQIEVASATVEDAHNKPYVRLVSVSNRRGSIAARVELDVATPGGVERQIVSVGDGDL
FT                   LERVTRRAVYGDYRIGEIDTTRGAEFVELRYPGGETFLAVGDAHGDVDPLAIQREMIRR
FT                   TIREHLDKELRLTPLGVKVLSLFFVDSVERYRRYDRGGHAVKGPYAAIFEDEYRRAAKL
FT                   PAYRALFAGFDAERDVAAVHDGYFSIDRKGGWTETSDSNASGRENAERAYGLIMREKER
FT                   LLSFATPLRFIFSHSALKEGWDNPNVFQICTLRDIRTERERRQTIGRGLRLAVDQRGER
FT                   VRGFDVNTLTVIATESYEQFAAHLQKEIEADTGIRFGVVGTHQFAALPVTREDGTPAPL
FT                   GAERSAALWTHLHEAGFLDAQGKVLDALKIVLKGGVLPLPAAFEPLRPRIVELLRKLSG
FT                   RLDVRNADDRRQLEPRRGADGEPVVFGEAFRALWARVQARTTYRVSFDDAALVAASVEA
FT                   LRAAPEVPRARLQWRKADISIGKAGVEATETASAGTVVLDEGDLALPDLLTELQDRTQL
FT                   TRRTLAAVLADSGRLDDFRVNPQAFIALAADAVNRCKRQALIDGITYQRIGDGVVWPLA
FT                   RFVEEPVIAYRKDLREGLRKSVYTAVEVRTAAERAFVDALEATDAVRLYARLPAWFRIP
FT                   TPLGDYRPDWLVLVETPGAPGQCYVVEMDNRTDDAELRGRERRKVQCGEAHFRAIAGAD
FT                   APVHFVRARTVDALLGSTGQTSFAF"
FT   gene            complement(16486..18510)
FT                   /locus_tag="bglu_1g00160"
FT   CDS_pept        complement(16486..18510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00160"
FT                   /product="type III DNA modification methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27221"
FT                   /db_xref="GOA:C5A812"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5A812"
FT                   /protein_id="ACR27221.1"
FT                   /translation="MEDTMRKIESASPEARSADLAADNLERLKALFPEAVTEGPDGAAL
FT                   DLDVLKALVGDRTLGEADEKYGLAWHGKRRARQLALTPSTGTLRPCRDESLDWDGTRNL
FT                   MIEGDNLEVLKLLHKSYAGSVKLVYIDPPYNTGREFVYPDNFADSLRHYLALTGQAAGG
FT                   VKLSSHTEASGRFHTDWLNMMYPRLKLAFDLLARDGLIAIHIDEHELPALVLVMREIFG
FT                   EENELGVAVWDKRNPKGDARGLAYQHESIVLFARDAEWLYQHAPLKRPKRNAQRMLDAA
FT                   REAIATTGGIAEATQAYRAWLRAQTTLSGGEAMYDRLSPDGRVYRLVSMAWPNKKRAPD
FT                   DYFIPLVHPVTGKPCPVPERGWRNPPATMRELLERGLIEFGADETTQPQRIYFLDENRY
FT                   ENVPSILPFGGSDDARLKSLAIPFDLPKPTDFAAALIGWLTGGEDLIVDCFAGSGTTAH
FT                   ATLAANAADGARRRYALVQLPEPLDASNKDQKAAAEFCAKLKRPANLAEITKERLRRAA
FT                   ERIAAEHPEAALDVGFRVFRLDSTNVVEWDPRGANVQQSLLDAVEHVKSGRTDADLLAE
FT                   LAIKLGLDLCAPIDTLPIAGKAVHVIDGAIVACFAARLDRAEAEALALGIVGVLDAVEA
FT                   PPAHDVTCVFRDAAFVDDVARVNLSAILEQHGIRSVRSL"
FT   gene            complement(18847..19626)
FT                   /locus_tag="bglu_1g00170"
FT   CDS_pept        complement(18847..19626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00170"
FT                   /product="Flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27222"
FT                   /db_xref="GOA:C5A813"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:C5A813"
FT                   /protein_id="ACR27222.1"
FT                   /translation="MVSVTYAQLNVWLTAFLWPFVRILALVAAAPLIGNAAVPVRVKIG
FT                   LSALTAIAVAPALGPLPQATVFSAEGIWILVNQFLIGVSMGFVMQIVFAVVEAAGDYIG
FT                   LQMGLGFATFFDPHAGTTPMMGRILNAFAMLAFVAFDGHLQLIAALVESFASVPISADL
FT                   LHPAGWQTLAGAGINVFAMGLLLALPVVAALLIANLALGILNRAAPQIGIFQIGFPVLM
FT                   LVGLLLVQLMVPNMMPFFSRLFDNGYEMMGRVAAGFR"
FT   gene            complement(19661..19933)
FT                   /locus_tag="bglu_1g00180"
FT   CDS_pept        complement(19661..19933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00180"
FT                   /product="Flagellar biosynthesis protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27223"
FT                   /db_xref="GOA:C5A814"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:C5A814"
FT                   /protein_id="ACR27223.1"
FT                   /translation="MTPEAVMTLAHGAMMIGLMLAAPLLLVALVVGLVVSLFQAATQIN
FT                   ESTLSFIPKLLAIVVTMVIAGPWMLTSMLDYTRTILMHVATLGTS"
FT   gene            complement(19947..20747)
FT                   /locus_tag="bglu_1g00190"
FT   CDS_pept        complement(19947..20747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00190"
FT                   /product="Flagellar biosynthetic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27224"
FT                   /db_xref="GOA:C5A815"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C5A815"
FT                   /protein_id="ACR27224.1"
FT                   /translation="MMPSRSGAREARRPRVAALLAVLAPLALLAALALPSLAHAQAAGL
FT                   PAFNSSPGPNGGTTYSLSVQTMLLLTMLSFLPAIVLMMTSFTRIIIVLSLMRQALGTAT
FT                   TPPNQVLVGLALFLTLFVMSPVIDRAYNDGYKPFSAGTLPMDQAVQRGLAPFKTFMLKQ
FT                   TREGDLALFAKIAKAPAMQGPEDVPLPLLVPAFVTSELKTGFQIGFTIFIPFLIIDLVV
FT                   ASVLMSMGMMMVSPTTISLPFKLMLFVLVDGWQLLIGSLAQSFT"
FT   gene            complement(20750..21343)
FT                   /locus_tag="bglu_1g00200"
FT   CDS_pept        complement(20750..21343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00200"
FT                   /product="Flagellar biosynthesis protein, FliO"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27225"
FT                   /db_xref="GOA:C5A816"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:C5A816"
FT                   /protein_id="ACR27225.1"
FT                   /translation="MSDAVRRAASARVSRPSGRSRPAAATTALAAAGLVLAPALARAAD
FT                   MNAVNHASNYASGVVVGSAVPSLGVGAVLQTLVGLAMVIGLVFGCAWLARRFGFQTARR
FT                   GGALKVVASVAVGGKESATVVEIGDTWLVLGVAPGNVRLLHTLPAGSPGVTSAASGTPA
FT                   PGDDALPGSFGERFRSALSGEIAKRLGGRHRKDS"
FT   gene            complement(21340..21774)
FT                   /locus_tag="bglu_1g00210"
FT   CDS_pept        complement(21340..21774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00210"
FT                   /product="Flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27226"
FT                   /db_xref="GOA:C5A817"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C5A817"
FT                   /protein_id="ACR27226.1"
FT                   /translation="MTELNPTPEGKQAGPGEESSLDDWAAALAEQNDQPIASGAGGAGV
FT                   FQPLSKAASNATHNDIDMILDIPVKMTVELGRTKIAIRNLLQLAQGSVVELDGLAGEPM
FT                   DVLVNGCLIAQGEVVVVNDKFGIRLTDIITPSERIRKLNR"
FT   gene            complement(21767..22765)
FT                   /locus_tag="bglu_1g00220"
FT   CDS_pept        complement(21767..22765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00220"
FT                   /product="Flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27227"
FT                   /db_xref="GOA:C5A818"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C5A818"
FT                   /protein_id="ACR27227.1"
FT                   /translation="MGHEEFMSQEEVDALLKGVTGEVDASDEPVEQKGVRPYNLATQER
FT                   IVRGRMPGLEIINDRFARLLRVGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNL
FT                   VHIKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDFTQTEMRIISRLLHLVFE
FT                   HYSVAWKSVRPLQFEHVRSEMHTQFANVATPNEIVIVTQFSIEFGPTGGTLHICMPYSM
FT                   IEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQSAEVELTANLTEMPSTFEKILNLRVGD
FT                   VLPIDVEESIIAKVDGVPVMECGYGIFNGQYALRVNRMISASDTMKEGGYD"
FT   gene            complement(22784..23284)
FT                   /locus_tag="bglu_1g00230"
FT   CDS_pept        complement(22784..23284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00230"
FT                   /product="Flagellar protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27228"
FT                   /db_xref="GOA:C5A819"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:C5A819"
FT                   /protein_id="ACR27228.1"
FT                   /translation="MATTTASASPERPPTGKFKRIFLFALIGLLIAAAGGAAAWFFLLH
FT                   REAPASAAHAAPPQLATPVFFPLESMTVNLQSDDDGLHYLRIGLTLKLTDPTAQDYLTQ
FT                   HMPEIRSRILLALSNKRPSDLATLDGKRALADELRALIEKPTQPGNRSARVDAVLFTDF
FT                   VVQ"
FT   gene            23736..24680
FT                   /locus_tag="bglu_1g00240"
FT   CDS_pept        23736..24680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00240"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27229"
FT                   /db_xref="GOA:C5A820"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5A820"
FT                   /protein_id="ACR27229.1"
FT                   /translation="MELRALRYFIEVVRQQSFTAAAEQMFVTQPTISKMVKALEDEIGS
FT                   PLLLRDSRQMVLTDAGRIVFQRGQDVLAAQAQLQAELDDLAELGRGELTIGIPPLGGAA
FT                   FTPAIAMFRHRYPNIELKLFEEGARTIEAALARGELELGGVLEPVDPAVFEVLRMVHAP
FT                   LWLVSRRGARWDGEGSVPLADLAEEPFVFYAESLALHQAVRDACAKAGFTPSIVSRSGH
FT                   WDFMAALVHAGVGIALLPAPYCRRLDPAQFSCRPIVEPEIEWSIALGWLRRGYLSHAAR
FT                   AWIEVVREVGPVDPDDDLAFDNLRAWGANTSRR"
FT   gene            complement(24793..25254)
FT                   /locus_tag="bglu_1g00250"
FT   CDS_pept        complement(24793..25254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00250"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27230"
FT                   /db_xref="GOA:C5A821"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5A821"
FT                   /protein_id="ACR27230.1"
FT                   /translation="MNGSYDIGSSDLETSVGYYLTRARQAFVERMDQALAPLGLTAQQI
FT                   GVMLLLARGEARTPLELSRRLAYDSGSMTRMLDRLERKGLLERSRSAADRRVIEIGLTG
FT                   RGRDAAEALPGLVAGEMNAQLAGFSADEVRTMTALLQRFIANAPLNAGA"
FT   gene            25569..27092
FT                   /locus_tag="bglu_1g00260"
FT   CDS_pept        25569..27092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00260"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27231"
FT                   /db_xref="GOA:C5A822"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:C5A822"
FT                   /protein_id="ACR27231.1"
FT                   /translation="MQPVVPLRAPQALRIAVSAAVAMLVAGCAVGPDYHRPDVAVPAAY
FT                   KEAPPGWKVAQPDDHADRGQWWKIYHDAQLDELIAKLNASNQTVAQSAAAYRQARALVA
FT                   QARAAYFPTLGATASDTRSSSPGVANSRFSTGRSSTTSYSAGLDASWEPDLWGKVSRNV
FT                   SSQRASEQAAAADLANARLSAQSTLAQTYFQLRAADSAQQLLDDTVASFRRALQLTQNQ
FT                   YAQGVAARSDVIQAQTQLQSAQASAIDNGIARAQYEHAIATLIGVPASSFSLPPMPLAA
FT                   EPPATPAAVPSALLERRPDVAAAERRAAAANEQIGVAIAAFFPTLTLSATGGVQSSAWS
FT                   QLFSLPSRVWTVGPQLAATLFDAGLRAAQTDAARASYDQNVAAYRGTVLSAFQDVEDNL
FT                   ASLRILDQEVVVQRQAVDSAQRALDIVTNQYKSGTVAYLSVLTAQTTAFTAEQKLVQID
FT                   GQRMVSSVGLVKALGGGWDASQMARETGGVEAPAPASAPAAAAAPLAQR"
FT   gene            complement(27206..27982)
FT                   /locus_tag="bglu_1g00270"
FT   CDS_pept        complement(27206..27982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00270"
FT                   /product="General secretory pathway protein N"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27232"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:C5A823"
FT                   /protein_id="ACR27232.1"
FT                   /translation="MPMRFWMRLRASLPWVVTGALAVAVVVVALLPAAWVTPQFARASG
FT                   GHLNLVDPDGSLWHGSATLLLAPGHDLSASTLLPGRIEWQTSFWSLFTGHLRMKMRQTE
FT                   AMPDPITVDATLRGALVSSGAMAVPASLLAGLGTPFNTLDLHGDVRIGWSDWRLFGQQV
FT                   FGQVTLTITDMSSRLSIVKPLGSYRAVWQAQGTNSTLDLSTLKGPLFLQGHGSFGSGAS
FT                   SFNGTARADDAQRENLLGLLNLLGRPIGPGLVSLTF"
FT   gene            complement(28035..28538)
FT                   /locus_tag="bglu_1g00280"
FT   CDS_pept        complement(28035..28538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00280"
FT                   /product="General secretory pathway protein M"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27233"
FT                   /db_xref="GOA:C5A824"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:C5A824"
FT                   /protein_id="ACR27233.1"
FT                   /translation="MKSELNETLAQFWDERNPREKLLLGWGGALLVVVVLYSVLWSPAQ
FT                   VNSEKIATALPGMRQQLAQMTEQANEARSLAAAAQGVAPTGLALRDALAGSLSDHGLQG
FT                   AQLQVVGSGVQVQLKNASFPVWTQWLDDVRKQFKVQVGELHASALKEDGQVDLSAVMQP
FT                   AGAK"
FT   gene            complement(28535..29947)
FT                   /locus_tag="bglu_1g00290"
FT   CDS_pept        complement(28535..29947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00290"
FT                   /product="General secretory pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27234"
FT                   /db_xref="GOA:C5A825"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:C5A825"
FT                   /protein_id="ACR27234.1"
FT                   /translation="MSTLIVVLPPREPAVPLPEWQWPELSFALLDKSGHAQRAGRSSLA
FT                   TLPHAASTVLVVAARDLLLLAAAVPAVKGPKLRQALPNIVEDYLIQDPQSCHIAVDPVA
FT                   LPDGRRVLAVIDREWFRFVVEAFKAAGHRAIRAVPATRCLPVPAEIALAADTAEPAPLP
FT                   DGEAGEPGAAGSVTEAAVISPAEPPAHGLQPARTPIIAAVMARIESVPIDGEIALAAAP
FT                   RVELAIARGALGEGLTAPAASAGSTLAALTADAPFELYTLGAPGAEPQLASVTTQADPD
FT                   AIPGTTPLPFDAFARRALETRFNLCQFDFEVVPWRFDRATLTRLKLPAALAVATLVVAV
FT                   IGVNLHWWRLARERDAISAQITETLLTAFPKTTTVLDPPEQMTRQIDQLRIAAGELSPN
FT                   DFLALASGVARSLGPLPANGIASLDYHDRRLDVGFKPQVKVDPDFGTRLARNGLTGTID
FT                   SSTGKWTIRSGS"
FT   gene            complement(29972..31108)
FT                   /locus_tag="bglu_1g00300"
FT   CDS_pept        complement(29972..31108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00300"
FT                   /product="General secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27235"
FT                   /db_xref="GOA:C5A826"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:C5A826"
FT                   /protein_id="ACR27235.1"
FT                   /translation="MTMRASALLHDSRRCGRRARPSPARQRGVAIISALLVVALTAILV
FT                   SGMLWRQQIQIRRIENQRLLMQAQWIARGALDWTRMILRSEGDTAPGVTYLGGIWTVPI
FT                   AKTKLSDFLGRIGVTDTSGGDDTYLSGEIEDAQAKYNLRNLVSTPAPGVLQISASQVAT
FT                   FKRLLMSLGIDSQLALRIARQIRAGLRYSATRFQTASVPGSGNVPIPQGDSGSNTGRGD
FT                   PGFDDGNDTDASSGAAPLVPTSLDSLLDVNGVTPEIIETLRPFVTVLPTVTPVNLNTAR
FT                   AEVIAALMPGLSVSSAQTIVAHRDTAFFRNVGDAQLAMQSTGAPNVMLDPTQIDVTTSY
FT                   FIVHGRIQHGRAEIDRTSLVYRDPTTHTTRIVRVVDQL"
FT   gene            complement(31105..31782)
FT                   /locus_tag="bglu_1g00310"
FT   CDS_pept        complement(31105..31782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00310"
FT                   /product="General secretory pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27236"
FT                   /db_xref="GOA:C5A827"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C5A827"
FT                   /protein_id="ACR27236.1"
FT                   /translation="MKPTARFKRCGARADRGFTLIEMLIAITILAVLALLSWRGLDQVI
FT                   RGRDRIAAVMEDERTFAQMFDQMRIDARRAVTDDEAGQPPVRVVGNTLQIVRGFDMPGS
FT                   PPRIQVVRYVISGGRVVRYVSPLISDERVLRSTLGDPSVDGWSAVPLMRGVGVITARVY
FT                   VPKIGWTTNMPVADDALGKQNQALRQPVVGNAPPERSVTGLEVGIGATSLRVPVKRVFM
FT                   VGE"
FT   gene            complement(31760..32179)
FT                   /locus_tag="bglu_1g00320"
FT   CDS_pept        complement(31760..32179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00320"
FT                   /product="General secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27237"
FT                   /db_xref="GOA:C5A828"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C5A828"
FT                   /protein_id="ACR27237.1"
FT                   /translation="MTMAAPLPLARRAPRAAAHGFTMIEVLIALAIIAVALAASIRAVG
FT                   TLASNAGALNDRLLASWSADNALGQLRLAHAWPDIGEQQFDCSQGNVALTCTERVSSTP
FT                   NPTFRRVEVAVRKTGEASVLAQMVTVVANETNRSL"
FT   gene            complement(32176..32667)
FT                   /locus_tag="bglu_1g00330"
FT   CDS_pept        complement(32176..32667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00330"
FT                   /product="General secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27238"
FT                   /db_xref="GOA:C5A829"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:C5A829"
FT                   /protein_id="ACR27238.1"
FT                   /translation="MRAPGTTALRHPPSRMRGFTLLEMLVVLVIAGILVSAATLTMHRN
FT                   PRTDLREEAQRVALLLESAGDEAQVRARPIAWQPTDHGFRFDIRGEDGWHTLRDDLYRP
FT                   RDWDGGVTGASIDYPGSDTPATRIVFGTEPVDVPVRITLYSGIGSVTIVGTGNGRYEVR
FT                   "
FT   gene            complement(32714..33166)
FT                   /locus_tag="bglu_1g00340"
FT   CDS_pept        complement(32714..33166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00340"
FT                   /product="General secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27239"
FT                   /db_xref="GOA:C5A830"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:C5A830"
FT                   /protein_id="ACR27239.1"
FT                   /translation="MQTWINRRTPVARRQRGFTLIEIMVVIAILGILAALIVPKIMSRP
FT                   DEARRVAAKQDIGTIMQALKLYRLDNGRYPTQEQGLQALIAKPTVDPVPNNWKDGGYLE
FT                   RLPNDPWGNPYKYLNPGVHGEIDVFSYGADAKEGGENNDADIGSWQ"
FT   gene            33316..33726
FT                   /locus_tag="bglu_1g00350"
FT   CDS_pept        33316..33726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00350"
FT                   /product="General secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27240"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="UniProtKB/TrEMBL:C5A831"
FT                   /protein_id="ACR27240.1"
FT                   /translation="MNALSIRILSLALFAALCATATYWAITLSAHQAPLPAAAVRAPLR
FT                   TEDAAVLFGGQLTHNPVEDVHLFGILALRQGAAAIVGIGDNPTRTITIGDQIAQGTKLA
FT                   EVRARSIIIDRKGARTEIFLPANTPGPAIYVR"
FT   gene            complement(33808..35025)
FT                   /locus_tag="bglu_1g00360"
FT   CDS_pept        complement(33808..35025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00360"
FT                   /product="General secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27241"
FT                   /db_xref="GOA:C5A832"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C5A832"
FT                   /protein_id="ACR27241.1"
FT                   /translation="MPAFRFEAIDAGGRPQKGVIEADSARAARGQLRGQGLTPLVVEPA
FT                   ANRSRGERKQRLSIGRKLSQREQAILTRQLASLLTAGLPLGEALAVLTEQAERDYIREL
FT                   MAAIRAEVLGGHSLASALTEHPRDFPEIYRALVAAGEHTGKLGIVLSRLADYIEQRNAL
FT                   KQKIVLAFTYPGIVTLIALGIVTFLLSYVVPQVVNVFASTKQQLPFLTIVMMALSAFVR
FT                   HWWWAILLGVGLVAWLVKATLSRPGPRLAFDRWLLGAPLAGKLVRGYNTVRFASTLAIL
FT                   TAAGVPILRALQAAGETLSNRAMSGNIDDAIVRVREGTSLSRALNHVKSFPPVLVHLIR
FT                   SGEATGDVTTMLDRAAEGEARELERRTMFMTSLLEPLLILAMGGIVLVIVLAVMLPIIE
FT                   LNNMVQ"
FT   gene            complement(35030..36514)
FT                   /locus_tag="bglu_1g00370"
FT   CDS_pept        complement(35030..36514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00370"
FT                   /product="General secretory pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27242"
FT                   /db_xref="GOA:C5A833"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:C5A833"
FT                   /protein_id="ACR27242.1"
FT                   /translation="MSELASAAPGEPAAPSAVAARLLPYGFARAGQILVAQQDGDALEV
FT                   WISERTTDAALAEVARNFGALTARRLPADELAQAINTAYARQDGSAAQVVGEVEGEVDL
FT                   SRLMQDIPEVEDLLESEDDAPIIRMINALLTQAAREQASDIHIEPFENASVVRFRVDGT
FT                   LRDVVRPKKALHGALISRIKIMAQLDIAEKRLPQDGRITLRVGGRPVDVRVSTLPTGHG
FT                   ERAVLRLLEKDAQRLNLEALGMGRDTLVQFDKLIARPHGIVLVTGPTGSGKTTTLYAAM
FT                   SRLETATTNIMTVEDPIEYDLSGIGQTQVNEKIGMSFARALRSILRQDPDVIMIGEIRD
FT                   LETAQIAVQASLTGHLVLATLHTNDAASAVTRLTDMGVEPYLLASSLLGVLAQRLVRQL
FT                   CPVCKEPREEDGRTLYHPVGCEKCGHSGYTGRRGVYELLVVDEAIRAQIHNNAPDSEIL
FT                   RAGRENGMRTLRDDAERWLAAGNTSLEEVLRVTGGA"
FT   gene            complement(36511..38808)
FT                   /locus_tag="bglu_1g00380"
FT   CDS_pept        complement(36511..38808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00380"
FT                   /product="General secretory pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27243"
FT                   /db_xref="GOA:C5A834"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:C5A834"
FT                   /protein_id="ACR27243.1"
FT                   /translation="MRRAAQALVVAGIVASQAAHAQVTLNFVNADIDQVAKAIGAATGK
FT                   TIIVDPRVKGQLNLVSEHSVPEEQALKTLQSALRMQGFSLLQDHGVLKVVPEADAKLQG
FT                   VPTYVGNTPRANGDQVVTQVFELHNESANNLLPVLRPLISPNNTVTAYPANNTLVVTDY
FT                   ADNIRRIAQIIAGIDNAAGTQVVVVPLKNANAIDIASQLGKLLDPGAIGNTDATLKVNV
FT                   SADPRTNSILLRASNASRLASARRLLAQLDAPSAAPGNMHVIRLRNADAVKLAKTLRGM
FT                   MGKGDSGSSASSNDANSFNQGNSSGSSFSTGTSGTAPLPSGSSSMSSGSGSGGYGSGSG
FT                   KNDGFLGGDKDKSDDNQPGGMIQADAATNSLIITASDPVYRNLRAVVDQLDERRAQVYI
FT                   EALIVELNSNTSANLGIQWQVANNALYAGSSLGTNVSGLGNTITGLTAAAAAGSAGGAN
FT                   GGAAAAASLTPGLNIGWLKNMFGITGLGALLQAFSGSSDANVLSTPNLVTLDNEEAKIV
FT                   VGQNVPIATGSYSNLTSGNSSNAFNTFDRQDVGLTLHVKPQITEGGILKLQIYTEDSAV
FT                   VPSTTSSTAVGVPTFSKRSIQSTVLCDNGEIIVLGGLMQDNYQVGNNKVPLLGDIPWIG
FT                   QLFRSEGKQRQKTNLMVFLRPVILTDHATTQAITANRYDYIQGVQGAYRTDNNLIRDKD
FT                   DPVTPPMPLGPDEGVAPAANLFDLTRMTRRPGYPPVPASAGAATPPAASQPAPAVTTPV
FT                   PTPGIASPGAQP"
FT   gene            39211..39669
FT                   /locus_tag="bglu_1g00390"
FT   CDS_pept        39211..39669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00390"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27244"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C5A835"
FT                   /protein_id="ACR27244.1"
FT                   /translation="MRIRSVLLVFSLLAAGVASAPAHADCYDEAARYQKVNPLILRAIA
FT                   WQESHNTPDAINRNANGSTDYGIMQINSIHLSRLAQYGITKDTLMQPCKNVYIAAWHLR
FT                   QKMNKYGNTWAAIGSYHSETPSLRDKYARQIAAILSKWHLLPAENAPR"
FT   gene            39982..41331
FT                   /locus_tag="bglu_1g00400"
FT   CDS_pept        39982..41331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00400"
FT                   /product="CobW/P47K family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27245"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5A836"
FT                   /protein_id="ACR27245.1"
FT                   /translation="MNSPLPVTVLSGFLGAGKTTLLNHVLANREGLRVAVIVNDLATVN
FT                   IDASLVKGAAGLSQAEARLVEMSNGCICCTLRDDLLVEIRRLAAGRAERPLDAILVEST
FT                   GIAEPMPIAETFSFVDDEGVSLEDLARLDTMVTVVDAFNFLRDYGSDEGLADRGLVGSD
FT                   EDDRTLVELLIEQIEFCDVLVINKADLVDADELARLQRILASLNPRARQLVSRFGEVPI
FT                   AEVIGTGRFDFEAAANAPGWLASLEHHHHHDHDGDAPCDAEHARAHGLPDEFGIGSFVY
FT                   RARRPFHPQRFWALLHEEWRGVLRSKGFFWLATRHDIGGSLSQAGGVCRHGPAGLWWAA
FT                   QDRAEWPEDDPALLDEIAADWHGEPGDTTVGDRRQELVLIGIGLDADAWRAKFDACLLD
FT                   DAEYAAGESAWRALPDPFPAWDLDEHDHDDEHHDDEHHGRSGDEEIVHRH"
FT   gene            complement(41465..41743)
FT                   /locus_tag="bglu_1g00410"
FT   CDS_pept        complement(41465..41743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00410"
FT                   /product="histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27246"
FT                   /db_xref="GOA:C5A837"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C5A837"
FT                   /protein_id="ACR27246.1"
FT                   /translation="MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLI
FT                   GFGSFGSGKRAARTGRNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR"
FT   gene            42127..44115
FT                   /locus_tag="bglu_1g00420"
FT   CDS_pept        42127..44115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00420"
FT                   /product="5-methylaminomethyl-2-thiouridine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27247"
FT                   /db_xref="GOA:C5A838"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5A838"
FT                   /protein_id="ACR27247.1"
FT                   /translation="MTDRIVPASLVFRDDGTLVSPAYGDIYHSAAGALAQAEHVFLRGN
FT                   GLPERWRGRRRFTIVETGFGTGCNFLATWAAWRADPARGERLHFVSIEKHPFSREDLRA
FT                   AARHLVAHTTIDARSFASLIDALADAWPMLTPGLHRLEFDEGRVVLTLAFGDALAVLPS
FT                   LVLRADAFYLDGFAPAKNPGLWSVEVFRALAKLADETATFATYTSAGDVKRALEAAGFA
FT                   WRKVDGFAGKRAMLVGEFAPRWRVRRHEPPRAAEAAAREAIVIGAGLAGCALVERLSAR
FT                   GWHVTLIERHAQPAGEASGNPAGVFHPLIARDDNFGARLSRAGYLYALSRWRSLEAAGY
FT                   DFARSRGGLLQLACDDDEFARMQAAAEALAMPDALAVLVSREAAAARLGSEVAHGGWWY
FT                   PQAGSLDPAALARACCAAAGERLRRLAGNEVARLAPREGGGWLALDAAGNTLASAAIAI
FT                   VANAADAPRVAGLRHAPVQRVRGQLTMLPPGAAPLVAMPAIGDGYLIPFADGTLLTGAT
FT                   YEPDATEAAPSEAGHRENLARLAALLPRFDAAAGARIAAGMLTGRVAFRCVASDRLPMA
FT                   GALGDEAAAAAHAHRLAGAQARDLPRAAGLFGAFGFGSRGFVWASLCAELIASQIEGEP
FT                   WPVERELAEAIDPARFLLRALRQGRAG"
FT   gene            44890..46104
FT                   /locus_tag="bglu_1g00430"
FT   CDS_pept        44890..46104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00430"
FT                   /product="monovalent cation:proton antiporter-2 (CPA2)
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27248"
FT                   /db_xref="GOA:C5A839"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C5A839"
FT                   /protein_id="ACR27248.1"
FT                   /translation="MKSAFSFLPNWPFVPDAVFWAGIALFAAGLCGELGYRAWRLPRVS
FT                   GYGVIGMIAGSAGFGAIDASTSSTARLLINVALGLLLFELGSRLDLRWIRRNPWLIASS
FT                   VAEAVLTFALVLTVLLVLGVPAMASIVLAAIAVATSPAMAIQLKTELRAEGQVSQRLLT
FT                   LTALNSVYSVVLTKLLTSWLHQEEYGNVFATILQPVYLIAGSLALAYLLARACNYLFRH
FT                   IAPMMRDEHSFVALFGLVVLAIAVAQALKLSTVLTLLLAGIIVKNLEARPQLWPEHFGT
FT                   AGWLLTVILFVLTLTSFSWRDLAAGGLIAIVLIVTRSVAKLIGVVAFARKSGIGVKQGV
FT                   ALGLSLAPMSALAYLLVDETYQLYPGFDPRLRSVVLCAIVILQIVGPLFVYRSLSAVGE
FT                   RRDES"
FT   gene            46154..47269
FT                   /locus_tag="bglu_1g00440"
FT   CDS_pept        46154..47269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00440"
FT                   /product="Glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27249"
FT                   /db_xref="GOA:C5A840"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:C5A840"
FT                   /protein_id="ACR27249.1"
FT                   /translation="MALETFNNSEPFTFGVELEIQIVNTHNYDLTKAASDLMRLVEDEP
FT                   HPGNITPEITESMIELSTGICHSHDQALGELHAIRDVLVKAADHLNVGLCGGGTHTFQQ
FT                   WSDRQIYDAPRFQYLSELYGYLAKQFTVFGQHVHIGCPDADSALFLLHSMSRYIPHFIA
FT                   LSASSPYVQNVDTGFHSARLNSVFAFPMSGRAPYTLTWDGFEEYFSKMVNTGVVNSMKD
FT                   FYWDIRPKPGFGTIEVRVMDTPLSVDRAAAIACYIQTLARYLLLDKPLTLSEDDYLVYT
FT                   FNRFEACRFGLEGTCVNPQTGERRTIAEDILATLDRLAPHAAALGSRAALDEIGSLARA
FT                   RVNDASWLRTVFKQEKSLNETVRQQCLRWRE"
FT   gene            47781..48422
FT                   /locus_tag="bglu_1g00450"
FT   CDS_pept        47781..48422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00450"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27250"
FT                   /db_xref="GOA:C5A841"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5A841"
FT                   /protein_id="ACR27250.1"
FT                   /translation="MSEGVYGNEAAGRVTHSLLRLSTAMRSQAWDWAEGAGLTPTQGEI
FT                   LVLLLQRKGPMRLGEIARETQLTAATTSDAVSTLEGKGLVEKRRALDDGRALAVRLSGR
FT                   GRTAAKKALQWPDFLSKAIRVLGNDEQGALYRSLLKVLRELQVAGEAPQHRMCVTCKHF
FT                   QPGKAVRKPSYRCSLLELSMADSDLRLDCSVHEEADALTQKKTWKVFSQL"
FT   gene            48460..49170
FT                   /locus_tag="bglu_1g00460"
FT   CDS_pept        48460..49170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00460"
FT                   /product="glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27251"
FT                   /db_xref="GOA:C5A842"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5A842"
FT                   /protein_id="ACR27251.1"
FT                   /translation="MNAEVVAIRHVHFEDLGSFERVLGERGRRVRYVDVGTSRVEVLDA
FT                   CGPSLLVVLGGPISAYDDELYPTIAPLVELIRRRIDAGLPTLGICLGAQLIARALGARV
FT                   YAGDARELGWSPLALTAAGHASPLRHLAGSATSMLHWHGDTFDLPPGAIHLASTPACAH
FT                   QAFSWGQHVLALQCHPEVAVESFEAWLIGHAGEIAATPGVDARQLRADTARFGPQLELA
FT                   AARMFGEWLASVGL"
FT   gene            49393..50505
FT                   /locus_tag="bglu_1g00470"
FT   CDS_pept        49393..50505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00470"
FT                   /product="NADH-flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27252"
FT                   /db_xref="GOA:C5A843"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5A843"
FT                   /protein_id="ACR27252.1"
FT                   /translation="MSALFSPLTLRSLTLPNRIVVSPMCQYSAERGEPTAWHTIHLGHL
FT                   ALSGAALLCTEAVAVEPEGRITPGDLGLWDDATEAAYRPLLAAIRRHSPIRVAMQIGHA
FT                   GRKASSRAPWEGGALIEVADGGWLPHAPSAVPHKEGETPPLALDAAGLNRLRRAFEATA
FT                   KRAARLGIDALEVHAAHGYLLHQFLSPLANHRTDEYGGSLENRMRFPLEIFEIVRAAFP
FT                   AERPVGVRVSATDWVDGGWTLDETIAFAKALKARGCDWIDVSSGGVSPLQKIPLSAGYQ
FT                   VPFARAVRHAVALTTFAVGLITEPAQAEKIVADGDADCVALARAMLYDPRWPWHAAAEL
FT                   GATVTAPPQYWRSQPREQKALFGEVSSGQR"
FT   gene            50817..51374
FT                   /locus_tag="bglu_1g00480"
FT   CDS_pept        50817..51374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00480"
FT                   /product="SET domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27253"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:C5A844"
FT                   /protein_id="ACR27253.1"
FT                   /translation="MSSRRIVVRRSGVHGKGVFAVAPIKAGERVVEYKGERISWKEALR
FT                   RHPHDPNDPNHTFYFALEEGGVIDGKVDGNSARWINHACAPNCEAEETAGRVFIHALRD
FT                   IEAGEELFYDYGLVIDAKLTKQLKRDYACHCGASTCRGTMLAVKEESGGKKKKPARKDG
FT                   KARKAEKAEKADRKGKDGRKKK"
FT   gene            complement(51426..52979)
FT                   /locus_tag="bglu_1g00490"
FT   CDS_pept        complement(51426..52979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00490"
FT                   /product="Sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27254"
FT                   /db_xref="GOA:C5A845"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5A845"
FT                   /protein_id="ACR27254.1"
FT                   /translation="MSSEPAATSLRRSLLRRLAAPLSMLALMSGLIAYWLAWQYTQHVI
FT                   DRSLADLATAISKQIQIAGPDAPFTVPPLAQAMFSDPTEQLIYRISDGEHELAGDPKLP
FT                   LQGTSVRRMHYAYVFEADYEGQAVRVAQVRVEQTDDGNPMIVEVAQPVRHRYQIAAEFL
FT                   IAIMMPLLLLLLAGWGIVWRVVNQQLGPLTHLADSLNRQTHTSLEPVDETDVPLEIRPL
FT                   TSAMNALLGRLKTALDAQRKFIADAAHQLRTPLTAVKLHAEHAAVARDPQQTLAAVHEL
FT                   RAAADRAVRLSNQLLSLARAEPGEQAARFVDVDLAALAFETGAEWVPRALAAHVDLGFQ
FT                   TSDDPGSAESLAKRAKSGDDELPEDFDLASVPPLVVRGNPVLLREVIANLLDNALKYVP
FT                   LARPEGARITVNVSQVALEDGRAAGEIVVEDNGPGVPSGQQADLFKRFFRGDAQSGNGV
FT                   ETGAGLGLAIVHDIVAMHDGEVLYADAPEGGSRFIVRIPLAAKPAEAAAGACEPETLQT
FT                   "
FT   gene            complement(53089..53781)
FT                   /locus_tag="bglu_1g00500"
FT   CDS_pept        complement(53089..53781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00500"
FT                   /product="Putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27255"
FT                   /db_xref="GOA:C5A846"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5A846"
FT                   /protein_id="ACR27255.1"
FT                   /translation="MRLLLIEDDRPIARGIQSSLEQAGFTVDMVHDGIFAEQALAQNRH
FT                   ELVILDLGLPGIDGMTLLSRFRQTNRHTPVIVLTARDELNDRVQGLNSGADDYMLKPFE
FT                   PAELEARIRAVMRRSGPHSDMPRPEVSLGGVRLSGVDRRIFNDDKPLELSPREFAVLEM
FT                   LLLRHGRVVSKAQLQDHLTHFGGDLGDTAIEVYVHRVRKKLEQCRVEIVTVRGFGYLLQ
FT                   EIRQPASV"
FT   gene            53892..54122
FT                   /locus_tag="bglu_1g00510"
FT   CDS_pept        53892..54122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00510"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27256"
FT                   /db_xref="InterPro:IPR022191"
FT                   /db_xref="UniProtKB/TrEMBL:C5A847"
FT                   /protein_id="ACR27256.1"
FT                   /translation="MSDISIHELEAAINFWRARSPSSGDELKLCEEASALSKPYALLIV
FT                   QRQSALKLEGLDPIARCAWESYARLKNGLES"
FT   gene            complement(54372..54683)
FT                   /locus_tag="bglu_1g00520"
FT   CDS_pept        complement(54372..54683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00520"
FT                   /product="Pterin-4-alpha-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27257"
FT                   /db_xref="GOA:C5A848"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:C5A848"
FT                   /protein_id="ACR27257.1"
FT                   /translation="MIHKLTSEARKTQLETLPHWSAVPGRDAIQRSLRFTDFNAAFGFM
FT                   TRVAIKAQEMDHHPEWFNVYNRVDITLSTHDANGLTERDIQLARFIDEVGRDAHAQLG"
FT   gene            complement(54796..55701)
FT                   /locus_tag="bglu_1g00530"
FT   CDS_pept        complement(54796..55701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00530"
FT                   /product="Phenylalanine-4-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27258"
FT                   /db_xref="GOA:C5A849"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:C5A849"
FT                   /protein_id="ACR27258.1"
FT                   /translation="MSNVVTAMLQEQFDAGLETRQDFTIDQPLERYTRVDHAVWSQLYA
FT                   RQTALLEGRAADAFVAGMKRLTLPADRVPSFEDVNRQLQPATGWEIVAVPGLVPADVFF
FT                   AHLASRRFPVTWWMRRPDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMHAYGQAALAVS
FT                   DDPFALSLLGRLYWYTVEFGLIRSRHDRDQLRIYGAGIVSSRGESVYSLESAAPNRIGF
FT                   DLDRVMRTAYRIDTFQKTYFVIDDFEQLFALAKVDARALARRLAGLAEHPAGAVLAGDR
FT                   VLHRGTGEGWAGDDDATGRA"
FT   gene            55841..56332
FT                   /locus_tag="bglu_1g00540"
FT   CDS_pept        55841..56332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00540"
FT                   /product="Transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27259"
FT                   /db_xref="GOA:C5A850"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5A850"
FT                   /protein_id="ACR27259.1"
FT                   /translation="MLELDHFDLALLDVLQRFGRATHQQLGEQVPLSPSQIGRRLQRLE
FT                   AAGVIDGYRVVLRPERLGLGVTAFTSLKLKHHGDSIIEQFQQQIDVLAEVLECHAVVGD
FT                   ADYLLRIVAPDLNALSSFVMKKLMRVPGVDSVRSNIVLTTFKRSGPLPLSHLEPGAAPA
FT                   "
FT   gene            complement(56389..56916)
FT                   /locus_tag="bglu_1g00550"
FT   CDS_pept        complement(56389..56916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00550"
FT                   /product="Adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27260"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:C5A851"
FT                   /protein_id="ACR27260.1"
FT                   /translation="MARNIEIKARARDFDGLRDKAASLATEEPLFYRQQDFFYDVPRGR
FT                   LKLRRFEDGTPAELIFYQRDDRDGPKASYYTRSPVTNPDAMHALLATALTTRGIVTKER
FT                   HVYLAGRTRIHLDRVDGLGDFVELEVVLAEGDDEAGGEAEAHEVFAKLGVASEDLVAVA
FT                   YVDLLAHEPTAA"
FT   gene            complement(57131..58030)
FT                   /locus_tag="bglu_1g00560"
FT   CDS_pept        complement(57131..58030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00560"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27261"
FT                   /db_xref="GOA:C5A852"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5A852"
FT                   /protein_id="ACR27261.1"
FT                   /translation="MDLILLRAFAAVAREGNLTRAAAQLCLTQPAVSLQIKHLQQALGV
FT                   ALFARTSRGLGLTRDGQALLPHAERALAAAGEVLRAASALRQEVRGRLRIGTVLDPEFL
FT                   RLGGFLRQLVETHPRLETELRHGMSGWVRDAVRTRELDVGYSIGRPDDDDPHHGALFHT
FT                   RTLTRYQYRVLAPAGWKERVQRARDWRALAALPWIWTPPSSAHHRLLSRRFAEAGVQPM
FT                   KVAEVDQEPSMLDLVKSGVGLTLARDSIALREAHAHALVIVEAVTVPTELTFVTLAARR
FT                   EEPAIAAALRLVEAQWAG"
FT   gene            58196..59854
FT                   /locus_tag="bglu_1g00570"
FT   CDS_pept        58196..59854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00570"
FT                   /product="oxidoreductase, GMC family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27262"
FT                   /db_xref="GOA:C5A853"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5A853"
FT                   /protein_id="ACR27262.1"
FT                   /translation="MTSERTLEGEFDYVIVGAGTAGCVLANRLSEDPDVSVLLLEAGGK
FT                   DDYHWIHIPVGYLYCIGNPRTDWLYRTQPEAALNGRVLSYPRGRVLGGSSSINGMIYMR
FT                   GQREDYDGWAELTGDAGWAWDAVLPVFRRSEDHHGGGNDAHGAGGEWRVERQRLRWKIL
FT                   DAFAEAAQQSGIAATDDFNCGDNSGVGYFEVNQKRGVRWNAAKAFLRPALSRPNLTIIT
FT                   GAQVERLAFDGARCAGVEYRGGGQPFVARARGEVIVAAGAVNSPALLELSGVGDAARLR
FT                   GLGIEVVRDLPGVGENLQDHLQLRTAFRVAGVRTLNTLSAHWWGKLWIGAEYLLRQSGP
FT                   MSMAPSQLGVFTKSDPHDPSITRADLEYHVQPLSLDRFGEPLHRYDAFTASVCNLRPTS
FT                   RGSIHIDSPDPFSAPRIAPNYLATEADRRVAANALRLTRRIAAAPALARYRPDEVLPGH
FT                   RYQTDQELAVAAGAVGTTIFHPVGTCRMGRADDPRAVVDSRLRVRGIDGLRVVDASVMP
FT                   TITSGNTNSPTLMIAERASEMIRADRRAGQGGPTR"
FT   gene            60228..60992
FT                   /locus_tag="bglu_1g00580"
FT   CDS_pept        60228..60992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00580"
FT                   /product="Branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27263"
FT                   /db_xref="GOA:C5A854"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C5A854"
FT                   /protein_id="ACR27263.1"
FT                   /translation="MILGDTILETHGLTKEFRGFTAVSGVDLRVKRGSIHALIGPNGAG
FT                   KTTCFNLLTKFVRPTAGEIVYNGIDITRERPAQIARRGIIRSFQISAVFPHLTALQNVR
FT                   VGLQRSLRSEFHFWRSARSLRRLDDRAMDLLTQVGLSDFAHVTTVELAYGRKRALEIAT
FT                   TLAMEPELMLLDEPTQGMGHEDVDRVTALIRKVSSGRTILMVEHNMNVIAGISDTITVL
FT                   QRGEVLAEGTYAEISKNPFVIEAYMGSAGAHR"
FT   gene            60989..61783
FT                   /locus_tag="bglu_1g00590"
FT   CDS_pept        60989..61783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00590"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27264"
FT                   /db_xref="GOA:C5A855"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5A855"
FT                   /protein_id="ACR27264.1"
FT                   /translation="MSGGERRQPEPDAPQHASATALDAAPAEADVPALAISGLEAWYGE
FT                   SHILHGVDLRVSRGEVVTLLGRNGAGRTTTLRAVMGLTGRRRGSIRIGGRETIDLATHR
FT                   IARHGVGYCPEERGIFASLSCEENLLLPPAVGAREHAMPLDEIYALFPNLAARRHSQGT
FT                   RLSGGEQQMLAVARILRTGANLLLLDEISEGLAPVIVQTLARMIVALKARGYTIVMVEQ
FT                   NFRFAAPLADRFYVMEHGRIVEHFGASELDAKMPVLHSLLGV"
FT   gene            61861..63069
FT                   /locus_tag="bglu_1g00600"
FT   CDS_pept        61861..63069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00600"
FT                   /product="Branched-chain amino acid ABC transporter,
FT                   periplasmic branched-chain amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27265"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5A856"
FT                   /protein_id="ACR27265.1"
FT                   /translation="MKLKILARACFGAALAATAVAAVPARAAGDVVKIGFVTDLSGLYA
FT                   DIDGPGGIEAIRMAIADFGGKVNGKPIEFVYADHQNKADIAASKAREWIDRDGLDLLVG
FT                   GTNSATALSMNQVAAEKKRVYINIGAGADTLTNEQCTPYTIHYAYDTMALAKGTGSAVT
FT                   KQGGKTWYFLTADYAFGKALEKNTAEVVKANGGQVLGAVRHPLSASDFSSFLLQAQASK
FT                   AQILGLANAGGDTVNSIKAAKEFGITKTMKLAALLVFISDIHSLGLETTQGLVLTDSWY
FT                   WNRDDASRKWAQRFFAKTRKMPTSLQAADYSSVTTYLKAVQAVGSTDADKVMAQLKKQK
FT                   IDDFYAKGYVRADGSMIHDMYLMEVKKPSESKEPWDYYKILATIPGEQAFATKQESRCA
FT                   SWK"
FT   gene            63172..64056
FT                   /locus_tag="bglu_1g00610"
FT   CDS_pept        63172..64056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00610"
FT                   /product="ABC branched-chain amino acid family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27266"
FT                   /db_xref="GOA:C5A857"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5A857"
FT                   /protein_id="ACR27266.1"
FT                   /translation="MDIFGIPLSAMLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFA
FT                   HGALFMLGAMLAWMGLHYFSLPYWAMLVVAPLVVGSFGILIERTMLRWLYRLDHLYGLL
FT                   LTFGITLVVEGVFRSIYGASGQPYDVPALLAGATDLGFMYLPNYRAWVVVASLAVCLAT
FT                   WFVIEKTRLGAYLRAGTDNPKLVEAFGVNVPLMITLTYGFGVALAAFAGVLAAPVIQVS
FT                   PLMGQPMIITVFAVVVIGGMGSILGSIVTGLLLGVIEGFTRVFYPEASATVVFVIMALV
FT                   LLVRPAGLFGKER"
FT   gene            64056..65036
FT                   /locus_tag="bglu_1g00620"
FT   CDS_pept        64056..65036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00620"
FT                   /product="Putative branched-chain amino acid ABC
FT                   transporter integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27267"
FT                   /db_xref="GOA:C5A858"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5A858"
FT                   /protein_id="ACR27267.1"
FT                   /translation="MMQRKVLYGVLLAGLAVLPFAGVYPLFVMKVMCFALFAAAFNLLI
FT                   GYTGLLSFGHAMFLATAGYLTGYAIQTLGLSPELGVLAGTAAATALGLVVGLFAIRRQG
FT                   IYFAMITLAFAQMVYFVYLQAPFTHGEDGLQGVPRGRLFGLLDLSSDLTLYYVILVAVV
FT                   LAALSIVRIVHSPFGQVLVAIKENEPRAISLGYDTDRFKLLAFVLSAALAGLAGSLKVL
FT                   VLGFETLGDAYWTMSGLVILMTLVGGMGTLFGPLLGAALIVLLEERLGDIGTWLASATG
FT                   VDWFRSLGESTSIVTGLIFIACVLTFRRGIVGEIVARVKPLRASS"
FT   gene            65131..65523
FT                   /pseudo
FT                   /locus_tag="bglu_1g00630"
FT                   /note="disrupted gene"
FT   gene            65219..65653
FT                   /pseudo
FT                   /locus_tag="bglu_1g00640"
FT                   /note="disrupted gene"
FT   gene            66052..68022
FT                   /locus_tag="bglu_1g00650"
FT   CDS_pept        66052..68022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00650"
FT                   /product="Glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27268"
FT                   /db_xref="GOA:C5A859"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5A859"
FT                   /protein_id="ACR27268.1"
FT                   /translation="MLYPTEFDVIVVGGGHAGTEAALAAARMGVKTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRLLY
FT                   KQAIRSRLENQPNLWLFQQAVDDLIVEGERVVGAVTQIGIRFRARAVVLTAGTFLDGKI
FT                   HVGLNNHTGGRAGDPAAVSLSARLKELKLPQGRLKTGTPPRIDGRSIDFSKLEEQPGDL
FT                   DPVPVFSFLGRAEQHPRQLPCWVTHTNERTHDIIRSGLDRSPMYTGVIEGVGPRYCPSI
FT                   EDKIHRFASKDSHQIFLEPEGLTTNEFYPNGISTSLPFDVQLDLVHSMRGLEHAHILRP
FT                   GYAIEYDYFDPRGLKASLETKVIEGLFFAGQINGTTGYEEAAAQGLLAGINAGRYAQDK
FT                   EAWCPRRDQAYLGVLVDDLVTRGVSEPYRMFTSRAEYRLSLREDNADMRLTEMGRELGV
FT                   VDDVRWDAFSRKRDAVSRETERLRATWVTPKTLAVEEATALLGKAIDHEYSLAELLRRP
FT                   GVSYAGVCGLRGGECAPAEPLADDPVLLAQIEEQIEIGIKYQGYIERQAGEIERNGAHE
FT                   NTRLPDGIDYAEVRGLSFEARQKLNQHRPETIGQASRISGITPAAISLLMVHLKRGLGR
FT                   RGTTSTTTAEAGGSNHVPTQQ"
FT   gene            68070..68711
FT                   /locus_tag="bglu_1g00660"
FT   CDS_pept        68070..68711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00660"
FT                   /product="16S rRNA methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27269"
FT                   /db_xref="GOA:C5A860"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5A860"
FT                   /protein_id="ACR27269.1"
FT                   /translation="MLADGLDSLGLTLDETQVAKLLDYVALLGKWNAVYNLTSIRDPRQ
FT                   MLIQHILDSLSIVPHLRSLDAATRALDVGSGGGLPGIVLAIVFPGWQVTLNDIVHKKSA
FT                   FQTQAKAELKLANLSVVTGRVETLRPGHEVPGQFDVIVSRAFADLADFVSLARHLVAPG
FT                   GAIWAMKGVRPDDEIARLPEGAQVRRTIRLAVPALDAERHLIEVGVAEAQ"
FT   gene            68766..69536
FT                   /locus_tag="bglu_1g00670"
FT   CDS_pept        68766..69536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00670"
FT                   /product="Sporulation initiation inhibitor protein Soj"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27270"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5A861"
FT                   /protein_id="ACR27270.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTTVNLAASLAAQEQRVLLIDLDPQGNA
FT                   TMGSGIDKAACESTVYEVLVDGVDIEQARVRPEALAYDVLPANRELAGAEIELVEVENR
FT                   ERQLKAAIDKIADQYDFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVN
FT                   TIKQIHANLNRELKVIGLLRVMFDPRITLQQQVSDQLKAHFGDKVFDAVIPRNVRLAEA
FT                   PSYGLPGVVFDRASRGAQAYLQFGTEMIERVRAL"
FT   gene            69574..70461
FT                   /locus_tag="bglu_1g00680"
FT   CDS_pept        69574..70461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00680"
FT                   /product="ParB-like partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27271"
FT                   /db_xref="GOA:C5A862"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:C5A862"
FT                   /protein_id="ACR27271.1"
FT                   /translation="MNAVAKKKGLGRGLEALLGGSADITEAVKIEGAPNTLALDRLQAG
FT                   KYQPRTRMDEGALQELAASIRAQGVMQPILVRPVGADRFEIIAGERRFRAARLAGLAEV
FT                   PVLVRQVTDQAAAAMALIENIQREDLNPLEEAHGIQRLLDEFDFTHEQAAESVGRSRSA
FT                   VSNLLRLLNLAAPVQTMLLAGDLDMGHARALLAVDAATQITLAHQVVNKRLSVRETEKL
FT                   VAQTTKEAPALKAKSKDDGGRDTRRLEEELSDLLASNVKIKLGRRGRGQLTIDFGDLDA
FT                   LEGILVRLRGNLAA"
FT   gene            70475..71608
FT                   /locus_tag="bglu_1g00690"
FT   CDS_pept        70475..71608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00690"
FT                   /product="Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27272"
FT                   /db_xref="GOA:C5A863"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:C5A863"
FT                   /protein_id="ACR27272.1"
FT                   /translation="MAELNVSNTSRRWLAFIASEPVLSILVVALVALQIARPQPVDALA
FT                   RLVDWQTVATLAGLLMVTKALEMSGFLMWLAHRIVHHVRTERSLAMLLIVFAAVLATWL
FT                   TNDVALFVAVPLVVSLQKLAPLPFKRLVICLAIAVNAGSIATPLGNPQNLFLWQRSGAS
FT                   FGRFILEMGPLALMTMLMLLVLAAFWFRSAPLDFSGDREPHPVRRPLAIAAALLFAGFV
FT                   AAADAHYVVPGLIVVALVLGLLRREAVLRIDWLLLLIFVLMFVVLRGAAALPAVHDTLA
FT                   RAGLDAPLRLYTAGALLSQGISNVPAAILLSEFSGDWRALAFGVSVGGFGFAIGSLANL
FT                   IAVRLAKTRGIWLPFHLVCVPFGLVAFAAGAVWLRWF"
FT   gene            71876..72403
FT                   /locus_tag="bglu_1g00700"
FT   CDS_pept        71876..72403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00700"
FT                   /product="F0F1-type ATP synthase subunit I-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27273"
FT                   /db_xref="GOA:C5A864"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:C5A864"
FT                   /protein_id="ACR27273.1"
FT                   /translation="MAGQAPEDRHDDHHAQQVAAAQRRGAPHADDDWDAGQQDNLIVPL
FT                   TRAEAQALFGSEVSRPSRVTPFRVVIAQVALSLVATLAWWLFSRSPGAAAQAAFMGGAI
FT                   GWVPSAVFAARLRFGGANTVMGWMFGEALKLGVTIAMFIAVALRFPDVQWVPLLVTYLV
FT                   ALKTYWLALAWR"
FT   gene            72557..73408
FT                   /locus_tag="bglu_1g00710"
FT   CDS_pept        72557..73408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00710"
FT                   /product="F0F1 ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27274"
FT                   /db_xref="GOA:C5A865"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:C5A865"
FT                   /protein_id="ACR27274.1"
FT                   /translation="MAASEGTHALDPSEYIAHHLQNFTSSHQTSIVDFHVWNLDTLFWS
FT                   IVCGLVTILVLRLAARKATPGVPGRFQCLIEMVVEMVEDQSKAVVHGNRTFIAPLALTV
FT                   FVWVLLMNSLDFLPVDLPGRVIALLGLSGVIPNHRIVPTADLNGTLGIALGVFVLMIYY
FT                   SIKIKGLGGFAHELLSAPFGAHPLLWIPNLALNIVEYVAKTVSLGMRLFGNMYAGELVF
FT                   LLIALLGSMWSFGGDATVLGFIGHVIAGSIWAIFHILIVLLQAFIFMMLTLVYLGQAHE
FT                   KH"
FT   gene            73483..73752
FT                   /locus_tag="bglu_1g00720"
FT   CDS_pept        73483..73752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00720"
FT                   /product="F0F1 ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00720"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27275"
FT                   /db_xref="GOA:C5A866"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:C5A866"
FT                   /protein_id="ACR27275.1"
FT                   /translation="MQAFIANIQGLTAVGIGIIIGLGAIGACIGIGLMGGKYIEACARQ
FT                   PELINPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSKLAG"
FT   gene            73885..74355
FT                   /locus_tag="bglu_1g00730"
FT   CDS_pept        73885..74355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00730"
FT                   /product="F0F1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27276"
FT                   /db_xref="GOA:C5A867"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:C5A867"
FT                   /protein_id="ACR27276.1"
FT                   /translation="MNLNATLFAQLVVFLILAWFTMKFVWPPLINALDERAKKIADGLA
FT                   AAEKGKAELEAAHQRADQELAQARTDGQQRIADAEKRALAVAEEIKANAQAEAARIVAQ
FT                   AKADAEQQVVKAREALRADVATLAVKGAEQILKREVDQTAHAELLNQLKAEL"
FT   gene            74358..74897
FT                   /locus_tag="bglu_1g00740"
FT   CDS_pept        74358..74897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00740"
FT                   /product="F0F1 ATP synthase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27277"
FT                   /db_xref="GOA:C5A868"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:C5A868"
FT                   /protein_id="ACR27277.1"
FT                   /translation="MAEFATIARPYAEALFRVAEAGDVAAWSTLVEELAQVAQLPEVKS
FT                   VASSPKVAREQIAELLLAAVKSPLAGSAEAKNFVRMLVDNHRIVLLPEIAVQFDALKNA
FT                   REGAADVQIVSAFPLEGAPLAELVASLERKFGRKLKAAVEVDASLIGGVRVTVGDEVLD
FT                   TSVRARLASMQAALTA"
FT   gene            74942..76483
FT                   /locus_tag="bglu_1g00750"
FT   CDS_pept        74942..76483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00750"
FT                   /product="F0F1 ATP synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27278"
FT                   /db_xref="GOA:C5A869"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:C5A869"
FT                   /protein_id="ACR27278.1"
FT                   /translation="MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLS
FT                   DVMQGEMLEFPGNTFGLALNLERDSVGAVILGDYGHISEGDIVKTTGRILEVPVGPELI
FT                   GRVVDALGNPIDGKGPVNAKATDAIEKIAPGVIWRHGVSQPVQTGVKSIDAMVPIGRGQ
FT                   RELIIGDRQTGKTAVALDTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAMEYTI
FT                   VVSASASDSAAMQYLAPYAGCSMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVSAEYVEKFTNGEVKGKTGSLTALPIIETQAGDVTAF
FT                   VPTNVISITDGQIFLETDLFNAGIRPAINAGVSVSRVGGAAQTNVVKKLSGGIRTDLAQ
FT                   YRELAAFAQFASDLDAATRKQLERGRRVTELLKQPQYQPLQVWELAVALFSANNGYLDD
FT                   IDVKDVLGFEKGLREYLKASHAELIKRIEDTKALSKEDDGALHEALKSFKKSGAY"
FT   gene            76552..77430
FT                   /locus_tag="bglu_1g00760"
FT   CDS_pept        76552..77430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00760"
FT                   /product="F0F1 ATP synthase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27279"
FT                   /db_xref="GOA:C5A870"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:C5A870"
FT                   /protein_id="ACR27279.1"
FT                   /translation="MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPY
FT                   ADKVRAIAAHMSRANPEYRHPFMVENKDAKTAGLILVTTDKGLCGGLNTNVLRATVNKL
FT                   KELEKQGQKFEATAIGGKGLGFLNRVGGKVISQVVQLGDTPHLDKLIGAVKVQLDLYSE
FT                   GKLSAVYIAYTRFINTMKQEAVIEQLLPLAADHFENGADGTPSTSWDYIYEPDAQAVVD
FT                   ELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLSYNKSRQAAITKE
FT                   LSEIVGGAAAV"
FT   gene            77503..78897
FT                   /locus_tag="bglu_1g00770"
FT   CDS_pept        77503..78897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00770"
FT                   /product="F0F1 ATP synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27280"
FT                   /db_xref="GOA:C5A871"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:C5A871"
FT                   /protein_id="ACR27280.1"
FT                   /translation="MSTTALVEGKIVQCIGAVIDVEFPRESMPKIYDALTLEGTELTLE
FT                   VQQQLGDGIVRTICLGASDGLRRGVLVKNTGKPISVPVGKPTLGRIMDVLGRPIDEAGP
FT                   IESEHQRSIHQKAPAFDELSPSTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNM
FT                   MELINNIAKEHGGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLR
FT                   VALTGLTMAEHFRDEGLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGK
FT                   LQERITSTKTGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDP
FT                   LDSTSRQIDPNVIGEEHYTITRGVQQTLQRYKELRDIIAILGMDELSPEDKLTVARARK
FT                   IQRFLSQPFHVAEVFTGAPGKYVPLKETIRGFKMIVDGECDHLPEQAFYMVGTIDEAFE
FT                   KAKKIQ"
FT   gene            79041..79466
FT                   /locus_tag="bglu_1g00780"
FT   CDS_pept        79041..79466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00780"
FT                   /product="F0F1 ATP synthase subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00780"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27281"
FT                   /db_xref="GOA:C5A872"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:C5A872"
FT                   /protein_id="ACR27281.1"
FT                   /translation="MATIKVDVVSAEEEIFSGQAKFVALPGESGELGILPGHTPLITRI
FT                   RPGAVRIESEAGADEFVFVAGGILEVQPGAVTVLADTAIRGRDLDAAKAEEAKRRAEET
FT                   LQNAKSDIDLAKAQSELATAMAQLEAIQRLAKIRSKN"
FT   gene            79635..81407
FT                   /locus_tag="bglu_1g00790"
FT   CDS_pept        79635..81407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00790"
FT                   /product="AMP-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27282"
FT                   /db_xref="GOA:C5A873"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5A873"
FT                   /protein_id="ACR27282.1"
FT                   /translation="MATMAGTGGGAAAGIDGARLAPRDGLSYVRGATDVPLSHATVGAL
FT                   LAETIARHPDRPAVVFREQGVRWNWREFGDEVDALAAALVALGIAPGERVGIWAPNRVE
FT                   WLLTQFATARIGAILVNINPAYRLAELEYALNQVGCKALIAAESFKSSHYTQMLRTLLP
FT                   EVDSQAPGALRCARVPSLRAIVSMSAQAPAGMFRFDEVLARGRTLRARAALDVLGAGLA
FT                   QTDPINIQFTSGTTGSPKGATLTHRNIVNNAIAIAGVMHLGAHDALCIPVPLYHCFGMV
FT                   LAALACVSAGAKMVFPGAAFDPLATLEAVQAERCTALHGVPTMFIAELDHPEFGRFDLR
FT                   TLRTGIMAGSPCPIEIMRRVVAEMHMAEVTIAYGMTETSPVSFQSATTDSLEKRTTTVG
FT                   RIQPHLEAKIVDATGAIVPVGETGELCTRGYSVMSGYWCDGAGDGGDALTRAAIVDGWM
FT                   HTGDLATFDEEGFCNIVGRLKDMLIRGGENIYPREIEEFLFRHPKIQSAQVFGVPDAKY
FT                   GEEVCAWVVLRAGETLDAEALREFCRGQIAHYKVPRYVRFVEALPMTVTGKVQKFVMRE
FT                   AMIDELGLAVQKTA"
FT   gene            81421..81651
FT                   /locus_tag="bglu_1g00800"
FT   CDS_pept        81421..81651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00800"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27283"
FT                   /db_xref="UniProtKB/TrEMBL:C5A874"
FT                   /protein_id="ACR27283.1"
FT                   /translation="MRFLQTKKSGLKSPLKTTRYGVSARRPKVERNRRGPVTIPTGMPL
FT                   ARDSAQSRRTIRSASYPLTRRTRKTTSVLKP"
FT   gene            complement(82020..82811)
FT                   /locus_tag="bglu_1g00810"
FT   CDS_pept        complement(82020..82811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00810"
FT                   /product="Prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00810"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27284"
FT                   /db_xref="GOA:C5A875"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR037298"
FT                   /db_xref="UniProtKB/TrEMBL:C5A875"
FT                   /protein_id="ACR27284.1"
FT                   /translation="MASAAIAGAMPARAADPAEAASSAATPPTPASRLDAVLARGTLRV
FT                   CTTGDYRPYSYYRPDGRFEGIDIDLAESLARSLGVRAEFVKTSWRTLTDDFVAKCDVAV
FT                   GGISTTLDRQKRVFFTRATMQDGKTPIVRCADVDRYRTIAQIDQPSTRVIVNPGGTNER
FT                   FARQFLPHATLTVYPDNVTIFRQILDGRADVMVTDASETRWQQKLNPGLCSVHPDQPFQ
FT                   FGEKAYMLPRGDVVFQQYVDQWLHLARETGEFQSITDHWLK"
FT   gene            83108..84202
FT                   /locus_tag="bglu_1g00820"
FT   CDS_pept        83108..84202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00820"
FT                   /product="Uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00820"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27285"
FT                   /db_xref="GOA:C5A876"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C5A876"
FT                   /protein_id="ACR27285.1"
FT                   /translation="MAHNLLNDTFLRALLRQPTDYTPIWLMRQAGRYLPEYNATRSRAG
FT                   SFLGLAKHPEYAAEVTLQPLERYPLDAAILFSDILTIPDAMGLGLEFLAGEGPKFAHPV
FT                   RTEADVARLAVPDIGATLGYVTDAVREIRRALTDAQGRQRVPLIGFSGSPWTLACYMVE
FT                   GGGSDDFRTVKSMAYARPDLMQRILDVNVDAVAAYLDAQIQAGAQAVMIFDTWGGALAD
FT                   GAYQRLSLDPIRRVVAQLAREHDGERVPVIIFTKGGGLWLEEIAGSGVDAVGLDWTVNL
FT                   GRARERVGGSVALQGNLDPSILFAPPATIRMEARAVLDSYGNHPGHVFNLGHGISQFTP
FT                   PEHVAELVDEVHRHSRTLRAGPLG"
FT   gene            84487..84639
FT                   /locus_tag="bglu_1g00830"
FT   CDS_pept        84487..84639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00830"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27286"
FT                   /db_xref="UniProtKB/TrEMBL:C5A877"
FT                   /protein_id="ACR27286.1"
FT                   /translation="MHRFRPDRREFSTKLSTGGVGVPRFLMRIRNLAAKVMFYFNFAAP
FT                   AARRR"
FT   gene            84636..86888
FT                   /locus_tag="bglu_1g00840"
FT   CDS_pept        84636..86888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00840"
FT                   /product="primosome assembly protein PriA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00840"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27287"
FT                   /db_xref="GOA:C5A878"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:C5A878"
FT                   /protein_id="ACR27287.1"
FT                   /translation="MSGDWFVRVALDHPLATLFDYRYRATVPPERGRLVQVPFGKRLAV
FT                   GLICEVATHTEVPANRLREVAEVCSELPPLSDAWLELIAFAADYYQRGRGEVALPALPQ
FT                   ALRDASRWGRLLAPEVRYRLLPAGREALPGALPTRAVALRRLAQALAEAPALGLPELRA
FT                   LHPKATATLDTWCEAGWAARDEISIADAGGQPVDNRVGAPVPPALTAEQQDALDAICAA
FT                   RGFAAFLLHGVTGSGKTEVYLRALAALLDARPDAQALVLVPEINLTPQFESAFRARFAA
FT                   VMPGDAIVTLHSGLAEGERARHWLAAHTGRARIVLGTRLAVLASLPSLAMIVVDEEHEP
FT                   AYKQQEGLRYSARDLAVWRAKQLDVPVVLGSATPSLESWWLAEQGRYRRLTLSRRAVAD
FT                   AVLPSVRLVDLEEERRRGRASLGGLSGPLVAALKGRLERGEQSLIFLNRRGYAPALACD
FT                   ACGWVAGCPRCSAYVVLHKPERALRCHHCGWESRIPHACPECGNVDLAPLGRGTQRVEE
FT                   TLAEAVPGARILRIDADSTRRKGSAQALFSDVHAGEVDILVGTQMIAKGHDFRRVSLVG
FT                   VLNADTALFSHDFRATERLFAQLMQVSGRAGRAGLAGDVLIQTRYPRHALYHALARHDY
FT                   VGFANATLAERRDAHLPPFVYQALLRAEGRTLEAAIAFLQAGAAALATLPGAERVTVYD
FT                   AVPLTIVKVMHVHRAQLLVESASRAVLQRVLAAWQPLLRELKGVLRWSVEVDPLDI"
FT   gene            87385..91308
FT                   /locus_tag="bglu_1g00850"
FT   CDS_pept        87385..91308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00850"
FT                   /product="Proline
FT                   dehydrogenase/delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27288"
FT                   /db_xref="GOA:C5A879"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR024090"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:C5A879"
FT                   /protein_id="ACR27288.1"
FT                   /translation="MASTTLGVKVDDLLRARLKDAAARLERTPHWLIKQAIFAYLERIE
FT                   HGQLPAELSGRSGVAELADGQSDAEDGAPHPFLEFAQSVQPQSVLRAAITAAYRRPEPE
FT                   CVPFLIGQARLPAHLADAVQTMAAKLVETLRTKSSGGGVEGLIHEFSLSSQEGVALMCL
FT                   AEALLRIPDRATRDALIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAG
FT                   LSSALTRMIGKGGEPLIRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDM
FT                   LGEAATTEEDALRYYASYEQAIHAIGKAAGSRGIYEGPGISIKLSALHARYSRAQQERT
FT                   MTELLPRVRALALLARRYDIGLNIDAEEADRLEISLDLLEALCFDPELTGWNGIGFVVQ
FT                   AYQKRCPFVIDYLIDLARRSRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYTD
FT                   VSYLACAKKLLGAPDAVYPQFATHNAHTLSAIYHLAGQNYYPGQYEFQCLHGMGEPLYE
FT                   EVTGRDKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADKTVAVKELVADP
FT                   VEEAARIVPLGAPHAKIPLPRQLYGDSRANSMGLDLSNEHRLASLSSALLTSAHHPWRA
FT                   APLLADEALDDAPAREVRNPADQRDVVGTVSEATPEHVSAALAHAVSAAPIWQATPVEA
FT                   RADCLARAADLLEAQMHTLMGLVVREAGKSLPNAVAEIREAIDFLRYYSAQIRDEFSND
FT                   THRPLGPVVCISPWNFPLAIFMGQVAAALAAGNTVLAKPAEQTPLIAAQAVRLLREAGV
FT                   PAGAVQLLPGDGETVGAALVSDPRTRAVMFTGSTEVARLINKVLAGRLDPDGKPIPLIA
FT                   ETGGQNAMIVDSSALAEQVVADVLNSAFDSAGQRCSALRVLCLQDDVAERTLTMLKGAM
FT                   HELSLGNPDRLSTDVGPVIDADAKRTIDAHVAAMKDKGHAVTQLPMPEGCAHGTFVPPT
FT                   LIEIDSIDELKREVFGPVLHVLRYRRSGLDKLLDQVRATGYGLTLGIHTRIDETIAHVI
FT                   GRAHVGNIYVNRNVVGAVVGVQPFGGEGLSGTGPKAGGALYLQRLLATRPAGLPKSLEA
FT                   ALVVDAPGDRESGDNPSSALAALRDWLIEQREPALAARCEGYLARVLAGATAVLPGPTG
FT                   ERNTYTLGPRGTVLCVAATAKGARAQLAAVLATGNRALFAGAAGEALAAALPAALKPYA
FT                   GVRKQPDAGFDAVLFEGDSDELLALVKEVSQRPGPIVSVQGVAAGAFENGDEDYALERL
FT                   LTERSVSVNTAAAGGNANLMTIG"
FT   gene            91394..92533
FT                   /locus_tag="bglu_1g00860"
FT   CDS_pept        91394..92533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00860"
FT                   /product="putative periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00860"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27289"
FT                   /db_xref="GOA:C5A880"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5A880"
FT                   /protein_id="ACR27289.1"
FT                   /translation="MQHTMKKVAGATLVAVMSLAGAAHAEDVKIGFAAPMTGAQAHYGK
FT                   DMQNGIVLAIEDFNATKPVIGGKPVTFVLDTQDDQADPRTGTTVAQKLVDDGIKGMLGH
FT                   FNSGTTIPASRIYANAGIPEIAMATAPEYTQQGYKTTFRMMTSDTQQGSVAGMFAVKDL
FT                   GKKRIAIVDDRTAYGQGLADQFEKAAKAAGATIVDREFTNDKAVDFKAILTKLKAAKPD
FT                   LIYYGGADSQGAPMVKQMKSLGITAPLMSGEMVHTPTFLKIAGEAADGTIASLAGLPLS
FT                   DMPGGKAYAEKYKKRFGEDVQTYSPYAYDGAIAMFTAMKKADSTDPAKYLPVLAKTDMA
FT                   GVTSTHIAYDSKGDLRNGGITMYKVVKGEWVPLKSIGGK"
FT   gene            93054..94208
FT                   /locus_tag="bglu_1g00870"
FT   CDS_pept        93054..94208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00870"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00870"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27290"
FT                   /db_xref="GOA:C5A881"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5A881"
FT                   /protein_id="ACR27290.1"
FT                   /translation="MQSATRPRSKLPDVGTNIFTVIGRLAAEHDALNLAQGAPNFAPDP
FT                   ALVERVARAMRDGHNQYAPMPGVAALREALAAKTERLSGARYDPGSEVTVVASASEGLY
FT                   ATISALVHPGDEVLYFEPSFDSYAPIVRLQGAVPVAIKLSPETLRIDWDEVAAALTPRT
FT                   RMIIVNTPHNPTATVFGAGDLARLERLTRDTGIVILSDEVYEHMVYDGAPHHGMASRPA
FT                   LAERSVIVSSFGKSFHVTGWRVGYCLAPALLMDEIRKVHQFMAFAADTPMQVAFAQALA
FT                   EPQSYLGLAPFYQRKRDLLARELAGSRFELLPSEGSFFMLARFRRLSDERDGDFVLRLI
FT                   REARVATIPLSAFHADGTDTGLIRLSFAKDDATLVEGARRLSAF"
FT   gene            94252..95043
FT                   /locus_tag="bglu_1g00880"
FT   CDS_pept        94252..95043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00880"
FT                   /product="lysine-arginine-ornithine-binding periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00880"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27291"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C5A882"
FT                   /protein_id="ACR27291.1"
FT                   /translation="MNRWNPRAALALAAALACGGAFAAQPQATLRFGVEAQYAPFESKA
FT                   ADGTLQGFDIDLGNAVCRLAQLSCQWVEASFDGLIPALQGRKFDAINSAMNATAQRRQA
FT                   IAFTTIIYRVPTQLIARTASGLLPTAASLAGKRVGVLQGSIQEAYANAHWANAGVAVLA
FT                   YQDQSQVYADLVAGRLDATLVLAPAGQRGFLSRPDGKGFGFVGQPVRDDRMLGSGIGFG
FT                   LREGDDALKARLDGAIERLKADGTVQALGRKYFGAIDISAQ"
FT   gene            complement(95071..95682)
FT                   /locus_tag="bglu_1g00890"
FT   CDS_pept        complement(95071..95682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00890"
FT                   /product="Transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00890"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27292"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5A883"
FT                   /protein_id="ACR27292.1"
FT                   /translation="MPKFSPLALAILAMLTEAPMHAYRIQQLIKLRGKDDVINVRQRNS
FT                   LYQTLERLLRERLVVVHDTERDGMFPERTVYAITDAGRDCARSWLRDQLAQPAREFPAF
FT                   PVALSVLPLLSVEDARRQLEARLGALEEELERLDAARNAALAMQIPRLFLLEGELLQAT
FT                   VETELGWVRSVVEHLRVGALTWSEAWLREVAERLAPPDAE"
FT   gene            complement(95780..96211)
FT                   /locus_tag="bglu_1g00900"
FT   CDS_pept        complement(95780..96211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00900"
FT                   /product="MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00900"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27293"
FT                   /db_xref="GOA:C5A884"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:C5A884"
FT                   /protein_id="ACR27293.1"
FT                   /translation="MKIGELAKAARCTPETVRFYEKEGLMPDAERTDANYRRYTEVHVE
FT                   RLRFIRNCRALDMTHDEIRALLRLTDDPSDRCDSINALLDEHIGHVNARLVELQHLKAQ
FT                   LSDLRDRCQGEHTVEDCGIVHGLATMETPEAPAKRTHLG"
FT   gene            96294..98735
FT                   /locus_tag="bglu_1g00910"
FT   CDS_pept        96294..98735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00910"
FT                   /product="Heavy metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27294"
FT                   /db_xref="GOA:C5A885"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5A885"
FT                   /protein_id="ACR27294.1"
FT                   /translation="MAQVNELPDAADADMAGPRAATACCGAARTSGAPRAGACAHDDHG
FT                   HAAGHAHGHAPGHGHSHEHASDHGHSHDHSSNRAHSHDHDHGADCCAPAARALTPLPDT
FT                   SRLADGSERTAFRIMQMDCPTEETLIRKKLGGMAAVTALDFNLMQRMLTVVHAPGAAGA
FT                   VAAAIRSLGMTPEAAGAGASAAGAVRAAEAKPLWPLVTAGAAALASEALTWAGLPSWLA
FT                   ALLAVAAVALCGSSTYRKGWIAIRNGNLNINALMSIAVTGAMLIGQWPEAAMVMVLFTI
FT                   AELIEAKSLDRARNAIQGLMRLAPDTATVRRPDGSWASMAAAEVALGAIVRVRPGERVG
FT                   LDGELVAGRSTVNQAPITGESLPVEKAPGDAVFAGTINEAGSFEYRVTAVASNTTLARI
FT                   IHAVEAAQGAKAPTQRFVDRFARVYTPIVFAIALVVALAPPLLAGGAWHDWCYRALVLL
FT                   VIACPCALVISTPVTIVSGLASAARCGILVKGGVYLEEGRKLGWLALDKTGTLTHGKPV
FT                   RTDVEPFARDVEPARVAWLAASLASRSDHPVSQALATAAAAEGVRAFAEVDGFEALPGR
FT                   GVRGEIEGVAHWLGNRRLAAELGRASAALDARVAELEAQGKTVVMLGDAVRVLGLFAVA
FT                   DTVRDTSREAVAQLHALGIRTAMLTGDNAHTAAAIAREVGIDDARGGQLPEDKLAAVAE
FT                   LARQGRAVGMVGDGINDAPALARADIGFAMGAMGTDTAIETADVALMDDDLRKIPAFVR
FT                   LSRATHRVLLQNIGFALVVKLVFLGLTLAGLGTMWMAVFADAGASLIVVANGLRLLRAS
FT                   R"
FT   gene            99244..100650
FT                   /locus_tag="bglu_1g00920"
FT   CDS_pept        99244..100650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00920"
FT                   /product="Ethanolamine transproter"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00920"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27295"
FT                   /db_xref="GOA:C5A886"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:C5A886"
FT                   /protein_id="ACR27295.1"
FT                   /translation="MHAESNGRPAAGGAPGPALKQTLGTWQLWGIAVGLVISGEYFGWS
FT                   YGWASAGTLGFVVTALFIAAMYTTFIFSFTELTTSIPHAGGPFAYARRAFGPAGGYLAG
FT                   VATLVEFVFAPPAIALAIGAYLHVQFPSLEPKHAAMGAYLVFMALNIVGVQIAATFELI
FT                   VTLLAIFELLVFMGVVSPGFSWDHFAKGGWGGADHFSPGALHGMFAAIPFAIWFFLAIE
FT                   GVAMAAEEAKHPRRSIPIAYVAGILTLVVLAVGVMVFAGGAGDWTKLANINDPLPQAMK
FT                   YIVGEHSGWMHMLVWLGLFGLVASFHGIILGYSRQIFALAREGYLPEWLAKVHPRFRTP
FT                   YRAILAGGVVGIAAIYSDELIQFGGQTLTANIVTMSVFGAIVMYIVSMAALFKLRRSQP
FT                   AMARPFRAPLYPLFPAFALAAALVCLATMVYFNALVALVFLVFVALGYGYFIATRSQRA
FT                   AAPAEALLKE"
FT   gene            100712..102109
FT                   /locus_tag="bglu_1g00930"
FT   CDS_pept        100712..102109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00930"
FT                   /product="Ethanolamine ammonia-lyase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00930"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27296"
FT                   /db_xref="GOA:C5A887"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5A887"
FT                   /protein_id="ACR27296.1"
FT                   /translation="MAHTETIGARTYRFADLKTLLARASPLRSGDQLAGLAAASEEERV
FT                   AAKMALANVPLKAFLNEALIPYERDEVTRLIVDTHDAGAFAELAHLTVGEFRNWLLSPA
FT                   ADGAALERVAPGLTPEMVAAVSKLMRNQDLIAAARKRRVVTRFRNTVGLPGRLSVRLQP
FT                   NHPTDDVKGIAASMLDGLMYGSGDAMIGINPATDSLAAITKLLAMIDAFRERYRVPTQS
FT                   CVLTHVTNTIAAIEKGAPVDLVFQSIAGTEQANASFGITLALLDEAHQAARSLGRGTVG
FT                   DNLMYFETGQGSALSANAHHGVDQQTCEVRAYAVARRFRPFLVNTVVGFIGPEYLYDGK
FT                   QIIRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDTLLTLLGAAGINFIMGIPGAD
FT                   DVMLNYQSTSFHDALYVREVLGLRRAPEFEEWLETMEIADAKGALLPASPRTPLLAGAD
FT                   GWMGLGA"
FT   gene            102106..102894
FT                   /locus_tag="bglu_1g00940"
FT   CDS_pept        102106..102894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00940"
FT                   /product="ethanolamine ammonia-lyase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00940"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27297"
FT                   /db_xref="GOA:C5A888"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:C5A888"
FT                   /protein_id="ACR27297.1"
FT                   /translation="MTDPVEKDPWGALKSFTNARIALGRAGSSLPTAPLLAFNLSHAQA
FT                   RDAVHQPLDADRLRGELEAAGFATLAADSAAPDRQHYLRRPDLGRRLSEPSRAALAAAG
FT                   AAGAPDLVFVVGDGLSAFAAAKQALPLLNAVRGRLEADGWTLGPVVVARQARVALGDEI
FT                   GELLRARFVAMLIGERPGLSSPDSLGVYLTHAPRVGCHDAQRNCISNVRPEGLPHAAAA
FT                   HKLHYLLTQARRLGLTGVGLKDDSDALLPGSPERERIDRR"
FT   gene            complement(103165..104685)
FT                   /locus_tag="bglu_1g00950"
FT   CDS_pept        complement(103165..104685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00950"
FT                   /product="Aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00950"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27298"
FT                   /db_xref="GOA:C5A889"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5A889"
FT                   /protein_id="ACR27298.1"
FT                   /translation="MNHAEMQHLNIEFPYRKQYGNFIGGKWVPPVGGDYFDNVSPVTGK
FT                   PFTSIPRSQAADIELALDAAHAARAAWGATPAADRAGILLKIADRMEANLARLAVAETI
FT                   DNGKPLRETTAADIPLAIDHFRYFAGCVRAQEGSIADIGGDLVAYHFHEPLGVVGQIIP
FT                   WNFPILMATWKLAPALAAGNCVVLKPAEQTPASILVWAELIQDLLPPGVLNIVNGFGLE
FT                   AGKPLASSKRIAKVAFTGETSTGRLIAGYASANLIPVTLELGGKSPNIFFADVMDRDDS
FT                   YFDKALEGFAMFALNQGEVCTCPSRALVEESIYERFIERAVQRVEKIRQGHPLDAQTMI
FT                   GAQASEEQMEKILSYIEIGRQEGAECLTGGARNTMTGELASGFYVKPTVFRGHNKMRIF
FT                   QEEIFGPVLSVTTFKNEAEALEIANDTPYGLGAGLWTRDGNRAYHFGRNIQAGRVWTNC
FT                   YHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNLLVSYSDKPAGLF"
FT   gene            105022..106083
FT                   /locus_tag="bglu_1g00960"
FT   CDS_pept        105022..106083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00960"
FT                   /product="HTH-type transcriptional regulator eutR"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00960"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27299"
FT                   /db_xref="GOA:C5A890"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C5A890"
FT                   /protein_id="ACR27299.1"
FT                   /translation="MNAASGASRAPGGGAVPEAEDTAEDTRRAAGGADAPAGRAVVSVA
FT                   HDADEQARNLVGWRQTYDQLAAGRFVGTLTELPLDTMKLFRETTSHTLRQACEVRGDAY
FT                   WFGIPAVPDGGARIDAQPIAADGFACRPGNLGFELLTPAAFSIYGVVVRGDVLRRYAEQ
FT                   VEHAGLDDRLPRQPMIHVGAERLARLRALLAASLDGAAGPRAALSGCERHALQAAVLAA
FT                   LFDICAGPDAARQAAPDAIAPARRRRIVAQARDYVLAHRGRAVGVPELCEQLHVSRRTL
FT                   QNCFQDVLGMAPATYLRAVRLNGARRDLCGRAAGSVQDVAAAWGFWHLSQFANDYRRMF
FT                   GMRPSEALRDSAG"
FT   gene            complement(106283..107359)
FT                   /locus_tag="bglu_1g00970"
FT   CDS_pept        complement(106283..107359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00970"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00970"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27300"
FT                   /db_xref="UniProtKB/TrEMBL:C5A891"
FT                   /protein_id="ACR27300.1"
FT                   /translation="MQSNAPAGPAAPSLPDALRHPGTLLNPERLLVAPYDLELAGHAPA
FT                   GHVAASQADAGILNAAERPFRLDYARLEEIHVINGMGVALGDSIIGLTALAALRAAHPA
FT                   LRIVLYRPARLAAHVEALYRLAGGEPAAPRTLPWPLDALPRAATRIDVGNQLYRPAFAA
FT                   LPMIDYFLDALGADPGSIPAAAKRNRWLARLPLPALPPGWRRRPYALLCANASTPLRSI
FT                   PAAERAALVARIARRYGLPVAGFGPVEHRDYTDVSALSPDTAAYLAWVRDARLLVGADS
FT                   SAIHVADGFGVPTLACFTSIAPELRVRDYPHCVAARLEVPAALRDRHASDEPAHLAAVA
FT                   AAYRAFDWDAVAWPRARD"
FT   gene            complement(107566..109287)
FT                   /locus_tag="bglu_1g00980"
FT   CDS_pept        complement(107566..109287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00980"
FT                   /product="Acetolactate synthase, large subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00980"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27301"
FT                   /db_xref="GOA:C5A892"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5A892"
FT                   /protein_id="ACR27301.1"
FT                   /translation="MSIVPESAVPAASASVTGARLLVEALLANRVERVFCVPGESFLAV
FT                   LDALADETERIGTVVCRHEAAAAHMAEAVGKLTGRPGIALVTRGPGATHASIGVHTAFQ
FT                   DSTPMILLVGQCARGHLDREAFQEIDYRRMFGELAKWVAQIDDARRIPEYLSHAFHLAT
FT                   SGRPGPVVLALPEDVLSEPCAPQPAPPAAKRIAAAPSEAQLAELRERLARAERPMVIAG
FT                   GSGWSVDACADLRRFAEAWQLPVACAFRYQDCFDNEHPLYAGDVGLGINPALARRIHAA
FT                   DLLLVLGPRLGEATTGGYVLLEIPKTRQTLVHVHQGADELGRVYAADLPIVSGMPEIAS
FT                   RLAALAPPERLPWAGSAAEAHAACLAWRRPLPMPGRVQLGEIIQQLRERLPHDAIVTNG
FT                   AGNYAIWLHRHYAYRQFRSQLAPTSGAMGYGVPAALAAKSLYPQRVAVALAGDGCFMMA
FT                   GNELATAMQYGLAIVVIVVNNGHFGTIRMHQERHYPHRVHGTALTNPDFAAYARAFGAH
FT                   GETVVETAGFLPALERALASGLPALIEIRVPQEACTPAATLEQIREQGRRARGEAP"
FT   gene            complement(109537..110925)
FT                   /locus_tag="bglu_1g00990"
FT   CDS_pept        complement(109537..110925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g00990"
FT                   /product="L-serine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g00990"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27302"
FT                   /db_xref="GOA:C5A893"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:C5A893"
FT                   /protein_id="ACR27302.1"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAALMFVQGLERDELLERTAT
FT                   VKVDLYGSLGATGKGHGTDRGVMLGLMGDAPDTVDPDTIDARLAEVRDTRKLALLGRHP
FT                   VPFVLKEQIGFYRQALPEHPNAMTLRARDAAGAPLRETTYLSVGGGFVVTAGAPNTKVL
FT                   SAAEQMPYPFRTSAELLALTASTGKSIAQLMWDNERAWHDEAATRAGLLKIWEVMQSCV
FT                   SRGCGIGNPDAHGTLPGPFQVKRRAPQLYRTLTGNPELALRDPLSMIDWINLYAIAVNE
FT                   ENAAGGRVVTAPTNGAAGIIPAVLHYYMRFTPGANEQGVIDFLMTAAAIGILYKLNASI
FT                   SGAEVGCQGEVGVACSMAAGALAAVLGGTPRQVENAAEIGMEHNLGLTCDPVGGMVQIP
FT                   CIERNAMASVKAVNAARMALRGDGSHYVSLDSVIKTMRETGADMKTKYKETSRGGLAVN
FT                   IVEC"
FT   gene            complement(110956..112074)
FT                   /locus_tag="bglu_1g01000"
FT   CDS_pept        complement(110956..112074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01000"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01000"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27303"
FT                   /db_xref="GOA:C5A894"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:C5A894"
FT                   /protein_id="ACR27303.1"
FT                   /translation="MVRKVFSDRARARGRTWRALAPALAACLALAAAAQARAAMNFCAA
FT                   PALQSNEVTSAEPGVQALVRSVEARVNEQPKALAHLHTEGLLPHEGIRDASEAALNDME
FT                   LMRDAALAWRVTNDARYLALVNRFLLAWTTTYQPDFNPIDETRFESLIVAYDMTASTLP
FT                   VKTRNAAAAFIDKLGAGYVAQIEAQKRPLTGTWRNNWQSHRIKLIALAAFTLGDRKMMN
FT                   AAQRLFVEHLADNIAPDGTTLDFTERDAVHYAVYDLQPLVTAALAARRFNRNWLRERGA
FT                   NGATLEAALDWLVPYARGEKTHEEFVNSTVGFDAKRREAGLPGYSGPWSPKNATELFYL
FT                   AARLDGRYTRVAQLLAPQPPAWVAACLPLPAR"
FT   gene            complement(112162..115089)
FT                   /locus_tag="bglu_1g01010"
FT   CDS_pept        complement(112162..115089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01010"
FT                   /product="Glycine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27304"
FT                   /db_xref="GOA:C5A895"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:C5A895"
FT                   /protein_id="ACR27304.1"
FT                   /translation="MKLEHPDHLMNRTPLSLAALETHDAFAERHIGPDAASQQAMLDTL
FT                   GFASRAALIDAVIPAAIRRAETLPLGAFTQPKSEAEALAALRELAGKNQVFRSFIGQGY
FT                   YHAHTPAVILRNVLENPAWYTAYTPYQPEISQGRLEALLNFQQMVTDLTGLAIANASLL
FT                   DEATAAAEAMTLLQRNGKPKSNRFFVADDVLPQTLEVIRTRAEPIGIEVATGPASQAAQ
FT                   ADAFGVLLQYPGVNGDVHDYRALADAVHAAGGHVVVAADLLALTVLAPPGEWGADVAVG
FT                   NTQRFGVPVGFGGPHAAYLAVRDEFKRQMPGRLVGVTVDAQGKPALRLALQTREQHIRR
FT                   EKATSNVCTAQALLAIMASSYAVYHGPRGLKTIALRVNRIAALLDAGLKQLGYATVNAT
FT                   FFDTLTIEAGERAAALHEAARARRINLRHAGATRVGVSIDETTTRADLADLLAIFAEVA
FT                   GAAAPGVDALEAALPGHATLPAGLERQSAYLTHPVFNRHHSETEMLRYLRSLSDKDLAL
FT                   DRSMIPLGSCTMKLNATSEMLPVTWPEFGQIHPFAPEEQTLGYREMIAQLEAMLVAATG
FT                   YAAVSLQPNAGSQGEYAGLLIIHAYHASRGEGHRDVCLIPASAHGTNPASAHMAGMKVV
FT                   VVACDAQGNVDLADLKAKAEQHSANLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVY
FT                   VDGANMNAMVGLTAPGQFGGDVSHLNLHKTFCIPHGGGGPGVGPVAVGPHLAQFLPNQR
FT                   STGYARGEHGIGAVSAAPYGSASILPISWMYVAMMGARNLTAATEVAILNANYIAKRLA
FT                   PHYPVLYSGPGGLVAHECILDLRPIKESSGITVDDVAKRLMDYGFHAPTMSFPVPGTLM
FT                   VEPTESESQEELDRFIDAMIAIREEIRAVEEGRADREDNPLRHAPHTAAVVTANQWTHA
FT                   YTREQAAFPVASLAGNKYWPPVGRADNVYGDRNLFCACVPMSDYA"
FT   gene            complement(115151..115531)
FT                   /locus_tag="bglu_1g01020"
FT   CDS_pept        complement(115151..115531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01020"
FT                   /product="Glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27305"
FT                   /db_xref="GOA:C5A896"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:C5A896"
FT                   /protein_id="ACR27305.1"
FT                   /translation="MSNVPADLKYTDEHEWIRTEADGTLTIGITDHAQTTLGDIVFLEL
FT                   PQVGKHADAGDPVGVVESVKAASDIYAPVSGEIIAINEDAVDTPESVNQDAYDAWLFKV
FT                   RLAPGASTGALLDAQAYKKLID"
FT   gene            complement(115590..116708)
FT                   /locus_tag="bglu_1g01030"
FT   CDS_pept        complement(115590..116708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01030"
FT                   /product="Glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27306"
FT                   /db_xref="GOA:C5A897"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:C5A897"
FT                   /protein_id="ACR27306.1"
FT                   /translation="MTALKHTPLHAAHAALNARMVDFGGWDMPVNYGSQLEEHRAVRTD
FT                   AGMFDVSHMCVVDFRGERVRAFFEHAIANHVGKLRTPGKALYSCLLNPEGGVIDDLIVY
FT                   YFTENFFRVVVNAGTAEKDLAWFAHLNAEGSFALEITPRRDLAIVAVQGPNARAKVWDT
FT                   VPAVRAATSELKPFNAAQVADTPFGELTVARTGYTGEDGFEIIVPAAHVEALWHALAAR
FT                   GVRPAGLGARDTLRLEAGMNLYGQDMDDSVSPLDAGLAWTVDLCAPREFVGRAALEARG
FT                   QRSAFVGLILEKENGKAGGVLRAHQTVLTEHGEGEITSGTFSPTMQESIAFARVPAGVA
FT                   AGATVQVRIRDKNLPARVVKLPFVRNGKVLAA"
FT   gene            116711..117112
FT                   /pseudo
FT                   /locus_tag="bglu_1g01040"
FT                   /note="disrupted gene"
FT   gene            complement(117651..118055)
FT                   /locus_tag="bglu_1g01050"
FT   CDS_pept        complement(117651..118055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01050"
FT                   /product="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27307"
FT                   /db_xref="UniProtKB/TrEMBL:C5A898"
FT                   /protein_id="ACR27307.1"
FT                   /translation="MQRLIRTAVGAALVASLAACVVTPPPAKRPVPRPRPAQPAPVQPP
FT                   PPPQPAPPPIGVERMNDILGRIDSLGRRIDTRVNGGDYPPPQGQALHRRLEVIRQEATD
FT                   MGAQHGGGLTGDEQRVLNQELDTAARAIGV"
FT   gene            complement(118275..119327)
FT                   /locus_tag="bglu_1g01060"
FT   CDS_pept        complement(118275..119327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01060"
FT                   /product="Oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27308"
FT                   /db_xref="GOA:C5A8M9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8M9"
FT                   /protein_id="ACR27308.1"
FT                   /translation="MTSLLKIGLMGFGFAGATFHAPVIAHSGRTRIAAIATGQPDKARA
FT                   AYPGAAVVADLDALLAHGEVECVVIATPNDTHFDLARRALEAGKHVVVDKPVTLGSAEA
FT                   RTLARLARERGLVFAPFHNRRWDGDFLTVRELVAGGELGRITWFESHFDRFRPQIRQRW
FT                   REDATRGGGLLFDLGPHLIDQALTLFGAPETVSATVRARRDGAEAADLVHLLLGYPDKE
FT                   VLLHASALAAIEPARFTILGTRGGYQKFGLDTQEDQLKAGLTPDHVEFGGGNPPGVLRL
FT                   LDGEIETERPVPTLDGQYAEFYRALAASVQDGAPFPVAAQDAVDVMAIIELADRSAREG
FT                   RQLPFVRETF"
FT   gene            119754..121838
FT                   /locus_tag="bglu_1g01070"
FT   CDS_pept        119754..121838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01070"
FT                   /product="UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27309"
FT                   /db_xref="GOA:C5A8N0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8N0"
FT                   /protein_id="ACR27309.1"
FT                   /translation="MSAGLNAAQSEAVRYLDGPCLVLAGAGSGKTRVITQKIAHLIENK
FT                   GFEPRHIAAVTFTNKAAAEMRERVGKLLEGKTLTTPGKEGRKVPVNQLTVCTFHSLGVQ
FT                   ILRQEAEHVGLKPQFSIMDSDDCFGMVQEQIGTTDKGLIRKIQNIISLWKNGLISPEEA
FT                   MTIAANEDEHQAALVYRNYVATLHAYQAVDFDDLIRLPTELFASNEQVRDRWQNKLRYL
FT                   LIDEYQDTNACQYQLLKLLAGPRAAFTAVGDDDQAIYGWRGATLENLAQLGKDFPKLHL
FT                   VKLEQNYRSTVRILTAANNVIANNPKLFEKKLWSEHGMGDTITVTPCNDEEHEAESVVF
FT                   RLSAHKFERRTQFRDYAILYRGNFQARIFEQVLRRERIPYVLSGGQSFFDKAEIKDLCA
FT                   YLRLIANPDDDPAFIRAVTTPRRGIGNTTLEALGSFAGQAKVSLFEAVYMGGIEARLSA
FT                   RQVEPLRVFCDFIQRLTDRADKEPASVVLDDMMEAIHYEAYLYDAFDERQAQTRWQNVL
FT                   EFLEWLKRKGTKPETEAVDGEAEGFHNADGLADTGKNLLGLIQTVALMSMLEGKDEDPD
FT                   AVRLSTVHASKGLEYPHVFLVGVEEGVMPHRGSSEDDAIDDERIEEERRLMYVAITRAQ
FT                   RSLHLNWCKKRKRARETIVCEPSRFIAEMGLDEAPPPTPEEAPMTPKDRLASLKALLQK
FT                   "
FT   gene            complement(121944..122846)
FT                   /locus_tag="bglu_1g01080"
FT   CDS_pept        complement(121944..122846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01080"
FT                   /product="Cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27310"
FT                   /db_xref="GOA:C5A8N1"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8N1"
FT                   /protein_id="ACR27310.1"
FT                   /translation="MSEAPHHEAPIKTPGQLIAVIVASFAIPIAIIVLLAGYADRAFRS
FT                   GAGTDGLSDAAVAQRIAPLAQVAVKDANAPKTYKSGEEIYKAVCVTCHGTGAAGAPKFG
FT                   DAGDWAPRIAQGYDTLLQTALAGKGAMPARGGTSPDDVSDFEIARAVVYMANHGGANFA
FT                   EPAEPAEPAANAAPASAAAAEAASGASGADTAATQAAAAMAAIAALPKPGAAPAAPAAG
FT                   GAGQALYNSTCQACHATGVLGAPKFGNKADWAPRLADPIDKIYDYALHGKGSMPPKGGS
FT                   NASDEDVKAAVDYMVNAVK"
FT   gene            123102..123177
FT                   /locus_tag="bglu_1gt01"
FT                   /note="tRNA-Arg1 anticodon CCG, Cove score 82.41"
FT   tRNA            123102..123177
FT                   /locus_tag="bglu_1gt01"
FT                   /product="tRNA-Arg"
FT   gene            complement(123231..124307)
FT                   /locus_tag="bglu_1g01090"
FT   CDS_pept        complement(123231..124307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01090"
FT                   /product="Site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27311"
FT                   /db_xref="GOA:C5A8N2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8N2"
FT                   /protein_id="ACR27311.1"
FT                   /translation="MSLYKRKTSPNWQYKLYPPGGGAPVQGSTGTSNKEQAQEFHDRLK
FT                   VELWNQARLGIKPRYTWNDAVVRYVTEREGLPSLETSKTHLRWLDRHLAGVALADIDRD
FT                   RIDAIALAKRREPLTVRTKQGPVAIERTASIGTVRRVVGVLKAVLNAAVEWEWIDRAPV
FT                   TARAKLPEKRIRWLTLDQAERLLAELPDHLAEMARFSLETGLRRSNVTGLQWSQVDIVR
FT                   RVAWIHPDQAKAKKAITVPLSDTAIAVLLRQRAAKRAPAFVDSVFVYRGTPVYQTSTAA
FT                   WHKALARCGIREFRWHDLRHTWASWHVQRGTPLQVLKELGGWETMEMVQRYAHLSADHL
FT                   AQWVAPLTAAPAPRLAAI"
FT   gene            complement(124175..124510)
FT                   /locus_tag="bglu_1g01100"
FT   CDS_pept        complement(124175..124510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01100"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27312"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8N3"
FT                   /protein_id="ACR27312.1"
FT                   /translation="MATVDLAGAAAILRAHPETVRLKAKAGELPGRKVGKCWIFSTVAL
FT                   QRYLAGEWIPRVVQGDHPEESKSCRSTNGKPVPTGNTSCTPLAAERQYRAALAPATRSR
FT                   RKNSMTG"
FT   gene            complement(124594..125178)
FT                   /locus_tag="bglu_1g01110"
FT   CDS_pept        complement(124594..125178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01110"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27313"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8N4"
FT                   /protein_id="ACR27313.1"
FT                   /translation="MTRSHRPRPPCGRCPYPAFSGRAAALNSAFPCAPAMARTVTAPSP
FT                   FPLPPVPPTSRNGRGTARARRAGGRAGRFSRWVGAGSAKNLWISAVGAPKSLILEASAP
FT                   TSRPRFATGLSVFATDSVFGPAAAAPLFSLSTSLKKKKKEDQEGADTGRNHAPRLAYVL
FT                   PRVTHAAYFLGHGFFARPTEIRGNPWRKIFI"
FT   gene            complement(125175..127970)
FT                   /locus_tag="bglu_1g01120"
FT   CDS_pept        complement(125175..127970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01120"
FT                   /product="Zinc finger, CHC2-type"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27314"
FT                   /db_xref="GOA:C5A8N5"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8N5"
FT                   /protein_id="ACR27314.1"
FT                   /translation="MASIDELKQRIDLHDLADRLGMKRGRGGDRALYHSPQHEDKSPSL
FT                   SIFVNHPKHGTGWRDHSADTGGSCVDLVMYARGGSVADAVRYLHDAYGIPTTAPAAAGE
FT                   RREKSKIDYIADKCLAERDGARAYLAGRGISAAAIDAAIAARSLGFNTWTSSKVAAGEV
FT                   GHAGPAAAFVVRSPHDGRVVAVDMRYLDPAINGGVKTQTQGDKAGFGWTADPRRLAKAK
FT                   RVYVVESAINALSIDSCALPGAAALALRGLANVGDIDFTFLRGRQVVICLDNDEPFGDG
FT                   HPRAGHRPGPEAAWALYERLTSLNISAVLVDQAEWLADLGDGEAKAKPINDVNDYLQVR
FT                   GADQLGRALDQLEPWLIAGLAGDATRRGRPRIFLPSHDFAQYWRFRVRPDFTSYITKMD
FT                   RNEESGVETPVMTDLCGFRIAGISRVSVASATATMTGDDDQAPTVYFAVSVQAPRHGPQ
FT                   LIRRVMLDDQLHNVDQWGKFGPIWAPAPFKRMVNILERGADLGARQAANFVGLAWRDGR
FT                   LIVNEGPDCYFTEADKQCPYHNLTFPSGPIGDARRVITAYQATFKQNAATIPLVWALGG
FT                   HLKALLGFWPHMTVQANKGAGKSTLIKRLERSLAFTMFSGQSLQTEFRLLTSISHTSHP
FT                   VGWEELSARRQDVIDKAVGLLQENYQYTVTRRGTDMTEYLLCAPVMLAGEDVPVRSLLG
FT                   KLVRTTLTGKRGPLLPDDLPRFPVRQWLEFLAGLDKRSVLDQYGKLRDKALANCRASGE
FT                   DDGAKRMAGNYAALALAWRYLCDFAGMDPSEGDFPRDLLTEMNGHVAETSADREPWVWI
FT                   METILSEIDGGNYKHPFTFDTVDGEFCLLLRSGHVMDHIAHTSSLRDKWNGLPVKSDRV
FT                   FKAQLKHAGVVVGEKEVERRIYTRRVAHLVPISLERLAAFGLYVSVREDLASDALQGAA
FT                   A"
FT   gene            complement(127972..128226)
FT                   /locus_tag="bglu_1g01130"
FT   CDS_pept        complement(127972..128226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01130"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27315"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8N6"
FT                   /protein_id="ACR27315.1"
FT                   /translation="MKRVTHTAPHDALLRAAIAAAADVLPFNNPPGSVARQCTLGLFVA
FT                   ALGDRLALAFPESAEALHALVLSPATTGNPTQATPEHQQ"
FT   gene            complement(128223..128594)
FT                   /locus_tag="bglu_1g01140"
FT   CDS_pept        complement(128223..128594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01140"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27316"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8N7"
FT                   /protein_id="ACR27316.1"
FT                   /translation="MIAMTNDQAIRYEVLTNGGLRTVIGEHIVIPNEAGAAFGIHADPL
FT                   LPDGHYEKWAVTHLVSGLPAGAGATRASAVKQATRNCERNRKRLRDMLDEATTARTRIQ
FT                   FAAGQLERNSLTTESEKRA"
FT   gene            complement(128591..128785)
FT                   /locus_tag="bglu_1g01150"
FT   CDS_pept        complement(128591..128785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01150"
FT                   /product="Putative phage-encoded membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27317"
FT                   /db_xref="GOA:C5A8N8"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8N8"
FT                   /protein_id="ACR27317.1"
FT                   /translation="MKPYVFALGVLLMLAFSTAGMSWLASSALRLVDARHARALALAVS
FT                   VLCMVALVASLAWSVPPRG"
FT   gene            complement(128802..129005)
FT                   /locus_tag="bglu_1g01160"
FT   CDS_pept        complement(128802..129005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01160"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27318"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8N9"
FT                   /protein_id="ACR27318.1"
FT                   /translation="MRAPLSDIELRAAWHRMRMVGDFDASMRHRAVRLAVESAARALQQ
FT                   REQARQHRAFDAKRHAANDIDQ"
FT   gene            complement(129008..129220)
FT                   /locus_tag="bglu_1g01170"
FT   CDS_pept        complement(129008..129220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01170"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27319"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8P0"
FT                   /protein_id="ACR27319.1"
FT                   /translation="MATALSAPVVTPFDVSSLSLQQRIDYLSTLCLADIELVAFVEIAR
FT                   KLGYTLTGRWDCENDRPVLKPALYH"
FT   gene            complement(129311..129559)
FT                   /locus_tag="bglu_1g01180"
FT   CDS_pept        complement(129311..129559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01180"
FT                   /product="Putative phage transcriptional activator
FT                   Ogr/Delta"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27320"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8P1"
FT                   /protein_id="ACR27320.1"
FT                   /translation="MRILNRCPHCRTRATARSSREMSATFREVTYQCNNVECGHTYVVN
FT                   MEFARTLSPSATPNMSLQLPLSPHVRDRLAEQLELPV"
FT   gene            complement(129547..129750)
FT                   /locus_tag="bglu_1g01190"
FT   CDS_pept        complement(129547..129750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01190"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27321"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8P2"
FT                   /protein_id="ACR27321.1"
FT                   /translation="MPETSTEIAFSDNEREVLEAVRRLHGLPSIDAAAEWLVKRRLRAL
FT                   SKQSNGRGRALYLVRSDPKCAS"
FT   gene            complement(129790..129987)
FT                   /locus_tag="bglu_1g01200"
FT   CDS_pept        complement(129790..129987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01200"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27322"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8P3"
FT                   /protein_id="ACR27322.1"
FT                   /translation="MYPDPKRVRNHKHTVRLDDYEQALITALANYQGEQPAVLMRSILM
FT                   REATAVLGEQNTEILDRAGA"
FT   gene            130299..130793
FT                   /locus_tag="bglu_1g01210"
FT   CDS_pept        130299..130793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01210"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27323"
FT                   /db_xref="GOA:C5A8P4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8P4"
FT                   /protein_id="ACR27323.1"
FT                   /translation="MDTIGSRLREERLRLGLSQEEFAAVGGVARRAQTNYEADERSCDA
FT                   KYLAAVAGVGVDLLYVLVGVRVGPISSQSEPKSQGGSDEGERDLIESYRQLNEAGKAAL
FT                   QAFMASLGLTGQLTTSAPKRAKRLAENRRAALDQRTAENVERAVAEVERARAERAARKK
FT                   K"
FT   gene            complement(131255..132337)
FT                   /locus_tag="bglu_1g01220"
FT   CDS_pept        complement(131255..132337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01220"
FT                   /product="Fels-2 prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27324"
FT                   /db_xref="InterPro:IPR023399"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8P5"
FT                   /protein_id="ACR27324.1"
FT                   /translation="MPANSNSRTPDERRRMARVEREPDYRITIAGRDISKRFAPRLQSL
FT                   TVTESRSEEADTVDIVLDDARGDIALPKRGQEIKVSIGWAGSTLIDKGTFIINEFEYAG
FT                   APDTITVRARSAAMRDGMQERREKSWHKQTIGAIVKSIAARYSLAPAIGDTLAKIAIAH
FT                   IDQTQESDMSFLTRLAKRYDAVMNVKDKRLLFMPIGTGKTASGKPLDELAIVRKDGDSH
FT                   RYHVSERENYNAVRAHYHSNGHGRRKSVIVGGENNHNVKVLPEDYATKEEAMAAAQAEY
FT                   NRTQRSQQTLSYSLAWGRPEVFPEMPVTVAGLKPEIDEAAWIVKRATHTLDDSGLVTDL
FT                   DLEMRDDPTTDRHRSHLGKR"
FT   gene            complement(132337..132786)
FT                   /locus_tag="bglu_1g01230"
FT   CDS_pept        complement(132337..132786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01230"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27325"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="InterPro:IPR016912"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8P6"
FT                   /protein_id="ACR27325.1"
FT                   /translation="MLMSLDQFVFSLTSAPFHELSRRRDWKHARKSRVGARDSRQFAGE
FT                   GEDTITLTGMVAPGVIGDAASIDALAAMADHGDAYVLVDGAGHAYGAYVITGLEERQCY
FT                   HTAEGIPRRIDFTLTIERVDDEVLRQTPDAPYDDPDNDDTDDQEA"
FT   gene            complement(132800..136039)
FT                   /locus_tag="bglu_1g01240"
FT   CDS_pept        complement(132800..136039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01240"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27326"
FT                   /db_xref="GOA:C5A8P7"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8P7"
FT                   /protein_id="ACR27326.1"
FT                   /translation="MSNELKLRIMFDMIDKYTKPLRNILNGNKGLSQSLRQAQSDLKRT
FT                   RGELAELSKKQQAVGKFRELRAGLDETAKRLAGARAQSRELAKALHASGPPSREMVTEL
FT                   ARARQAVAQLGAEHKRESKAVDEMRVKLAQTGIDTRKLSDHERTLRGSIVSSTDAMKAQ
FT                   VRQLEALGQREKRLAEARKGMQAMQAVAGGMAVSGYAARATGTRIFHGFGDALDEEKKM
FT                   ANERARIKALGLGDAATRDAETYVRAMKTMGVSTTENMTMMRDALSIFADEHHAQMVMP
FT                   TLASMKFGTDSLFGADDAHANEEKFMNMLKVIELRGGTKDEATFRGEANRVQKVLSATG
FT                   GRVGGDEWRNFIQTGGVAAKQLKADAFYYQMEPLIQEMGGHAVGTGLMSAYQNLVQGKT
FT                   TNRAKSMLVKYGLLDPSKVKYDKVGNVKEILPGGLKGGDMITNSPVDFVEKVLLPQFAK
FT                   HGVTDPKKINDLIGAMITNRTGANLYATIAMQLQQIRKSEKLNGGANGIDDNEALARAT
FT                   PQGKELAAHAQLRDLMREMGQAVLPLYMKGLDLASSVLSKLTDAIKAHPDAAKIILSAA
FT                   AAFGALLVVGGTVTIVLAGILGPLALLRFSMLTLGIEGSVLRRSLGAGADAFRGLGRAG
FT                   TKSGELLASAFKASSPTEASRRLRSFVRQLGTAIPNAGKAAVDTLKDWGKTSVTTLRNG
FT                   LVAARRYTRQVWLAVAAQTAAARGAVAGAWSRGRQYAGSRGIGGMMRDGVVSLGAFLRG
FT                   GALRSIGSIGRALLFVGQVLLWIGAAVLTPVGLFIAALVAGALVILRYWEPIKAFFRGF
FT                   WSGLREGLAPLAPAFERAFGGLKRMLDPLKPVFDWVVDGVRAAWDWLSKLFGPVDTTAA
FT                   SLTKATDAGKGFGLWLASIIVDIGNAADRFIQFGADLTNGLVNGIKSGFSNVKDAISSL
FT                   ADSTIAWFKEKLGIHSPSRVFASLGGFVSDGAAVGMDGGQKRVARAAAGLATAAVASFG
FT                   SPMLTTAATLAAPAAAIVSPTVPIDNRPPLAASSSGSTAATGGATQAAAPVINIYPAAG
FT                   ADPQAIARAVAAELDKRDRAQRARTSARLSD"
FT   gene            complement(136036..136155)
FT                   /locus_tag="bglu_1g01250"
FT   CDS_pept        complement(136036..136155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01250"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27327"
FT                   /db_xref="InterPro:IPR009493"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8P8"
FT                   /protein_id="ACR27327.1"
FT                   /translation="MADIATVFHWAPRDMEGFSLSELMDWRERARIRSGTEDA"
FT   gene            complement(136164..136502)
FT                   /locus_tag="bglu_1g01260"
FT   CDS_pept        complement(136164..136502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01260"
FT                   /product="Gp28, phage tail protein E"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27328"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8P9"
FT                   /protein_id="ACR27328.1"
FT                   /translation="MTNHHNDTTTTTENNAANTHTLDTPIERDGQTITTVTLTKPDTGA
FT                   LRGTSLAALVNLDVDALCKVLPRITTPTLHPSDIRLMDPADLVALGGLFAGFLMPKAVK
FT                   ASMEFPTE"
FT   gene            complement(136557..137066)
FT                   /locus_tag="bglu_1g01270"
FT   CDS_pept        complement(136557..137066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01270"
FT                   /product="Phage major tail tube protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27329"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Q0"
FT                   /protein_id="ACR27329.1"
FT                   /translation="MGMPRKLKNFMLFYNGNRFAGDVDEIELPKLKRKMEGWQGGGMSG
FT                   PVKIDMGQDEIQLEWTCGGLMTEVLSDWGITTHDGVLLRFAGGYQAEDSAKYDSVEIIV
FT                   RGRHEEIDMGKAKVKDNTSFKVTTAASYYKLSVNGSVLIEIDFINMIENVNGTDLAAGL
FT                   RNAIGL"
FT   gene            complement(137083..138255)
FT                   /locus_tag="bglu_1g01280"
FT   CDS_pept        complement(137083..138255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01280"
FT                   /product="bacteriophage major tail sheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27330"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Q1"
FT                   /protein_id="ACR27330.1"
FT                   /translation="MPQDYHHGVRVIEVTNGGPPIRTVSTAVLGIVCTASDASDTAFPL
FT                   NTPVLITNVISALGQAGTKGTLRKTLDAIGKQTKPVTVVVRVPDGKDEAETTSNVIGTV
FT                   TADGKYTGAKALLTAQAKLGVKPRILVAPGLDTAAVAAALAPIAQSLRAFAYVSANGCK
FT                   TKEEATAYRKQFGQREIMVIWPDFIGWDDTTNATAIIPAPAIAAGLRAKIDNDIGWHKT
FT                   ISNVVINGVTGISADVSWDLQDPATDAGYLNEHEVTTLVNYNGFRFWGSRTCAADSKFV
FT                   FENYTRSAQVIADSIAEAQMGNVDGALNPSLARDIIENINSWFRRQVSNGYLIGGHSWY
FT                   DPEPNTNDVLSAGQMYLDYDYTPVPPLENLMLRQYITDRYLATFADRVTA"
FT   gene            complement(138294..138929)
FT                   /locus_tag="bglu_1g01290"
FT   CDS_pept        complement(138294..138929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01290"
FT                   /product="Bacteriophage-acquired protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27331"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Q2"
FT                   /protein_id="ACR27331.1"
FT                   /translation="MLVHHYNPTTGEYLSSGQPDADPLNNDRWLIPSNATLDAPPPRAA
FT                   TSWPFYRDGAWFLLPDYRGRRCYRTDTGEPVEIAVAGKTPDELGLTDIPRPSPRHAWVD
FT                   GAWVVPDSVIEAEKRAARQQTFDQLMANAKKANDGKADAYAAGLLDDEGIYYFKAWSAY
FT                   QMALVAAMNSTDASATITWPKTPAPYVAPVAEVAPQDVTPPEAPTKSA"
FT   gene            complement(138948..141545)
FT                   /locus_tag="bglu_1g01300"
FT   CDS_pept        complement(138948..141545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01300"
FT                   /product="Phage-related tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27332"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Q3"
FT                   /protein_id="ACR27332.1"
FT                   /translation="MAGNLIQITDAGRAALVAPGNTGTAAHRVVSIGLATASFAFDRAM
FT                   LAMPNERKRIITFGGENVAADTIHVVLQDDTDDQYALYGFGLYLDSGVLFGAYVQDAPI
FT                   MEKSPAAILLLAADAVFSTIDAAQLEFGPTTFLNPPATTERQGVVELATVDEVAAGADA
FT                   TRAVTPLGAAKRYMPISGGIFSGPIAVQASVDTNNAQVVVSPAVGKLGAESKVRFSAAF
FT                   GDPKSNDTSPRVVASVRAGFNGGVWGSEYLDFHLNRVPNDARDDANMDRALRLAAGGRA
FT                   VIGATQDDGGTALQVGGSVRANNYGIGDQSSKASGLVGISNGTNGPNVGFYGRESVGGG
FT                   AITLSTGGKERLRLKGDGKLLIGTDTPDASAAVLQVAGAASVTGSIIANGTSAFARGVQ
FT                   STGLDDGGGSFRATNGGYGAFLRNDGSHMYLLSTKKGDPLGSFNDYRPFAWDLDSGYVT
FT                   IDYNGHGASVGGALSIAISASIGRGRDQGVIWLGPRNDGYLYSTADSCGWWYGAAGSVQ
FT                   YVFGDHSLRVDNQPVWHAGNLTPLDRNAGGWMASDVHFAPGARLVLSEGSPGAPSLTFE
FT                   NDGAPDTGLYHVADGQFGVTCNSQPIVGFAPDGTRFTSNVFGPTPAAGDRSTRFATTEW
FT                   VLSALSSSSIGQIVFEPRTTTRAGFLKANGSLLERADYPALWAYAQASGALISDAAWWA
FT                   GQSGCFSTGTTGTNFRIPELRGEFLRCLDDGRGLDTSRAAGSLQLSQNAKHSHDASSTV
FT                   GGSHTHGAFTTGAGSHNHAIDQQPHAHDTWLGSVQVSGVDRGGGFGPYNGRVGEAWSDP
FT                   ANANIAILPTGDHVHGAGTYPAGDHNHAIAVQPSGGDEARPRNIALLAMIRAY"
FT   gene            complement(141552..142079)
FT                   /locus_tag="bglu_1g01310"
FT   CDS_pept        complement(141552..142079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01310"
FT                   /product="phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27333"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Q4"
FT                   /protein_id="ACR27333.2"
FT                   /translation="MNSLLPPSATVLERRIAEASAPATAVPVTLDTLMDPDRVPLAVLP
FT                   WLAWHMGVETWKDYWPEQIKRARVKAAIRIARMKGTAEAVRQVCASFGANVVLREWFEL
FT                   TPKGRPGTFEILLTVGDRDGVPATAAYVADIIAEVDRHGPLHAHARIQRERPATHWRRR
FT                   ARRALSPPEPHG"
FT   gene            complement(142072..142977)
FT                   /locus_tag="bglu_1g01320"
FT   CDS_pept        complement(142072..142977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01320"
FT                   /product="Bacteriophage baseplate assembly protein J"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27334"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Q5"
FT                   /protein_id="ACR27334.1"
FT                   /translation="MRTTPIDLSQLPAPSIVDAIDFETLYAQRRASLLALYPADQQAEI
FT                   AATLALESEPLARLMQESAYREMLLRQLVNDKARGVLLAYASGSTLDHIAALFDVDRLL
FT                   ISAADPENNIAAVYEDDDSLRERVQLAPRGFSVAGPEEAYEFHARSADGRVLSASAKSP
FT                   EPCVMVVSVLSRDGDGTADAALLATVRAALEGKRPLSDEVIVQSAEVVPYTIRATLRFF
FT                   SGPDRSVALAEAKKRTAQFANDMHRIGMEVTVDGLFAAMRVPGVQKVLMDSPAGGVPIT
FT                   GAQAPFCTGIELVDGGVADE"
FT   gene            complement(142974..143336)
FT                   /locus_tag="bglu_1g01330"
FT   CDS_pept        complement(142974..143336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01330"
FT                   /product="Bacteriophage baseplate assembly protein W"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27335"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Q6"
FT                   /protein_id="ACR27335.1"
FT                   /translation="MKGMNAATGRAIGGTDHLAQSIARILSTPLGTCIQRRTFGSELPE
FT                   LVDAPNNGATRIRLYAATVTALMRWEPRLTVTRVQLVAAGADLLDGRQYIDIEGWTDER
FT                   DELTTLRVPISNGTKA"
FT   gene            complement(143333..144031)
FT                   /locus_tag="bglu_1g01340"
FT   CDS_pept        complement(143333..144031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01340"
FT                   /product="bacteriophage baseplate assembly protein V"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27336"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Q7"
FT                   /protein_id="ACR27336.1"
FT                   /translation="MDANETHRKARNAVRKGSILDIDHANALCRVAVGESDDDGLQTNW
FT                   IPWIAGSAGTTRDWLPPTRGEQVVLLCPMGDPAQAVALRGFYSDAAPAPDASPNTHTRV
FT                   YPDGARVTYDHAGHSLVAELPAGATVRIVAPVSVTVETKAATIKADTATIDAANTTCTG
FT                   SLTVKGPFAFESGMTGKGGTEGGRGSVMRIDGSAAFTGDVTAGQVSLQSHKHQAQGENA
FT                   ITSQPISGAA"
FT   gene            144201..144977
FT                   /locus_tag="bglu_1g01350"
FT   CDS_pept        144201..144977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01350"
FT                   /product="site-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27337"
FT                   /db_xref="GOA:C5A8Q8"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Q8"
FT                   /protein_id="ACR27337.1"
FT                   /translation="MTTHQAFAPPLTRPAPAINQLHQVDALELARSLPDHSIDMVFTDP
FT                   PYASGGLHLSAKTRSVQAKYIQSGIAVDYENFEGDNMDQRAWAFWCHAWLSECRRAMKP
FT                   GGLLACFIDWRQLATLTDVVQAAGLIFRGIAVWDKTPGRFRPRRGGFAQQAEFLVWASR
FT                   GDMRQSEVYLPGVFSVRLPLPKQHVTEKPLDLAREVVRLVPADGVVFDPFAGSGTHLVA
FT                   ARDAGLSWIGAETNRRYHEVATARLAGGWASVGQVA"
FT   gene            complement(144957..145418)
FT                   /locus_tag="bglu_1g01360"
FT   CDS_pept        complement(144957..145418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01360"
FT                   /product="phage virion morphogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27338"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Q9"
FT                   /protein_id="ACR27338.1"
FT                   /translation="MSDETTVIDAWINALIGKLEPAPRRKLLRDLGQDLRRTQQARIAA
FT                   QHNPDGSAYEPRKGKKPRARDKAGRVRRLAMFRKLRTARYLKVTVDAAGVSIGFDDRLS
FT                   RIALIHQEGRRAPVVPGGPVVQYPARVLLGWPPEDRAEVLNHLLRYLTH"
FT   gene            complement(145415..145831)
FT                   /locus_tag="bglu_1g01370"
FT   CDS_pept        complement(145415..145831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01370"
FT                   /product="Bacteriophage tail completion protein R"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27339"
FT                   /db_xref="InterPro:IPR009678"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8R0"
FT                   /protein_id="ACR27339.1"
FT                   /translation="MNKVNSLRAAIVAAVPELARAPDRLLVFVNDGTVCATGTRTTSFD
FT                   CEYECELIITRFTGHAIVVMAAVIEWAKLNEPALVENPDLRRGGIAFEADIQSNEATDI
FT                   VLKLKLSESVVVKVDDDGRRLVEYFDEAAEPWQP"
FT   gene            complement(145824..146090)
FT                   /locus_tag="bglu_1g01380"
FT   CDS_pept        complement(145824..146090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01380"
FT                   /product="Gp41, LysC"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27340"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8R1"
FT                   /protein_id="ACR27340.1"
FT                   /translation="MATNRFAPGLIALSLAMLCACTQAPPSPAATITLRECATVTRCTM
FT                   PAMQPRSNGELSNALQAARAAWARCAAEVDMVAACQAKAGRDE"
FT   gene            complement(145933..146361)
FT                   /locus_tag="bglu_1g01390"
FT   CDS_pept        complement(145933..146361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01390"
FT                   /product="Putative phage-encoded lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27341"
FT                   /db_xref="InterPro:IPR020000"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8R2"
FT                   /protein_id="ACR27341.1"
FT                   /translation="MTLRAWIVLAALAAAASAGFEYVRQLQARLATAAAQVATARQDLG
FT                   ARDATIARMQADARDKDAQLAKLAHARAAVDSALTTSQQQLRNLIDGNESIRAWADSPL
FT                   PGDVVRLHASPALTGGDDYASRVRDGDALHDAGDAAAQ"
FT   gene            complement(146358..147170)
FT                   /locus_tag="bglu_1g01400"
FT   CDS_pept        complement(146358..147170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01400"
FT                   /product="Gp43, bacteriophage-acquired protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27342"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR024408"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8R3"
FT                   /protein_id="ACR27342.1"
FT                   /translation="MNVLHFNDRGAEVGLLQSRLARAGYTVPTTHIYDEATERAVKAVQ
FT                   AAAGLVVDGIAGPKTYATLASGQRNPKHMADADLIAAAGKLGVSVACVRAVNEVEAKGV
FT                   GFLDDGRPKILFERHIMYRQLTANVGQAAAVDAAKQFPAVVSESAGGYQGGAAEYVRLD
FT                   TAARIDAASAYASASWGAFQVMGFHWKRLGYSSVDDFVSQMETSEAAQLDAFVRFILAD
FT                   KALLAALKARKWATFAAAYNGADYARNLYDVRLERAYAKYAGNDKAAA"
FT   gene            complement(147167..147439)
FT                   /locus_tag="bglu_1g01410"
FT   CDS_pept        complement(147167..147439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01410"
FT                   /product="Putative phage-encoded membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27343"
FT                   /db_xref="GOA:C5A8R4"
FT                   /db_xref="InterPro:IPR008473"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8R4"
FT                   /protein_id="ACR27343.1"
FT                   /translation="MHMSYALIALAAHLAVILRVLTHRKDGTRHRFHIAWAAWAIVAVS
FT                   GGAGIELLLHARTAGFFQAALAVLLAVLVYLARGDVAHLLRSKQA"
FT   gene            complement(147441..147785)
FT                   /locus_tag="bglu_1g01420"
FT   CDS_pept        complement(147441..147785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01420"
FT                   /product="Putative phage-encoded membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27344"
FT                   /db_xref="GOA:C5A8R5"
FT                   /db_xref="InterPro:IPR032637"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8R5"
FT                   /protein_id="ACR27344.1"
FT                   /translation="MAEPNTTTAAALFAALGIAGVAPGIDGDALIGAFAGAALVVVTSK
FT                   DLGIGRRAAYMLISLVMGYLAAPEIMNVVPIHSTGVAAFLSAALVIAVTLTLIERVKGV
FT                   DFFAFLRKGE"
FT   gene            complement(147799..148005)
FT                   /locus_tag="bglu_1g01430"
FT   CDS_pept        complement(147799..148005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01430"
FT                   /product="Phage tail protein X"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27345"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8R6"
FT                   /protein_id="ACR27345.1"
FT                   /translation="MKLTALQGDTLDALCWRHYGSTAGTVEAVLDANPGLAELGAILPL
FT                   GTVIDMPELNTIEQTKPLLHLFD"
FT   gene            complement(148005..148484)
FT                   /locus_tag="bglu_1g01440"
FT   CDS_pept        complement(148005..148484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01440"
FT                   /product="Fels-2 prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27346"
FT                   /db_xref="GOA:C5A8R7"
FT                   /db_xref="InterPro:IPR009225"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8R7"
FT                   /protein_id="ACR27346.1"
FT                   /translation="MSSFVAVAEPRPASTPIDGTLTNDGFFPDIDLAPLRNDMRLDGTV
FT                   TRERLAHATREAMLSVNDELSAWRATQREAGARTLQDVPADLIDGTSRLVYRYLRAVYH
FT                   LAHADVTEKYRGYDTTKSGARDDDELCHTVNESRRNARWAVSDILGRPRSTIELI"
FT   gene            complement(148581..149270)
FT                   /locus_tag="bglu_1g01450"
FT   CDS_pept        complement(148581..149270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01450"
FT                   /product="Phage small terminase subuni"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27347"
FT                   /db_xref="GOA:C5A8R8"
FT                   /db_xref="InterPro:IPR010270"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8R8"
FT                   /protein_id="ACR27347.1"
FT                   /translation="MTINTPARAHFARVSAARAAAATAPGQTMAGATPYELMLAKLAAD
FT                   RRALKGVQSVARKVELKRKLLPEYADYVAGVLNGGHGAQDDVLMTIMVWRIDAGDYDDA
FT                   LAIAAYALTHDLALPDQFERSLASVVAEQFADAALAAFLERSTFDAHSLELVDELTADA
FT                   DMHDQVRAKLCKALGYAVQEADPPRALDYLRRALSLNDRVGVKKDIDRLSKLIEATGRP
FT                   GDSAEGM"
FT   gene            complement(149267..150280)
FT                   /locus_tag="bglu_1g01460"
FT   CDS_pept        complement(149267..150280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01460"
FT                   /product="Gp2, phage major capsid protein, P2 family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27348"
FT                   /db_xref="InterPro:IPR006441"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8R9"
FT                   /protein_id="ACR27348.1"
FT                   /translation="MKKETRQAYRKYATQIAKLNDTDDVSQKFAVEPSVQQTVETKMQE
FT                   SSAFLKSINVLPVTELEGEKLGLSVSGPIASRTDTTKAERQPVDPTALDSNRYRCEKTD
FT                   YDTAITYRKLDAWAKFPDFQQRIRNVILNQSALDRIMIGWNGVKAALSTDKAANPLLQD
FT                   VNIGWLQQYRDRASHRVLHEGAKEAGKVLVGKGGDYVNLDALVMDIVSSMIDPWFQEDT
FT                   GLVVICGRELLHDKYFPIVNTTQAPTEQLAADLIVSQKRIGNLPAVRVPFFPKRAMMVT
FT                   KLENLSIYFQEGARRRSLIDNPKRDQIENYESSNDAYVVEDFGCGCVSENIELVAA"
FT   gene            complement(150316..151128)
FT                   /locus_tag="bglu_1g01470"
FT   CDS_pept        complement(150316..151128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01470"
FT                   /product="Phage capsid scaffolding protein (GPO)"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27349"
FT                   /db_xref="GOA:C5A8S0"
FT                   /db_xref="InterPro:IPR009228"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8S0"
FT                   /protein_id="ACR27349.1"
FT                   /translation="MATNKTKFFRVAVEGATVDGREIKREWLTQMAKNYNRELYGARLN
FT                   IEHLKGWAPLSATNPFGAYGDVIALKASEIEDGPLKGKMGLYAQLDPTDELVALSKKRQ
FT                   KVFTSIEVNPDFADIGEAYLVGLAATDDPASLGTEALQFAARRSNNLFSAACETLIEFD
FT                   GEPESTSLLSIVKSMFARNRSTDDQRDADVRHAVEEIAGFVSQQGCDVAALRVDLTAAQ
FT                   QDAAAAKKRADEAVTAVEALTTKLSATDNGAPRRQLSTGSTGELATDC"
FT   gene            151273..153042
FT                   /locus_tag="bglu_1g01480"
FT   CDS_pept        151273..153042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01480"
FT                   /product="Phage terminase, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27350"
FT                   /db_xref="GOA:C5A8S1"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8S1"
FT                   /protein_id="ACR27350.1"
FT                   /translation="MLETTDPIQREANVRQIARSLYWQGWRISSIARHLELKPATVASW
FT                   CRRDKWKDATPIERIEAAAETRLMVLIAKDKKDGADYKEIDLLGRQIERLARVQKYGET
FT                   GREGDLNPNIAARNAGPKRKPPKNEISEEQEERIVKAFRESLFDYQKVWYRNGDQQTRN
FT                   ILKSRQIGATWYFAREAFVDALDTGRNQIFLSASKAQAHVFKQYIVQFARDVADVELTG
FT                   DPIILPNGATLYFLGTNSRTAQSYHGNLYFDEYFWVPKFRELNTVASGMAMHKRWRLTY
FT                   FSTPSSTTHEAYAFWSGADANRGRAPGDRIQIDTSHEALVRGMLGEDEQWRQVVTVLDA
FT                   IEGGCDLFDLERLRRRYSADAFANLLMCQFIDDSVSVFKLAELQRCMVDSWEEWADDFS
FT                   PLLLRPFGYREVWVGYDPALTGDSAGLVVVAPPRVEGGTFRVLERHQFRGNDFEEQAAA
FT                   IEQITRRYNVGYIAIDTTGMGQGVYQLVRKFYPAAVALNYSPEVKTRLVLKGQSVIRNG
FT                   RLQFDAGWTDLAAAFMGIKQTMTASGRHATYTADRNEETGHADLAWACLHAIDREPLAG
FT                   GDINSSSFTEFYS"
FT   gene            153039..154094
FT                   /locus_tag="bglu_1g01490"
FT   CDS_pept        153039..154094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01490"
FT                   /product="Gp5, phage portal protein, pbsx family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27351"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="InterPro:IPR030935"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8S2"
FT                   /protein_id="ACR27351.1"
FT                   /translation="MSKRRSRAPRTFAAAPDSGAAGAAPARAEVFTFDDPTPVMNRAEI
FT                   LDYVECWSNGDWFEPPVSFAGLAKSFRASTHHSSALYFKANVLASTFRPHRWLSRNAFE
FT                   RWALDFLTFGNGYLERRRNQLGDTLRLEPALAKYTRRKADFSGFVYVNGWQDKHEFEPG
FT                   SVFQLMRPDINQEVYGLPEYLSSLHSAWLNESSTLFRRKYYENGSHAGFILYMTDAAQK
FT                   QEDVDNMRTALKNAKGPGNFRNVFMYAPGGKKDGIQLIPVSEVAAKDEFFNIKNVTRDD
FT                   LLAAHRVPPQLLGIVPSNSGGFGTPDTAARVFGRNEIKPLQARFAELNDWLGEEVVSFD
FT                   DYEIPPAPVDA"
FT   gene            complement(154202..154864)
FT                   /locus_tag="bglu_1g01500"
FT   CDS_pept        complement(154202..154864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01500"
FT                   /product="Eco29kI restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27352"
FT                   /db_xref="GOA:C5A8S3"
FT                   /db_xref="InterPro:IPR018575"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8S3"
FT                   /protein_id="ACR27352.1"
FT                   /translation="MTDSIGNIIPFNPLDKKNLGASVAEAMLEQKPQPLGELKQFFGVG
FT                   IYAIYYVGDFEAYAPLAERNRNGALQAPIYVGKAVPKGARKGGGVGEVRSKALYDRLRE
FT                   HAESVQLATNLDIKDFVCRFLVVDDIWIPLGESLLIAKFAPLWNALIDGFGNHDPGSGR
FT                   YNGLRPRWDVLHPGRAWAEKCKAREETQGHIVRDVQNYFSTISFPASHHVLGPDQQP"
FT   gene            complement(154861..156084)
FT                   /locus_tag="bglu_1g01510"
FT   CDS_pept        complement(154861..156084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01510"
FT                   /product="DNA cytosine methyltransferase M.NgoMIII"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27353"
FT                   /db_xref="GOA:C5A8S4"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8S4"
FT                   /protein_id="ACR27353.1"
FT                   /translation="MKAVELYAGAGGLAMGVGLAGFKPLAVVEWDRWACDTIRENQRRG
FT                   FPLVADWPLYEGDVRKFDWSRLEGEEIDLLAGGPPCQPFSMGGKHQAHDDSRDMFPATV
FT                   DIVRKLRPKAFIVENVKGLTRSTFANYYQYILLQLEFPEVPARRNEEWFEHHLRLQAER
FT                   TSGRQKGKKLTYNVVPTLVNAADYGVPQKRERVFIVGFRSDLDVDWSFPRPTHSYDSLL
FT                   RDQWVTGEYWERHQVPRRARPTMPESVASRVRRLAGSLPFATELPWRTVRDAIAGLPSP
FT                   LARTASQYQDHRFQPGARVYPGHTGSPLDLPAKTLKAGDHGVPGGENMLVNTDGSVRYF
FT                   SIRESARVQTFPDGFKFHGSWTETMRQLGNAVPVALGHVVARSVAERLAIVQLEQLARR
FT                   RVTVRGAA"
FT   gene            complement(156071..156466)
FT                   /locus_tag="bglu_1g01520"
FT   CDS_pept        complement(156071..156466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01520"
FT                   /product="DNA mismatch endonuclease Vsr"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27354"
FT                   /db_xref="GOA:C5A8S5"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8S5"
FT                   /protein_id="ACR27354.1"
FT                   /translation="MSRIKGSNTKPELIVRSLIHRIGYRYRLHGKGLPGRPDLVFSKRR
FT                   KVIFVHGCFWHRHDGCHLARLPKSRLDFWRPKLEANAERDKEVERRLSELGWKVLTIWE
FT                   CEVKDEVVLTLRVRAFLDDTENNNEGS"
FT   gene            complement(157161..158579)
FT                   /locus_tag="bglu_1g01530"
FT   CDS_pept        complement(157161..158579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01530"
FT                   /product="Deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27355"
FT                   /db_xref="GOA:C5A8S6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8S6"
FT                   /protein_id="ACR27355.1"
FT                   /translation="MGKPLYTDRDIERISPVENGSEFDPSDKTRAHFRRDYARLVHCAA
FT                   FRRLQGKTQLFPGGESDFFRNRLTHSIEVAQIAKGIAIRLNAKTPQLIKQKINTDLVEL
FT                   AALAHDIGHPPFGHNGEHALDECMANHGGFEGNAQTLRIITRLEKRETNDEAAASKSGL
FT                   NLTHRSIAALLKYNQRIPRKQKDRKDPQKLAKGYYESETDLVASVKKAVAPGLAGSKFK
FT                   TVECQIMDIADDIAYSTYDLEDAFKAGFFDPLEIVSLTADDDMLKKITDKVNEAIGEKF
FT                   STIYIQNVIVKAFIRIFEKLDNNIPSDDEIMNRAAQVVAVYRHSKKISSNGFFRTQFTS
FT                   ELVKEFIQGVGIEFNEKQPALSKINVDPEVRVKIETLKHLTFEALTMSPRMRLVEYRGR
FT                   DVVKQIFSTLAQDEKKGHLLLPDDWRHEYATTNKMQQRRVICDFVAGMTDRYAMEFFAR
FT                   LTSINHEHSFFKPF"
FT   gene            complement(159582..160115)
FT                   /locus_tag="bglu_1g01540"
FT   CDS_pept        complement(159582..160115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01540"
FT                   /product="PAAR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27356"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8S7"
FT                   /protein_id="ACR27356.1"
FT                   /translation="MGFAFIREGDTTMHGGRVLTYDPTHTVDGKPLALVGDMAACPRCG
FT                   GVFPTVKVRTELNMTFGGRAVACEGDMTACEATLIAFQGTATASPTSGPSGNAASSIGA
FT                   GLSVLSQPASGGSKRGRFQVLDDDTGRPVAGHPYTVTGSNGETGATDADGYTSWLQADQ
FT                   SSSLTFERSNSSLS"
FT   gene            161053..162206
FT                   /pseudo
FT                   /locus_tag="bglu_1g01550"
FT                   /note="disrupted gene"
FT   gene            complement(162531..163100)
FT                   /locus_tag="bglu_1g01560"
FT   CDS_pept        complement(162531..163100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01560"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27357"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8S8"
FT                   /protein_id="ACR27357.1"
FT                   /translation="MRPRACPGTSRGWPRRPAPARRHARPGAGGTRPGAAQAARPRRAA
FT                   GPARLIQSDTSAGGFTTLPRSADNACLPSSRRIDMVNDMRAVVIRAPIRELRGLPTWKL
FT                   IPFASIAGGPHGARTYCVSKQGVVITLDETTPGITQTLNVIPHDQNDDRAAASHALRDL
FT                   ARELDAAGFDRQLTASADTPGPLGNA"
FT   gene            complement(163277..164200)
FT                   /locus_tag="bglu_1g01570"
FT   CDS_pept        complement(163277..164200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01570"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27358"
FT                   /db_xref="GOA:C5A8S9"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8S9"
FT                   /protein_id="ACR27358.1"
FT                   /translation="MPQSRIAALQIGASPLGKAETLQQILAFEDAIRAERLALVVMPEA
FT                   LLGGYPKGETFGTRLGYRLPEGRDAFARYHGNAIDVPGPETDALAGLSARSGASLVTGV
FT                   IERAGATLYCTALFFDPAAGLVAAHRKLMPTGTERLIWGQGDGSTLPVVETAAGRAGAA
FT                   ICWENHMPLLRMAMYAKGVEIWCAPTVDEREIWQSSMRHIAHEGRCFVVSACQVQPSPA
FT                   ALGIEVPGWDPQRPLINGGSVIVGPLGEVLAGPLVGETGLVITEVDTAELTRARYDFDV
FT                   AGHYARPDVFTLAVDERPKRSVVFHR"
FT   gene            164379..165320
FT                   /locus_tag="bglu_1g01580"
FT   CDS_pept        164379..165320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01580"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27359"
FT                   /db_xref="GOA:C5A8T0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8T0"
FT                   /protein_id="ACR27359.1"
FT                   /translation="MNAMNIADVDLNLLKVFEVLFDEGGASRAAIRLDLTQSAVSAALR
FT                   RLRALYGDPLFVRTGRGLAPTARARELKPLIGEALDRCRQSLAFGAPAPASFEGRAVSV
FT                   AMSDDFEIAFGGRLIECAARLAPGLRVIFRQTHSQIVGDALANREVDLAIAAGGFATRG
FT                   LGHMALGHGRYACLVDPAAAPGRLVLTLDDFLAREHVLVSSGGVVGIVDEALAEIGRRR
FT                   TVRASTTHFAALPFLLRGTPAVATIPHHAAEALARMTGLGLVACPLAMPAYPVALGWRV
FT                   STLRDAAVAKLRQAIVDSFAGFAAASLAGGRP"
FT   gene            165799..167526
FT                   /locus_tag="bglu_1g01590"
FT   CDS_pept        165799..167526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01590"
FT                   /product="Acid phosphatase AcpA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27360"
FT                   /db_xref="GOA:C5A8T1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017768"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8T1"
FT                   /protein_id="ACR27360.1"
FT                   /translation="MSDPKSNPSGPGADIDALRGMAGEPGAAGPDDPERRRALGGLAAL
FT                   GASFALGACAAPPGGVQAAAPRSEAELRVDRALREQVRHIVVIYAENRSFANLYGDFPG
FT                   VAQPLSTVPAERYTQLDRDGKTPLARLPAIWGGLVPQAQEVDGRRYMIAERDIQGLKNA
FT                   PFRIHDAHGKPLPNGVITRDLWHRFYQNQMQINAGRNDQFAAWADSGGLVMGHYRNSAE
FT                   TLRLWQLARDYTLCDNFFMAAFGGSWLNHIFLISAQAPFYPDIATSPAKSLVSVVDGDD
FT                   PAGTRLKLADDSPASALDGPPKFVNDGLFTPDGYAVNTMAPPYQPSNVRPLEGGNPAYA
FT                   DPTNPRVLPPQRYATIGDRLSEKGVDWAWYSGAWQYALDHRDTGMVPDFQYHHQPFNYF
FT                   VNYAPGTEARRRHLRDAGLGDDPSTNRLLADIDAGKLPAVTFYKPQGNLNMHAGYADVE
FT                   SGDRHISTVIEHIRRGPQWANTVIVMTHDENGGWWDPVAPPQGDRWGPGSRIPALVISP
FT                   FARRGHVDHTFYDTNSILRFISRVHGLAPLDGVAARDRAFAARGATPPGDLVNALTIG"
FT   gene            complement(167700..168326)
FT                   /locus_tag="bglu_1g01600"
FT   CDS_pept        complement(167700..168326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01600"
FT                   /product="LysE family translocator protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27361"
FT                   /db_xref="GOA:C5A8T2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8T2"
FT                   /protein_id="ACR27361.1"
FT                   /translation="MTFETWLAFASACIVLVLIPGPTILLVIGDSLANRHGSSWSTVAG
FT                   VAAGDTIAMAVSLAGAGALLALSATAFTALKLAGGAYLIYLGLRSILQARAAGRQTVPA
FT                   EPKSAARRFLSAWAVTALNPKSIVFFVAFVPQFVSPHTSFLSQCAVLVPTFVCIATLNA
FT                   ACYARLARYAASRLTGATAHRRFACGGGALLIGAGVLTLRMSSRH"
FT   gene            complement(168767..169825)
FT                   /locus_tag="bglu_1g01610"
FT   CDS_pept        complement(168767..169825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01610"
FT                   /product="Rieske family iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27362"
FT                   /db_xref="GOA:C5A8T3"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8T3"
FT                   /protein_id="ACR27362.1"
FT                   /translation="MDFDLELITRHWHLVGHRRELPADGDFVRFDCAAGEIVVFNDAGE
FT                   LVAFDNRCPHRGARMYLDDSGNQTASCAYHGWTYREGQLIIPGRERFRHCSIERAALNT
FT                   YALEWCGDFLFVGIRPAADLATQLGEFEPVVADISFNIDRRLDLNRYDYGCYWPLAVEN
FT                   ALEPYHIGAVHPGTLGALALEDGENRYDGVNSLWRAPIGASRQRNQLAKLRRLFAIDYQ
FT                   YEGYLSLYLFPFTMISSTYGYSYSLQHFLPAGGEAAGLTRFTSRLYGAPTKGATADAII
FT                   EPFFASTARLNRQVFDEDHAICRRLPRDAWSTAPLAFPADTEAKIDHFRASCRAFDATL
FT                   KPGAQAAASSAA"
FT   gene            complement(169834..170448)
FT                   /locus_tag="bglu_1g01620"
FT   CDS_pept        complement(169834..170448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01620"
FT                   /product="Putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27363"
FT                   /db_xref="GOA:C5A8T4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8T4"
FT                   /protein_id="ACR27363.1"
FT                   /translation="MAGGGAFARELINWAEDAADAGLGPRVTGFLDVNPQALDGFPYAL
FT                   EWRGDIDTYQPADGDALLIAIGEPQAKREVVARLAARGARFASLRHPSAVVARSARLGT
FT                   GVVLCPQAVLSADSEIGDFVAVNILSSVGHDVTVGAYSTLSSHVDLTGHVRVGEGVFFG
FT                   SGARVLPRVAIGADARIGAGAVVMRKVPDGATLYAAPAKKL"
FT   gene            complement(170514..171278)
FT                   /locus_tag="bglu_1g01630"
FT   CDS_pept        complement(170514..171278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01630"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27364"
FT                   /db_xref="GOA:C5A8T5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8T5"
FT                   /protein_id="ACR27364.1"
FT                   /translation="MTVFSDHALAGGTYLVTGASSGLGRATAVAIARAGGRVIAGGRDA
FT                   ARLADTFAALPGNGHRAEVRALDDADLTAEWISTLTETHGALAGVFHAAGIELIRPARM
FT                   TKQAQLDDTFASSLFAAFGIARAAAKKGVLADGASLVLMSSVAASTGQVGMTAYSAAKA
FT                   GVEGLMRSLACELAPRRIRVNAIAAGAVRTEMHARLTRGSPDEAVAAYESSHLLGFGEP
FT                   EDVANAALFLLSDASRWVTGTALVVDGGYRVR"
FT   gene            complement(171275..172375)
FT                   /locus_tag="bglu_1g01640"
FT   CDS_pept        complement(171275..172375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01640"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27365"
FT                   /db_xref="GOA:C5A8T6"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8T6"
FT                   /protein_id="ACR27365.1"
FT                   /translation="MNAPLAFAGRELRSGGARIAGVVSCVPSHELANDAFVERFGEAAV
FT                   RDVVKMVGVERRRVAAAGQTAGDLCRTAGDHLLRGLGWQAEEVDAVLFVSQTPDYRLPG
FT                   TAFVLQAAWGLPAASIALDINLGCSGYPQALWLGMNLIRSGAARRVLLAVGDTISKLVD
FT                   PDDRATALLFGDAGTVTALEADETAEDAVFVIGSDGAGVPNLIVPGGGCRESVVAGTAA
FT                   DAPQAAPGADPQLAGRSRAHLFMNGGEIFNFTLRRIPPLVARTLELAGHGVPDYDAFLF
FT                   HQANLFMLKHLAKKAGLPGERVPVNLNTYGNTSCASIPLLMTTELRGTLATQRQRLALF
FT                   GFGVGYSWASASLVAGPLAVVDTIES"
FT   gene            complement(172378..172599)
FT                   /locus_tag="bglu_1g01650"
FT   CDS_pept        complement(172378..172599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01650"
FT                   /product="Putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27366"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8T7"
FT                   /protein_id="ACR27366.1"
FT                   /translation="MNAFYEGLAEVFEIDTAEVSPALVLADYNWDSLAIVSTIALADDC
FT                   FGVLLNGQALGNCQTVADIEALIAAQKG"
FT   gene            complement(172618..173649)
FT                   /locus_tag="bglu_1g01660"
FT   CDS_pept        complement(172618..173649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01660"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27367"
FT                   /db_xref="GOA:C5A8T8"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8T8"
FT                   /protein_id="ACR27367.1"
FT                   /translation="MAARATILDIASHLPAMVLGNDALAALYPEWPAEKILAKTGIRER
FT                   RVAADDETASDLAFEAARRLFAQGSVRADEIDFVILCTQAPDYVLPASACVLQHRLGIP
FT                   THAGAFDVNLGCSGYVYGLSLAKGLIETGAARCVLLLTADTYSKYLHPLDKSVRTLFGD
FT                   GATATAIGLDERAADAEAEHIGPFVFGTDGRGAQNLIVRAGLFREPRSAKSAREHEDAS
FT                   GNVRTDEHLYMNGAEVMAFSLAEVPRAADRLLERACLTRDDIDCFVLHQANRFMLEALR
FT                   KKMKVPEDRFPILMEYTGNTVSSTLPLALEQLRGEGRLARGTRAMLLGFGVGYSWAGCL
FT                   LNC"
FT   gene            complement(173649..174797)
FT                   /locus_tag="bglu_1g01670"
FT   CDS_pept        complement(173649..174797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01670"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27368"
FT                   /db_xref="GOA:C5A8T9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8T9"
FT                   /protein_id="ACR27368.1"
FT                   /translation="MMNALPLRVVEPQADERIYVTQPHLPPLAEFLPYLEQIWDSKVLT
FT                   NGGPFHQRLEQALCEYLGVKHLALFTNGTLALVTALQALRITGEVITTPYSFVATAHSL
FT                   LWNGIKPVFVDIDPHTLNLDPKKIEAAITPQTAAIMPVHCYGRPCDVEAIRRIADNYNL
FT                   KVIYDAAHAFGVQMHDSSVLEHGDLSILSFHATKVFNTFEGGAIICPDAKTKQHIDHLK
FT                   NFGFVDEVTVVAPGINAKMSEINAAFGLLQLEYVDDALARRAAIDARYRELLADVPGIR
FT                   CVPPVDVKVFNHSYFPILVDEPFPLSRDALYQHLRDHEIYSRRYFYPLISDFPNYRGQP
FT                   SAHPDNLPVARDTSRRVLCLPIYPELSDANVERIVSLIAEAR"
FT   gene            complement(174794..177166)
FT                   /locus_tag="bglu_1g01680"
FT   CDS_pept        complement(174794..177166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01680"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27369"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8U0"
FT                   /protein_id="ACR27369.1"
FT                   /translation="MSDPMPSTRSAPDDPQFDADIALVMQSAIACHHNGEFADAKAMYE
FT                   VVIAARPNHADARYNLAVLNVQTGNPEAALPHFEVALGVDPNNGQFWVAYINAQIEAGR
FT                   AAAAWAMIGMCQQRGIRGPALDGLIQRLSISEEGRAATVGTAAAGHTVAATPAPAADEA
FT                   PVNADPRGGLARRPTQQDITRFTALYNKGRYADAVKHARTMTERYPGSAYAWKSLSNAL
FT                   HKHGEYLAAAEPLARATTLDPADVVLGTLYADVLRLANRLADSEREARRVIAVDDSHAE
FT                   AWRVLNMTLLAQGRSTEAIAAGNRSVELAPDSLQMYGSLGVALSELGATLEAEQAFRRA
FT                   HELMPRDAAMHSNLLFCMTHDPQLDSETIFAAHRRFADIHEAPVRSRWPRHPNKRDPER
FT                   KLRVGIISGDLFNHAVSSYVMPILEVLHRDPSLSLHVYHNHTTEDGVTERMRGWTDSWL
FT                   QVAGLTDDRLVERIRSDRIDIMLDLSSHTGRNRLTALARKPAPVQITWVGYPGTTGLDA
FT                   MDYYFADRYGVPFGEMERQYTEKIIHLPAGGTFKPVDNAPPVNLLPALHNGFVTFGSFN
FT                   RLNKLRREVIAVWARILHAVPNSRMRVGSVPRVGGVDMLLEWFTAEGIAHQRLDLQPRA
FT                   PAAVYLQQHHHVDFCLDTFPYTGSTTALNALWMGVPTLTIRGGTLASRAGAVWMSSVGL
FT                   EQFVADSPDDFVARGIALANDVQGLAAVRRGLRDRCRQSPGFQPERIANAVSDAFRMAW
FT                   RRWCADEAPAPFTVPERAATGASADSAAAETALTGDA"
FT   gene            complement(177425..177748)
FT                   /locus_tag="bglu_1g01690"
FT   CDS_pept        complement(177425..177748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01690"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27370"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8U1"
FT                   /protein_id="ACR27370.1"
FT                   /translation="MGETDMEQHTLVSQVLAMTHDIERAVRLADWASVERLVAARNPYL
FT                   MSIEAEQSPESLLMIREIQAIDAAVLAESTQTRDELQVEYRSAIERVNAARQYSQTAAA
FT                   LHY"
FT   gene            complement(177755..179311)
FT                   /locus_tag="bglu_1g01700"
FT   CDS_pept        complement(177755..179311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01700"
FT                   /product="flagellar hook-associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27371"
FT                   /db_xref="GOA:C5A8U2"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8U2"
FT                   /protein_id="ACR27371.1"
FT                   /translation="MSTISSSTSQASNNQLSSNAALQEAAQSIISGSTGNTGLNVTTLV
FT                   TALVNSKTAAQASLLSTAIAQNQNKSQAYTALQTALTTLQSSLTTLSDGSFAQTFTATA
FT                   SGTGLTATAGSGAVAGTYQIGVTQIAQSQSLSSPAFGANKQLGAGTLTLSINGKSSTVN
FT                   INSNNNTLAGIKDAINNASDNPGVTATIVNGADGAHLVLSSANSGAANAISVSVNATTD
FT                   NGLSELGVTSKSSTTGGQSTITSAGTTAATSWTQSTAAQDAQFTVGGIANSSATNTVTS
FT                   AIAGVTLNLTQAAVSTATPATTQTLTIAADTTKQTAAITTFVQNYNALVTAMQTVGSYS
FT                   TTAGSSTPTVGTLFGDSALNSIQTQLSSMLGGSVSSNGVTATLSSLGISVSDGSDGATA
FT                   GDLVINQATLTTTLSSKPGVAASLFNSTNGLGAKMNNAITSIMSTHGVLTQSENSVTST
FT                   LTSLSSQQSALAAYAKTLTTQYNAQFTQLNTVLAAMTTNQNYLTQLFGGTNSAGALATN
FT                   K"
FT   gene            complement(179547..180701)
FT                   /locus_tag="bglu_1g01710"
FT   CDS_pept        complement(179547..180701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01710"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27372"
FT                   /db_xref="GOA:C5A8U3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR022578"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8U3"
FT                   /protein_id="ACR27372.1"
FT                   /translation="MLGINTNVNSLVAQQNLNGSQSALSQAITRLSSGNRINSAADDAA
FT                   GLAIATRMQTQINGLNQGVQNTNDAVSLIQTTSSQLSSLTSSLQRISTLATQAATGTLS
FT                   SSDQAAAEKEVAQQIQEVNRIAAQTNFNGKNLLDGSAGIVTFQIGANVGQTVSLDLSQS
FT                   LSAAKIGGGLVQSGTNVGTIQNMSLDANGAATTAAQPAITSVNVLSDGKGGFTFTDQNG
FT                   QALSTTAVGAIFTTGTAAGTGTAVTNLTLATGATSGMTTAQASAAANMISQINSVNAPP
FT                   TVSSLNINNATSANQAIVSVANALSTINNLQATLGATQNRLQGIAQTQQANSTNLSSAQ
FT                   SQIQSADFAQETAALSKAQVLQQAGISVLAQANSLPQQVLKLLQ"
FT   gene            181294..181506
FT                   /locus_tag="bglu_1g01720"
FT   CDS_pept        181294..181506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01720"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01720"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27373"
FT                   /db_xref="GOA:C5A8U4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8U4"
FT                   /protein_id="ACR27373.1"
FT                   /translation="MTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQSYEKPTAVR
FT                   KRKKAAAVKRLHKRLRSQMLPKKLH"
FT   gene            complement(181611..182309)
FT                   /locus_tag="bglu_1g01730"
FT   CDS_pept        complement(181611..182309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01730"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27374"
FT                   /db_xref="GOA:C5A8U5"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8U5"
FT                   /protein_id="ACR27374.1"
FT                   /translation="MGKRCNWVRTEADAHYHDTEWGRPSRDDRHLFEMLILEGAQAGLS
FT                   WSTILNKRENYRAAFANFDADAVARFTPAQVEALMQNPGIVRNRLKIESAIANARAVQR
FT                   IRAEHGSLAVFLWSFVGDTPVQNGWHSYRDAPASTEASDALSKALKRYGCKFVGSTICY
FT                   ALMQAIGMVNDHEFDCPCRAACAALGKPAATAARGAASPAAGAANTTRTASRPGAERPA
FT                   AKPKRTASAA"
FT   gene            182521..183423
FT                   /locus_tag="bglu_1g01740"
FT   CDS_pept        182521..183423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01740"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27375"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8U6"
FT                   /protein_id="ACR27375.1"
FT                   /translation="MQQTRAGTAPIHLLGIDGGGTGTRAVLADAHGRELARGSGGPSGL
FT                   ALGIDAAWASIGAACAEAFAQAGLRIDWARCVLGCGLAGSNHPEWLAGFAASSPAAALA
FT                   VESDAYTTALGAHGGAPGVIVALGTGSIAAALDAQGRCRIAGGYGFPSGDEASGAWFGL
FT                   RALAHAQQALDGRVPADGFAAALLEKTGATDRDSLVVWSCAANQTAYAMLAPVVFAHRE
FT                   HPVAAGLIAEAGGAIGRMIDALDPARTLPVALCGGLAGHLEAAVPEPHRARLRAPLADS
FT                   AHGALRLAQREAARLAGAR"
FT   gene            183507..184328
FT                   /locus_tag="bglu_1g01750"
FT   CDS_pept        183507..184328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01750"
FT                   /product="HAD hydrolase, IIB family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01750"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27376"
FT                   /db_xref="GOA:C5A8U7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8U7"
FT                   /protein_id="ACR27376.1"
FT                   /translation="MYQVICTDLDGTLLNSDHQLDPYTIETVRRLAGDGVPFVIATGRH
FT                   HADVAGIRDVLGIRPYLITSNGARVHAPDDTRLHALDIAPPLVRELVRPEVAGAHARVI
FT                   VNLFTDDSWLIDREAPALLAFHQDSGFRYRVVDMLAHDGAGVAKVLYIGEPRDLAVVAA
FT                   NLANRFGDALYVTYSLPDCLEVMTADVSKGRALRVVLERLGIDRAHCVAFGDNMNDIDL
FT                   LETAGFPFMMDNANPDLMLRLPRVPRIGSNADAGVARHLRTLFELGADPMR"
FT   gene            184722..185018
FT                   /locus_tag="bglu_1g01760"
FT   CDS_pept        184722..185018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01760"
FT                   /product="histone-like nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01760"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27377"
FT                   /db_xref="GOA:C5A8U8"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8U8"
FT                   /protein_id="ACR27377.1"
FT                   /translation="MSQYAKLKAQIAELQAQAEDVRRQEVEAVITDLQRKIAEYGLTAQ
FT                   DLGFAERARRGRPPKKAPLPPKYRDPKSGATWSGRGKPPNWIVGKNRERYLVE"
FT   gene            complement(185133..186197)
FT                   /locus_tag="bglu_1g01770"
FT   CDS_pept        complement(185133..186197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01770"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01770"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27378"
FT                   /db_xref="GOA:C5A8U9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8U9"
FT                   /protein_id="ACR27378.1"
FT                   /translation="MRIAQIAPLYEAVPPKLYGGTERVVSYLTEALVELGHDVTLFASG
FT                   DSVTSAKLEASWPRALRLDPSIRDSMAPHMRLLEQVARVAHEFDILHLHLDYLPFPLLS
FT                   RLDVPYVTTLHGRLDLPELQPVFNAFPNAPVVSISNSQRIPLPQAGWAGTVYHGLPDTL
FT                   LTPQPDRKPEYLAFLGRICPEKRVDTAIRIAAKSGLPLKIAAKVDKVDAEYFKTEIEPL
FT                   LATANVEFIGEINEAQKPAFLSGAKALLFPIDWPEPFGLVMIEAMACGTPVVAFNRGSV
FT                   PEVIEDGLTGFIVEDEHSAIGALQQIDTLSREAIRQRFETRFSAKTMARHYVEIYETLG
FT                   AHLKRPHLTRLAAG"
FT   gene            186740..187060
FT                   /locus_tag="bglu_1g01780"
FT   CDS_pept        186740..187060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01780"
FT                   /product="flagellar transcriptional activator FlhD"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01780"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27379"
FT                   /db_xref="GOA:C5A8V0"
FT                   /db_xref="InterPro:IPR023559"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8V0"
FT                   /protein_id="ACR27379.1"
FT                   /translation="MSATSEMLAEIKEVNLSYLLLAQRLLREDKAMGMFRMGISEEIAD
FT                   VLANLTLAQTVKLAASNQMLCRFRFDDHALLSSLADKGRSSAVAQAHSAILMAGQPVES
FT                   LR"
FT   gene            187158..187724
FT                   /locus_tag="bglu_1g01790"
FT   CDS_pept        187158..187724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01790"
FT                   /product="flagellar transcriptional activator FlhC"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01790"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27380"
FT                   /db_xref="GOA:C5A8V1"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8V1"
FT                   /protein_id="ACR27380.1"
FT                   /translation="MATKSVVLEVKEITLAIELIELGARLQLLETETNLSRDRLIKLYK
FT                   ELKGVSPPKGMLPFSTDWFMTWQPNIHSSLFYNIYRFMQAHGGCDSIQSIVKSYRLYLE
FT                   HVGLSEDDEAALSLTRAWTLVRFFDSGMLQMTPCTRCGGHFVAHAHDPQGGFVCGLCQP
FT                   PSRAGKTRKAAAKAEAEPAAALAAV"
FT   gene            187949..188809
FT                   /locus_tag="bglu_1g01800"
FT   CDS_pept        187949..188809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01800"
FT                   /product="flagellar motor protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27381"
FT                   /db_xref="GOA:C5A8V2"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8V2"
FT                   /protein_id="ACR27381.1"
FT                   /translation="MLIIVGTLVTLLSVFGGYALAGGHLGALVQPLEILMIVGAGVGAF
FT                   ILGNGVKTIKATLLVLPPLFKSSKYTKALYMELMALLYVLLAKARKEGTLTLEADIDDP
FT                   EKSPIFTQYPKILADKHMVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHVEGEGPAH
FT                   ALTRVGDAMPAFGIVAAVMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGP
FT                   LASLAEQRVAESTKLLQCIKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVR
FT                   RVKAK"
FT   gene            188826..189875
FT                   /locus_tag="bglu_1g01810"
FT   CDS_pept        188826..189875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01810"
FT                   /product="flagellar motor protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01810"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27382"
FT                   /db_xref="GOA:C5A8V3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8V3"
FT                   /protein_id="ACR27382.1"
FT                   /translation="MSKGKDRAIVVKRVAPAKKGHHGGAWKLAYADFMTAMMAFFLLMW
FT                   LLSAVTPVQLKGIADYFNTPLKAALFGNGDRSSHDSSIIQGGGSDITRSDAGTTRRTDG
FT                   TTMLASRLAQKGRDDLHDTDPGSQDRAEQARLHDLQIKLMAAIEANPVLRQFKQQIRID
FT                   STLSGLRIEIVDTQKRPMFATASNMVEPYMRDILREIGKTLNEVPNRIVVQGHTDAVPY
FT                   AGGEKGYSNWELSADRANASRRELISGGMDDAKVLRVTGLASTQNLNKADPFDPENRRI
FT                   SILVLNHKSEVALMHDDASTTTLSNDAAGSQALSQQIAAPAKPAKPAAPAPVALPAVAA
FT                   PARPAAHAQ"
FT   gene            189897..190271
FT                   /locus_tag="bglu_1g01820"
FT   CDS_pept        189897..190271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01820"
FT                   /product="chemotaxis two-component response regulator
FT                   CheY1"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27383"
FT                   /db_xref="GOA:C5A8V4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8V4"
FT                   /protein_id="ACR27383.1"
FT                   /translation="MIRSILAIDDSATMRGLLQVTLADAGYDVTVAADGDRALELAAAI
FT                   AFDLVLTDHHMAGKNGLDVIRALRARGTYRQTPILVLTTESSDTFKAAARDAGATGWIE
FT                   KPLEPDTLLSLVAALAPSHP"
FT   gene            190338..192602
FT                   /locus_tag="bglu_1g01830"
FT   CDS_pept        190338..192602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01830"
FT                   /product="chemotaxis protein CheA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27384"
FT                   /db_xref="GOA:C5A8V5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR015162"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8V5"
FT                   /protein_id="ACR27384.1"
FT                   /translation="MTLDITQFYQTFFDEADELLAQMEQLLLGLDAGSPDPEDLAAIFR
FT                   AAHSIKGGAATFGFAALTDTTHILESLLDRARNHEITLTVPMIDAFLETKDVLSAQLAD
FT                   YRASAEPDAAAAAAICAKLESLLKEALGGGAAGPAAPQPVAAAPAAPAAAPEPDSDADL
FT                   ESAFAAASAEFDSATGGAPEHVVTQAVEATHPGSGGGEAEGGAQDGAHLKVVLSGVDAK
FT                   DRELLVEELGNLGHIVERSESGGALTLWLESDVPSDDIVAVLCFVIDESQISIGRGTAP
FT                   SAGGPAEIVTAAAPQEVRDTPAPAAEAQPAAPSAPATPPAAAPAAPAAAHADHGDAAKP
FT                   AASAEDRRARAPAAAGAEGSSIRVGVEKVDQLINLVGELVITQAMLAETANAFDPALHD
FT                   RLFNGMAQLERNARDLQEAVMSIRMMPMDYVFSRFPRLVRDLAAKLGKEVELVTFGQAT
FT                   ELDKSLIERIIDPLTHLVRNSLDHGIETVERRRAAGKDAVGQLVLSAAHHGGNIVIEVS
FT                   DDGAGLNRERILKKAAQQGIPVSETASDDEVWNLIFAPGFSTAETITDVSGRGVGMDVV
FT                   KRNIQAMGGHVEISSTAGRGTTTRIVLPLTLAILDGMSVKVGNEIFILPLNFVMESLQP
FT                   AAADIYTVGNGERVVRVRGEYLPLVALHEVFSVDDARTDPTQGIVTIMETEGRRFAMLI
FT                   DELVGQQQVVVKNLETNYRKVHGISAATILGDGSVALIVDVAALNREARTAHGAGALAT
FT                   F"
FT   gene            192637..193170
FT                   /locus_tag="bglu_1g01840"
FT   CDS_pept        192637..193170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01840"
FT                   /product="chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01840"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27385"
FT                   /db_xref="GOA:C5A8V6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8V6"
FT                   /protein_id="ACR27385.1"
FT                   /translation="MSEVHSIQPAAAGAGASNRRDAAQADAAGQEFLVFTLGDEEYGID
FT                   ILKVQEIRGYDSVTRIANAPEFIKGVINLRGIIVPIVDMRIKFHLGRIDYDHQTVVIIL
FT                   NVAHRVVGMVVDGVSDVLTLTADQVMPAPEFGATLTTEYLTGLGTVDGRMLILMDIEKL
FT                   MTSREMALIDEFSA"
FT   gene            193197..195209
FT                   /locus_tag="bglu_1g01850"
FT   CDS_pept        193197..195209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01850"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01850"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27386"
FT                   /db_xref="GOA:C5A8V7"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8V7"
FT                   /protein_id="ACR27386.1"
FT                   /translation="MLQNWSIRTTLTAVSLSFVLLTAVVGGLGLVALKHTGSALDEIVG
FT                   GDMPAIQALSDTSSYLLRTRVALDRVRALTEAGNVEETQSALNRASELYDTSAKNWQAF
FT                   QDAKKVGVDSAMADELATRHSALTAAVDAEFAAIKGSDIAAYHAIADSQISPMFVAYDS
FT                   AVASVLGALGKRVASHRENIQTQIGLMISCIAVGIGLAVLMVFGVRVTLRRLIVGPLER
FT                   AIDQFERIASGDLSGQVREHGTNEVGRLFAGIGRMQTAMIEMVKSVHRGAESIDVGAHE
FT                   ISSGNVDLSQRTEQQAASLQETASSMEQLTGTVRQNAENARQASQLAVNASDIATRGGQ
FT                   VVSEVVSTMQAITVSSNKVVDIIGTIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAG
FT                   EVRSLAQRSASAAKEIKQLIGDSADSVKSGSELVGRAGDTMAEIVQAVRRVTDIIGEIS
FT                   AASHEQSTGIEQINRAVGQMDAVTQQNAALVEQAAAAAASLEDQTRQLKSVVARWRVEG
FT                   GSAALAQAAAEPVLRAPAPQPVRPSKPAVPVVRAASAPAVAAPAAAPVPAAVAALAAPA
FT                   SGAAKEPAPAEPVASPAVPAEPVAVKAPRRPAAGAARRGSTAAPAGGAAKPAHAPRTAK
FT                   PAAVGGGALKRPALGSEPKPALAASAGSDDDWETF"
FT   gene            195220..196191
FT                   /locus_tag="bglu_1g01860"
FT   CDS_pept        195220..196191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01860"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01860"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27387"
FT                   /db_xref="GOA:C5A8V8"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8V8"
FT                   /protein_id="ACR27387.1"
FT                   /translation="MNAPARSASRLELPSSPSRTTEAGRDFAFTGEDFARIRALIHRRA
FT                   GISLSDHKRDMAYSRLARRLRTLGLDSFRDYLDRLERDNDPVEWEAFTNALTTNLTAFF
FT                   RESHHFPILADFVKTRATPVSVWCSAASTGEEPYTIAITLLEALGPSAARSATILATDL
FT                   DTQVLEKARLGVYTFDQVKHLSQERLRRFFLKGTGPQAGRVKVRPELKQMIRFEPLNLT
FT                   DADYGISGQSFDAIFCRNVMIYFDKPTQAQVLTRFEPLLKPGGLLFAGHSENFSYVTQA
FT                   FRLRGQTVYERTRDAGPAGTARARPRPSAVADAAPSLAGEDA"
FT   gene            196188..196883
FT                   /locus_tag="bglu_1g01870"
FT   CDS_pept        196188..196883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01870"
FT                   /product="chemoreceptor glutamine deamidase CheD"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01870"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27388"
FT                   /db_xref="GOA:C5A8V9"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8V9"
FT                   /protein_id="ACR27388.1"
FT                   /translation="MSAPLPIASNHYFDNHFGRPGVKLLPNEFFTTREDLVLVTVLGSC
FT                   VAACLHDPFAGLGGMNHFMLPDDGADVRATASDSMRYGAYAMEVLINELIKAGGRRERF
FT                   EAKVFGGAAVLAGMTTINIGDRNADFVRRYLALEKIRIAAEDLQGVHPRKVAFMPRTGQ
FT                   AMVKKLRLSVPGVAEREAELARAAADAKAARAQRARAHVELFSAPASPKPRVELFGSSA
FT                   AAGTKKQEA"
FT   gene            196889..197956
FT                   /locus_tag="bglu_1g01880"
FT   CDS_pept        196889..197956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01880"
FT                   /product="chemotaxis-specific methylesterase CheB"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01880"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27389"
FT                   /db_xref="GOA:C5A8W0"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8W0"
FT                   /protein_id="ACR27389.1"
FT                   /translation="MQKIKVLCVDDSALIRSLMTEIINGQPDMTVVATAPDPLVARELI
FT                   KQHNPDVLTLDVEMPRMDGLDFLERLMRLRPMPVVMVSSLTERGSEITLRALELGAVDF
FT                   VTKPRVGIRDGMLDYAELLADKLRAAARARVRQAAPARPASASGHASAPLVNNPLVSTE
FT                   KLLIVGASTGGTEAIRELLVPLPPDAPAVLIAQHMPPGFTKSFAQRLNTLCRIAVKEAE
FT                   HGERVLPGHAYIAPGHAHLLLARSGANYLAHLSDEPPVNRHRPSVDVLFRSAATHAGKN
FT                   AIGVILTGMGRDGAAGLLEMKRAGAHTFAQDEASCVVFGMPREAIALGGADEVVPLSEM
FT                   SRRVLASMGERVQRV"
FT   gene            197996..198391
FT                   /locus_tag="bglu_1g01890"
FT   CDS_pept        197996..198391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01890"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01890"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27390"
FT                   /db_xref="GOA:C5A8W1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8W1"
FT                   /protein_id="ACR27390.1"
FT                   /translation="MDKNMKILVVDDFPTMRRIVRNLLKELGYGNVDEAEDGAAGLARL
FT                   KGGGFDFVISDWNMPNLDGLAMLKEIRADAALSHLPVLMVTAESKKENIIAAAQAGASG
FT                   YVVKPFTAATLDEKLNKILEKLAKTGS"
FT   gene            198393..199112
FT                   /locus_tag="bglu_1g01900"
FT   CDS_pept        198393..199112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01900"
FT                   /product="chemotaxis regulator CheZ"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01900"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27391"
FT                   /db_xref="GOA:C5A8W2"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8W2"
FT                   /protein_id="ACR27391.1"
FT                   /translation="MNKPIHAAPAGADSPVEPSADGADLTSDRILARIGQLTRTLRDSM
FT                   HELGLDKHVQQAAQAVPDARDRLRYVAAMTEQAAERVLTAIEVAKPVQERMQTEAEALD
FT                   ARWEAWYRAPIERAEVRELMDDTRSFLGALPEATSATNAQLLEIMLAQDFQDLTGQVIK
FT                   KIMDMVCMIEQQLLGVLVDNIAPERREQFAANAAALAAAEAVPEALLNGPQIAPEGRAD
FT                   VVQDQAQVDDLLASLGF"
FT   gene            199378..199896
FT                   /locus_tag="bglu_1g01910"
FT   CDS_pept        199378..199896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01910"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01910"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27392"
FT                   /db_xref="InterPro:IPR021267"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8W3"
FT                   /protein_id="ACR27392.1"
FT                   /translation="MKSIQMRGLAAKWAVGLLAAGCAASAFAELGGAPTPPPAGDTAAV
FT                   VRTLSPTVNASAQLAGSGTAARGAYTVRETKLGSGTVIREYLNASGTVFGLAWQGPTRP
FT                   DLAALLGSYLPQYMSGVEASHAAHGLRAPITVDSGSLVVHAGGHMGAFVGQAWLPAALP
FT                   AGVTGNDIQ"
FT   gene            199913..201190
FT                   /locus_tag="bglu_1g01920"
FT   CDS_pept        199913..201190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01920"
FT                   /product="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01920"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27393"
FT                   /db_xref="InterPro:IPR021847"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8W4"
FT                   /protein_id="ACR27393.1"
FT                   /translation="MRTSSNPLRWLGALSLVAITALLVACGGGDGGSSSTASTGSGQST
FT                   AGSSSGSSSGGSSSGTSGGTGSNGQMPIIVNAGVQNVVNMPSVSVKVCAPGTATCQTID
FT                   NVLLDTASYGLRLVSSAASGVLGNLPAQSASNGGALAECGQFVSSFTWGSVRQADVTIG
FT                   GLTASALPVQIIGDLGTSNVPSSCSNGSTSANTVAALGANGILGVGPAPFDCGVACVSS
FT                   TTFSNYYSCPSSGACTATTVALNAQVANPVARLPSNNNGVSVQLNAPSGGIATGVLTLG
FT                   VPAALPSGVTRLTTTTAGDLTGTFQGRAISAAFFDTGSNAYFFDSSGGASLPTCSRNTS
FT                   FYCPSANVDLTATVTDGTNNLSVAFTIANAQTLFNTGAYAIANLGGPFGQNSTLDFGLP
FT                   HFYGRTIYFGIDQRSIGGTQTPFVAL"
FT   gene            201377..201907
FT                   /locus_tag="bglu_1g01930"
FT   CDS_pept        201377..201907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01930"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01930"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27394"
FT                   /db_xref="GOA:C5A8W5"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8W5"
FT                   /protein_id="ACR27394.1"
FT                   /translation="MHQTTATALPSIQRITPFLWFDHEAEAAANFYVSVFDDSRITRIA
FT                   RYGREGARAAGQAEGTVMTVAFELAGQAFSAINGGPVFRITPAVSFVVNCRSQDEIDRY
FT                   WTSLGDGCDESAQQCGWLKDRFGVSWQVVPVQLPVLLGEADAAQAARVMGALMTMKKLD
FT                   LAALERAAAGHQT"
FT   gene            202264..203490
FT                   /locus_tag="bglu_1g01940"
FT   CDS_pept        202264..203490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01940"
FT                   /product="flagellar biosynthesis protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01940"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27395"
FT                   /db_xref="GOA:C5A8W6"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8W6"
FT                   /protein_id="ACR27395.1"
FT                   /translation="MAEDSDLEKTEDATPRRREKAREEGQVARSREFASFALLAAGFYG
FT                   AWLLSGPIGEHLRTMLRGSLTFDRASAFDTHQMLTGAGRAGMEGLSAIAPVLALTGLAA
FT                   LAAPIALGGWLLSTKAIGFKFDRLDPISGLGRIFSPQGVIQLGMALAKTVIVGGIGGIA
FT                   IWRSHDEMLGLLNLPLHEALAGTLHLVAVCCGMTVAGMLVVAGMDVPYQIWQYNKKLRM
FT                   TKEEVKREHRESEGDPHVKGRIRQQQRAMARRRMMANVPKADVVVTNPTHFAVALRYTD
FT                   GEMRAPKVIAKGVNLVALRIRELAEEHRVPILEAPPLARALYHNVDLEREIPGSLYSAV
FT                   AEVLAWVYQLKRFRSEGGAFPAEPVDLDVPPELDKGAEIDDEDELQEAAEVLGTPAAGR
FT                   GARNEGDVA"
FT   gene            203487..205589
FT                   /locus_tag="bglu_1g01950"
FT   CDS_pept        203487..205589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01950"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01950"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27396"
FT                   /db_xref="GOA:C5A8W7"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8W7"
FT                   /protein_id="ACR27396.1"
FT                   /translation="MSTPSGLSTKLAGRFDAANLRALAGPILICMILGMMILPLPPMLL
FT                   DLLFTFNIALSVMVLLVSMYTMKPLDFAAFPSVLLFSTLLRLSLNVASTRVVLLEGHTG
FT                   PDAAGQVIEAFGHFLVGGNFAVGIVVFVILMIINFTVITKGAGRIAEVSARFTLDAMPG
FT                   KQMAIDADLNAGLINEEQARKRRVSVAQEAEFYGSMDGASKFVRGDAIAGLVIMAINVI
FT                   GGLIVGIVQHDMSFAAAGKNYTLLTIGDGLVAQIPSLVISTAAGVIVSRVATDEDIGTQ
FT                   ITGQLFANPRVLTITGTIIVLMGLIPNMPHFAFLLLGGGAIWMARTMRRREAARQAMGA
FT                   VSEIAPPAALPADSHEATWEDVTLIDPLGLEVGYRLIPLVEAGGDGELLKRIKSIRKKF
FT                   AQEIGFLPPVIHIRDNLELRPNGYRIALKGVEVGTGEAYPGQWLAINPGQVTAALPGAQ
FT                   TRDPAFGLPAVWIDVSQREQAQVYGYTVVDASTVVATHLNHLVVQHAAELLGRQEVQAL
FT                   LERTGRDAPSLIEDLVPKTVSLTTLQRVLQNLLEEGVPIRDMRTIIEAVSEQAGRITDP
FT                   YDLTAAVRLALGRAITQQWYPGSGEMQVMGLDSNLERVLSQALATGANPGLEPGLAQTL
FT                   LMGTQEAMLRQQNMGLPPVLLVQHALRAMLARFLRRSLPQLKVLSYAEVPETRTIKVTN
FT                   VIGGNA"
FT   gene            205586..207310
FT                   /locus_tag="bglu_1g01960"
FT   CDS_pept        205586..207310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01960"
FT                   /product="flagellar biosynthesis regulator FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01960"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27397"
FT                   /db_xref="GOA:C5A8W8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8W8"
FT                   /protein_id="ACR27397.1"
FT                   /translation="MNIRKFTGPTSRDALRLVREALGGDAVVLSNRTLDDGSVEIVALA
FT                   DAELAALSPKSPIAAAGSMRALPPASRPASAVTGMPRAAAPNNPYASGGLPDVFSSVFG
FT                   ASAEPAGAFDADDELLDDGEAPAATVAAAPVQDEPAASSAPAPWLVEHARRLTRQHEAL
FT                   VSPAPRAEASPGAASPIAPAARNDGEPPEWARDIVRNVAARQSAEASAARATAAAAAAP
FT                   KQAERAGASAATLADEVNARIERIVNETVMHELSAMRGMMEEQFAGLMWNDRQRRTPLH
FT                   GALTKRLFAAGFSAQLVRTVVDNLPAGVSAGSFEGACDWAESVLAGNLPVLDSEDALME
FT                   RGGVFALMGPTGVGKTTTTAKLAARCVMRFGASKVALLTTDSYRIGGHEQLRIFGRILG
FT                   VPVHAVKDGGDLQLALSELRNKHIVLIDTIGMSQRDRTVSDQIAMLQGADARVQRLLLL
FT                   AATSHGDTLNEVVQAYRGSDQPDLAGCILTKLDEATNLGGVLDTVIRYQLPVHYVSTGQ
FT                   KVPENLYVATRKFLLKSAFCVPRDGSPFVPLEDDLPGMLSALAGGRPGSGHHEVYFG"
FT   gene            207303..208115
FT                   /locus_tag="bglu_1g01970"
FT   CDS_pept        207303..208115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01970"
FT                   /product="flagellar biosynthesis protein FlhG"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01970"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27398"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8W9"
FT                   /protein_id="ACR27398.1"
FT                   /translation="MDKRITDQAEGLRRLLAGRANRIVAVTGGPVGVGCTSAVVNLAAA
FT                   LAALGKEVLVVDERNDANSAAATLGSARLRSGNAVRHEAGFSLCVAADLARDGYDDERL
FT                   AAYLEGAADIVLVDAQRDANGALSALARAAHDVLIVTRVAGSAITEAYACMKRLHYAHA
FT                   LAQFRVLVNHVQSESDARAAYENLAGVAGRYLTVALAEGGYVSADPLVPRARELVHTVV
FT                   DAFPSSAAARDYRQIASDLLYWPMRPTNPAGRAFAGHPAVERGAAHAV"
FT   gene            208177..208902
FT                   /locus_tag="bglu_1g01980"
FT   CDS_pept        208177..208902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01980"
FT                   /product="flagellar biosynthesis sigma factor FliA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01980"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27399"
FT                   /db_xref="GOA:C5A8X0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028617"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8X0"
FT                   /protein_id="ACR27399.1"
FT                   /translation="MGEGGMGQAEVLAKYAPLVRRLGLQLVAKMPASVDLDDLIQAGMI
FT                   GLLDAASRYKEDQGAQFETYATQRIRGAMLDELRSNDWLPRSLRKTSREVEQAIHQVEQ
FT                   RLGRSANESEVATHLEMPLDDYQAMLQDLHGSQLIYYEDFDRSADDEPFLDRYRVDHSD
FT                   PLSALLDEHLRAALVEAIDRLPEREKLLMSLYYERGLNLREIGAVLEVSESRVCQLHSQ
FT                   AVARLRARLREQAWVGAEH"
FT   gene            209213..210631
FT                   /locus_tag="bglu_1g01990"
FT   CDS_pept        209213..210631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g01990"
FT                   /product="S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g01990"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27400"
FT                   /db_xref="GOA:C5A8X1"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8X1"
FT                   /protein_id="ACR27400.1"
FT                   /translation="MNAVIDPKASQDYVVADLSLAAWGRKELTIAETEMPGLMQIRDEY
FT                   QAAQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTP
FT                   VFAFKGESLDQYWEYSHRIFEWPNGEFANMILDDGGDATLLLILGAKAEKDRSVIAKPT
FT                   NEEEVALYKSIAAHLDVDGQWYSKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNV
FT                   NDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGATV
FT                   WVTEIDPICALQAAMEGYRVVTMEYAADKADIFVTATGNFHVIGHDHMKAMRHNAIVCN
FT                   IGHFDSEIDVASTRQYQWENIKPQVDHIIFPDGKRVILLAEGRLVNLGCATGHPSFVMS
FT                   NSFANQTLAQIELFVRGEQYENKVYVLPKHLDEKVARLHLARIGANLTVLSPEQASYIG
FT                   VSQDGPFKPNHYRY"
FT   gene            210782..211135
FT                   /locus_tag="bglu_1g02000"
FT   CDS_pept        210782..211135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02000"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27401"
FT                   /db_xref="GOA:C5A8X2"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8X2"
FT                   /protein_id="ACR27401.1"
FT                   /translation="MSLILTWIINALALLIITYLVPSIHIRSFGTALIVAVVLGLINAV
FT                   IRPVLILLTLPVTILTLGLFILVVNALCFWLASSLLKGFEVSGFWSAFFGSILYSIVSW
FT                   LLSALIFGQRSIG"
FT   gene            211155..211985
FT                   /locus_tag="bglu_1g02010"
FT   CDS_pept        211155..211985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02010"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27402"
FT                   /db_xref="GOA:C5A8X3"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8X3"
FT                   /protein_id="ACR27402.1"
FT                   /translation="MKPIELSLEFFPPKTAEGVDKLRATRAQLLPLKPKFVSVTFGAGG
FT                   STQQGTLDTVLDMQKDGLLAAPHLSCIGASKDNLRAVLDQYRSHGIRHIVALRGDLPSG
FT                   MGEVGELRYASELVSFIRAEHGDWFRLEVAAYPEYHPQSRSPKLDLLHFAEKVKAGANS
FT                   AITQYFFNADAYFRFVDDARKLGVDVPIVPGIMPITNFTQLMRFSEMCGAEVPRWVARR
FT                   LESFGDDKESIRAFGADVVTAMCERLIREGAPGLHFYTLNAATATKVVCERLGF"
FT   gene            complement(212133..213587)
FT                   /locus_tag="bglu_1g02020"
FT   CDS_pept        complement(212133..213587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02020"
FT                   /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27403"
FT                   /db_xref="GOA:C5A8X4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8X4"
FT                   /protein_id="ACR27403.1"
FT                   /translation="MQDDYPNYDATDLAALIATRRASAREVLDAAIARANALNPSINAI
FT                   VLTDYDAARERAAAPPAGPLGGVPYLVKDLAAAAGLRMSLGSRHYRYFVPDADAPFIAR
FT                   AKAAGANVFGKTSTAEFGQMPVTEPELFGPCRNPWNLDHTPGGSSGGAAAAVAAGIVPL
FT                   AHASDGGGSIRIPASCCGLFGFKPGYDPQLAAQPVPGDLIVNHAISRSVRDSALLFDLT
FT                   TGRAGTSEATLARLDEPVGALRIGLVTDPLFAAALSPDVLAALDDAARLAESLGHVVEP
FT                   MRLPIDQARAAETFLTCWAAIVEPLVHDAQALTGRRPRGDEFEPASRAMAQVGRHLARE
FT                   RLPLARDWQKQLIAQVESATARYDLVLCATLAAPPVRIGELRSTPFERAQMRLLAALPA
FT                   RPLLRMMLANTAKRAFAWAGCTELFNLTGQPAMSVPLHWNARGLPVGVQFAARRGDDAR
FT                   LLRFARQLELARPWFARRPPLVPAAR"
FT   gene            complement(213697..214392)
FT                   /locus_tag="bglu_1g02030"
FT   CDS_pept        complement(213697..214392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02030"
FT                   /product="Putative dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27404"
FT                   /db_xref="GOA:C5A8X5"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8X5"
FT                   /protein_id="ACR27404.1"
FT                   /translation="MTSQWIDIPVGNETFGGYLALPKGGKGPAVVIIQEIFGVNGHIRS
FT                   VAEQYAADGYVALAPDIFWRTQPRVELGYEGADFNKGLELLQKTDPHQAAADIGHAVAA
FT                   LRARPEVEGKRVAGIGYCFGGRLAYLAAAAGALDVAVAYYGGGIQNHLDVANHVTQPIQ
FT                   FHYAGLDDHIPAEAVEQVRAAFGGRAHAQVHWYPDAGHGFNCNVRASYNQRAAALAHGR
FT                   TLTFLAEQL"
FT   gene            215062..216204
FT                   /locus_tag="bglu_1g02040"
FT   CDS_pept        215062..216204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02040"
FT                   /product="Amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27405"
FT                   /db_xref="GOA:C5A8X6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8X6"
FT                   /protein_id="ACR27405.1"
FT                   /translation="MNIKMQKLLPISAAAMVFAALATNASADQVVKIGHVAPLTGGIAH
FT                   LGKDNENGARLAVEEINAKGLTIGGQKITLQLDAQDDAADPRTATQVAQKLVDDKVVAV
FT                   VGHLNSGTTIPASKIYSDAGIVQISPSATNPAYTQQGFKTTYRVVATDAQQGPALANYA
FT                   QSKGYKSVAVVDDSTAYGQGLANEFEKKAKALGLKVLSHDATNDKAVDFRAILTKIKGE
FT                   NPDAIMYGGMDATGGPFAKQAKQLGLRAKILAGDGVCTEQLSDLAGDASSNVVCSQAGA
FT                   ALEKMPGGAAFEAKYQKRFGQPIQIYSPFTYDAVYIIVDAMKRANSTDPAKILAAMPAT
FT                   DYKGVIGETVFDSKGDLKHGVISLYDYKGGKKTFLDQVKM"
FT   gene            complement(216364..217569)
FT                   /locus_tag="bglu_1g02050"
FT   CDS_pept        complement(216364..217569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02050"
FT                   /product="Amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27406"
FT                   /db_xref="GOA:C5A8X7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8X7"
FT                   /protein_id="ACR27406.1"
FT                   /translation="MSDPSSRLPPQPAAHRALSPAARHRARAATMALFFVAGMMYASWG
FT                   VHVPTVRDRFALSPALLSLALLAVAIGSIIAMTTNAKWIARVGTRTACLAGGIGMSVCG
FT                   ALILLAPSYPLLIVVLMLFGFTMATLDVAMNAEASAVEIAFGKPIISMLHGMFSIGGLS
FT                   GAALGGALLSAGMAPPMHLALASLVCAAIIAAACPAVLPHVPHQAAEHDSSLNRWRSAA
FT                   LWALGAIALVSLIAEGAMYDWATVYMRDVVAATPAFASAAYAAFSGGMAGGRFAGDVVR
FT                   ARFGAPQLVFASATFACIGMIGALLLPYPAPALIGFTMMGLGLSNMMPLLFAAAARVAG
FT                   ISPAEGLAHVAGLAYFGLMFGPVVIGGVAQAAGLPVGLAIVALCAAIVAAFAPRVMRRL
FT                   NV"
FT   gene            217764..218438
FT                   /locus_tag="bglu_1g02060"
FT   CDS_pept        217764..218438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02060"
FT                   /product="pyridoxamine 5'-phosphate oxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27407"
FT                   /db_xref="GOA:C5A8X8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8X8"
FT                   /protein_id="ACR27407.1"
FT                   /translation="MKLSVSLPIHLLHRGQTGTLATHAREPAGFPYPTIVPYATDARHR
FT                   PVVLVSALAEHTRNLAADPRAGFLVADPEPAVVPAASAVLEAERVTLVGRFVRSDDDPH
FT                   LAARYQRYHRDAARYLGLGDFAFWVLECERLRFIGGFGRMGWLDGAELDALPPLSFDQE
FT                   QALWARYPADERARELIGVDRHGADWRIDGRLRRTAFANPATDFHALIDAVEIAATTID
FT                   SP"
FT   gene            218830..219123
FT                   /locus_tag="bglu_1g02070"
FT   CDS_pept        218830..219123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02070"
FT                   /product="Histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27408"
FT                   /db_xref="GOA:C5A8X9"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8X9"
FT                   /protein_id="ACR27408.1"
FT                   /translation="MSSYKDLLAQREKLEKQIEEAKAKEYADVLNDVKQKISDYGFSLA
FT                   ELGLSRAKTAKAGRARAGVAAKYRDPESGATWSGRGKPPRWIAGKNRDQFAI"
FT   gene            219391..220551
FT                   /locus_tag="bglu_1g02080"
FT   CDS_pept        219391..220551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02080"
FT                   /product="Cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27409"
FT                   /db_xref="GOA:C5A8Y0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Y0"
FT                   /protein_id="ACR27409.1"
FT                   /translation="MSTFSADNLDAEKHAVARKTTSVSIAVNVALTILQIAVGLIAHSQ
FT                   ALIADGVHSLSDLISDFVVLLANRHSGAKPDADHNYGHSRYETVASLLLGAILIVVGVG
FT                   MLWRAGDRLVQQAAIPAVHASALAVAGLVVLSKEGLFRYMLAEARRVRSAMLVANAWHA
FT                   RSDAASSLVVAIGVVGSLAGVRLLDPIAAAIVGFMVARMGWSFGWEALQDLSDRALDAK
FT                   AAAGIRALLSETPGVRGIHELRTRKMGDAALVDAHILVDPMISASEGHFIAETARARLL
FT                   GDTHVLDALIHVDTENDLIWLKPALALPPRSEIAPRIEAMLGEAGLRATAMQLHYLSSG
FT                   LEIDLTLAAGTPPLTDADAAALRERLGVRRIGIACAMASAGERGAS"
FT   gene            complement(220606..221097)
FT                   /locus_tag="bglu_1g02090"
FT   CDS_pept        complement(220606..221097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02090"
FT                   /product="Transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27410"
FT                   /db_xref="GOA:C5A8Y1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Y1"
FT                   /protein_id="ACR27410.1"
FT                   /translation="MAAWQPPSETQVILDSFSQKILRLLQLDARRSVQEISDQVGLSST
FT                   PCWRRIKDMEQSGVIQRYTALLDREKLGLHVCALAHVHLTRHNEGGVEQFEREIATCPE
FT                   VTECYSTTGEADYILKIVAPDIKAYDVFLHERIFKIPAVSQVRTSVVLREIKFDTQLPL
FT                   "
FT   gene            complement(221217..221831)
FT                   /locus_tag="bglu_1g02100"
FT   CDS_pept        complement(221217..221831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02100"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27411"
FT                   /db_xref="GOA:C5A8Y2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Y2"
FT                   /protein_id="ACR27411.1"
FT                   /translation="MNGEIYVSTDVEADGPIPGPHSMLSFASAAYTEDKQLIATFSANL
FT                   ETLPNAAPHPVQEAWWKTQPEAWAACRRDLQAPDAALVAYVEWVEALPGKPVFVAMPAG
FT                   FDFTFMFWYMMRFAGRCPFSWSALDIKTLAFALTGLPYRKAIKPRLPKHWFDDHPHTHV
FT                   ALDDAIEQGALFCNMLAELRVRQAAFAASAPAGPDGEDGPG"
FT   gene            complement(221828..222475)
FT                   /locus_tag="bglu_1g02110"
FT   CDS_pept        complement(221828..222475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02110"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27412"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Y3"
FT                   /protein_id="ACR27412.1"
FT                   /translation="MKVTLIPVTPFQQNCSLIVCEQTGRAAVVDPGGDLERIREQVEQQ
FT                   GVQVEKVLVTHGHLDHCAGAKALAAHYGVPIEGPHEDERFWIEQLPSQSERFGFGAKAE
FT                   VFEPDRWLTDGDAVTVGDETLEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTD
FT                   FPRGNHEDLVRSIREKLWPLGDDVRFVPGHGPVSTFGNERATNPFVADRRFG"
FT   gene            223129..223758
FT                   /locus_tag="bglu_1g02120"
FT   CDS_pept        223129..223758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02120"
FT                   /product="Lipoprotein A family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27413"
FT                   /db_xref="GOA:C5A8Y4"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Y4"
FT                   /protein_id="ACR27413.1"
FT                   /translation="MKFRLPRQLGSVMMVAALTGCAMPPNPASEQAANNDNPAKHALRT
FT                   TAAARSDDAAGKQDDFDAALATMPAAGTDDASHASLSNAKPIDAADISDFRQTGRASWY
FT                   GRAFHGRRTANGDRFDMNELTAAHRTLPLSSYVKVINQANGKSVVVKINDRGPFKRGRV
FT                   LDLSYAAAKVIGLVRSGTARVKIVGLSPEQARIARDETVASASPTH"
FT   gene            complement(223923..224825)
FT                   /locus_tag="bglu_1g02130"
FT   CDS_pept        complement(223923..224825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02130"
FT                   /product="Uroporphyrin-III C/tetrapyrrole(Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27414"
FT                   /db_xref="GOA:C5A8Y5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Y5"
FT                   /protein_id="ACR27414.1"
FT                   /translation="MTSLPELAHTQHYPAGTLYVVATPIGNAADITLRALHVLALVDRI
FT                   AAEDTRNTGQLLARYGISKPLVAVHEHNEREAAGRLVEQLRAGERIAYVSDAGTPGISD
FT                   PGAKLVDAVRAAGLPVVPLPGANAAATALSIAGDWAGPFTFAGFLPPKAKQRAAALATL
FT                   KAHPYALVFYEAPHRIAETIDALADAFGTQRRVLIARELTKLHEDVFAGTLAEGPGWLA
FT                   GDPNRQRGEFAVVVEGASAPSGEHDPHAHDALLTLLLSELPVKGAAKLAAALTGASRST
FT                   LYARALELKEQEGRGARDA"
FT   gene            225010..225474
FT                   /locus_tag="bglu_1g02140"
FT   CDS_pept        225010..225474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02140"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27415"
FT                   /db_xref="GOA:C5A8Y6"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Y6"
FT                   /protein_id="ACR27415.1"
FT                   /translation="MGDAGGAACEAAGATCHSPVRPRNAARLGEADNFSGRSGSKRIGE
FT                   RFEWQARRFLEGERLAFVAANVVVRGGELDLVMRERDGTLVFVEVRARRHDRHGGALAS
FT                   VGLHKRRRIVQAARVIWARLGGACPCRFDVVGFEGGRLVWLRDAFRADDV"
FT   gene            225637..226221
FT                   /locus_tag="bglu_1g02150"
FT   CDS_pept        225637..226221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02150"
FT                   /product="phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27416"
FT                   /db_xref="GOA:C5A8Y7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Y7"
FT                   /protein_id="ACR27416.1"
FT                   /translation="MSVERIQQHIRDNATLVQEVLDALSLPIAAAVDAMFAALANGNKI
FT                   LACGDGPSAAPAERLANALTGGFERERPSLPGLALATDASRAGPFTGGEAADHIFAQQV
FT                   RALGQTGDVLVVIDPSGDSPRALAAAAEAREREITVIALTGSGGELVSALSDTDIHIGV
FT                   PSERALRIQEIHLLTIHCLCDGIDAMLLGED"
FT   gene            226240..227052
FT                   /locus_tag="bglu_1g02160"
FT   CDS_pept        226240..227052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02160"
FT                   /product="Transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27417"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Y8"
FT                   /protein_id="ACR27417.1"
FT                   /translation="MNTSRVGPALVRTMLAIALSAGLAATLQGCVLAVAGAAAGGGALI
FT                   ATDRRTLGAQTEDREIQVKAASQIKSGLPDEAHVNVTVFNRRVLLTGEVPNEASKQRAE
FT                   EIVRAINNVNAIVNELAIAPASSLSDRTNDSYLEGRVKAALIAEKGISANNFKVVCERG
FT                   SIYLLGLVTVDEGNIGADVASRVPGVVQVVKVFQYIKPMDAPGLAASSAPASAAGGAGA
FT                   AQPAPAVDVGPTVGAVPDSSVTSAPLQAPAPVSSSPNVHPGNARAGGQ"
FT   gene            227049..227414
FT                   /locus_tag="bglu_1g02170"
FT   CDS_pept        227049..227414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02170"
FT                   /product="Cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27418"
FT                   /db_xref="GOA:C5A8Y9"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Y9"
FT                   /protein_id="ACR27418.1"
FT                   /translation="MSARIERKGGGRLAVLAATAAIGAALLAAPAARAADDGLRVARGN
FT                   ACMGCHAVDRKLVGPSFKEVAARYKNDPAAAGKLAKKIRDGGSGVWGVIPMPAHPGMSD
FT                   ADIKSVVKWVLAGAPSN"
FT   gene            227522..227597
FT                   /locus_tag="bglu_1gt02"
FT                   /note="tRNA-Ala1 anticodon CGC, Cove score 80.39"
FT   tRNA            227522..227597
FT                   /locus_tag="bglu_1gt02"
FT                   /product="tRNA-Ala"
FT   gene            complement(227939..229027)
FT                   /locus_tag="bglu_1g02180"
FT   CDS_pept        complement(227939..229027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02180"
FT                   /product="Diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27419"
FT                   /db_xref="GOA:C5A8Z0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Z0"
FT                   /protein_id="ACR27419.1"
FT                   /translation="MELEPAGAPNHRPEESGTGPQGDDAALEAARRALPAHTATSDTAV
FT                   VLLVDDQPIVREAVRQALAGEAGIELRYCQDATQALDTARQTRPTLILQDLVMPEVDGL
FT                   TLVQQYRRTPELRDVPIIVLSTKEEPRIKQAAFEVGANDYLIKLPDRVELVARIRYHSR
FT                   AYVNLLQLNTAYRALRQSQEELLLANRELERLSQSDGLTSLPNRRYLDAYLEGEWRRSL
FT                   REGAELSMLMIDVDRFKQYNDTYGHVAGDDVLRQVGAALQRCMSRPGDLAARFGGEEFG
FT                   VVLPGTPAGGARLVAEKIRLAVAAMQVPHSGGAADGIVTVSIGGACTIATPSGSTTALL
FT                   EAADAALYEAKRGGRNRAVISA"
FT   gene            complement(229592..230005)
FT                   /locus_tag="bglu_1g02190"
FT   CDS_pept        complement(229592..230005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02190"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27420"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Z1"
FT                   /protein_id="ACR27420.1"
FT                   /translation="MKPLMNVPKRIADCALLAGIAAALAGCGSSSDGPRPLAQSQAAAI
FT                   GAPPGAMIYVSSALGAPQIEQCLSSRLSRARVTRQGTVATVLVGPYSEADDWRITLERN
FT                   AAAGTTIAVYPPRSGDGEPDEATLRFHLARCAV"
FT   gene            230450..231853
FT                   /locus_tag="bglu_1g02200"
FT   CDS_pept        230450..231853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02200"
FT                   /product="Putative major facilitator superfamily
FT                   oxalate/formate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27421"
FT                   /db_xref="GOA:C5A8Z2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Z2"
FT                   /protein_id="ACR27421.1"
FT                   /translation="MSSVIEPAGSAGTPSFLSKEATIARPGFSRWMVPPAALAVHLCIG
FT                   QAYAFSVFNGPLTKVIGITSSAAGDWTLTTLGWIFSLAIVFLGLSAAFAGKWLERVGPR
FT                   RTMLTAACCFGGGFIVAAIGVWVHQIWLLYLGYGVIGGIGLGLGYVSPVSTLIRWFPDR
FT                   RGMATGMAIMGFGGGAMIAAPLSVALMNHFKSATSVGVAETFVVLGVAYFISMTIGAFA
FT                   IRVPAPGWKPAGWEPPAQSTNKMITSRHVHIDQALKTPQFYLIWLVLFLNVTAGIGILG
FT                   QASVMIQESFKDTVSAAAAAGFVGLLSLFNMGGRFVWASASDWVGRKNTYFIFFLLGAV
FT                   LYYCVPQFAAGGHIALFVLAYGVILSMYGGGFSTVPAYLADMFGTAFVGGIHGRLLTAW
FT                   AAAGVAGPVLVNYIRAYQVGHGVAKADAYTMTVHLMAVLLVVGFFCNLLIRRVADQHYM
FT                   TDAQLAAGK"
FT   gene            231864..232007
FT                   /locus_tag="bglu_1g02210"
FT   CDS_pept        231864..232007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02210"
FT                   /product="putative oxalate/formate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27422"
FT                   /db_xref="GOA:C5A8Z3"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Z3"
FT                   /protein_id="ACR27422.1"
FT                   /translation="MTELSTRSGGSEHPTNKGLLVLFWLYVLVPLAWGVFNTLAQALKL
FT                   FQ"
FT   gene            232180..233049
FT                   /locus_tag="bglu_1g02220"
FT   CDS_pept        232180..233049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02220"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27423"
FT                   /db_xref="GOA:C5A8Z4"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Z4"
FT                   /protein_id="ACR27423.1"
FT                   /translation="MDIGFVGLGEMGSAIAANLLKAGHRVRVWNRSPEKAAPLVAQGAQ
FT                   PAATIGDAFAGDLVLSMLADDAAVRGVFDAGLLEQASRGLIHVNMATISVALAETLAHA
FT                   HAERGLHYVAAPVLGRPNVAALGQLTIIAAGPAEAIDRVQPAFDVIGKKTWRLGSLPQH
FT                   ANAVKLAANFSIASAIETMGEAAAMLAGHGVAVSDYIDVITNSILPGPVYQGYGTMIAE
FT                   RRYEPAMFKARLGLKDVRLALEAADAVSVPMPVGSVLRDNLIDAIAHGDGERDFAVLGE
FT                   VAARRAGR"
FT   gene            233112..233747
FT                   /locus_tag="bglu_1g02230"
FT   CDS_pept        233112..233747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02230"
FT                   /product="Lysine exporter protein LYSE/YGGA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27424"
FT                   /db_xref="GOA:C5A8Z5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Z5"
FT                   /protein_id="ACR27424.1"
FT                   /translation="MSLHTWSLFLATMFVVSAIPGPNMLLVMSHGARYGMRRSAATMAG
FT                   ALLALVLMFLISAAGLGVFLAAWPRMFDALRLAGAAYLIWLGVKAWRARVEQAPAVDGA
FT                   AAVPAGFATPGALFRNGFLVSGSNPKALLFAAALTPQFIDPNAPKLPQFASLVVTLAVC
FT                   EVSWYLVYCGFGTRIGATLKSARVVRIFNRLTGGVFVGFGAAMALVRH"
FT   gene            complement(233976..234812)
FT                   /locus_tag="bglu_1g02240"
FT   CDS_pept        complement(233976..234812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02240"
FT                   /product="OmpW family outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27425"
FT                   /db_xref="GOA:C5A8Z6"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Z6"
FT                   /protein_id="ACR27425.1"
FT                   /translation="MNKTLLRGAAVLAAALGASGAQAQSAGSNVIGLGWFHITPIQSST
FT                   SLVTNVAPTPINTPLSLPPSFDSPGTGLRTNNSDTLGLTISHFFTDNVAVTSVAGVPPV
FT                   FQVSGHGTIVPPGPAGALGTQNIGLDAVNPIVKSVRQWSPAVILQYYFANANSKLRPFV
FT                   GIGVSYNWFSDLQLSNNFIKQTQDNLGSILAAGAGKPGTTQVSAKASSSWQPVFNAGLT
FT                   YSINQHWGLIASVTYIPLKTTSTVTIKAADGTTLAESKGDLKANPIISYLAVSYKF"
FT   gene            complement(234829..236085)
FT                   /locus_tag="bglu_1g02250"
FT   CDS_pept        complement(234829..236085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02250"
FT                   /product="Lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27426"
FT                   /db_xref="InterPro:IPR021340"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Z7"
FT                   /protein_id="ACR27426.1"
FT                   /translation="MKRNLLLVTAAVAVPLLSACGGADDKPITALAATEPGLCPSSLDY
FT                   STVYTGGGGDGELVKLQLDTQKLTWQISYIESPIPATTGTVTPTRAGTTVSGTLSRETG
FT                   LPTAKLNNCAFQLNGASLDPSRPARVFVGFGVAGGTIPGARISFPGVIGVAAVPDTTFP
FT                   YYPFIGFSSLETNIANVAGVYSQLGYGQVPSQKFAPVTIDGKVTINADGSWQRCDTTGV
FT                   NAGTCQQLGSNFTQSPDGSGAFVTNHYQGQAKPTLSASGAQGKGYLIVGKLRNQLVPIM
FT                   IRTGAANPNPTPDANGVPGLTADDESGISIMAPQNTVAVGSQNGEYIGVDSQFDYRSTA
FT                   LINTQATLLDPFNASQASLATALNLDYTQATPGTVTSVHTGATSTTPTGKFIFTGGVFG
FT                   FLDNNNATSPYFTIGAFVQ"
FT   gene            complement(237039..237986)
FT                   /locus_tag="bglu_1g02260"
FT   CDS_pept        complement(237039..237986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02260"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27427"
FT                   /db_xref="GOA:C5A8Z8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Z8"
FT                   /protein_id="ACR27427.1"
FT                   /translation="MTTKVFVDGQEGTTGLKIFEYLSARSDIDILRIDDARRKDVEERR
FT                   RLINASDVTFLCLPDVASRESASLVDNDRTTLIDASTAFRTSADWAYGLPELTRAQRER
FT                   IRGAKRIAVPGCHASAFVLAMRPLVDAGIVPAEFAAHSYSITGYSGGGKKMIADYEAGG
FT                   NPRLASPRPYALGLAHKHLPEMAAHTGLAHAPIFTPIVGPFYKGLAVTTYFTPGQLARP
FT                   VTPQDVQQVFADYYAGEAFVRVAPFDAAANLDDGFFDVQANNDTNRVDLFVFGNEERFV
FT                   TVARLDNLGKGASGAAIQCMNLSIGAAEDAGLNR"
FT   gene            complement(238199..238795)
FT                   /locus_tag="bglu_1g02270"
FT   CDS_pept        complement(238199..238795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02270"
FT                   /product="PEBP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27428"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:C5A8Z9"
FT                   /protein_id="ACR27428.1"
FT                   /translation="MRESRQTKRTGRRRGVSAWRLLAVLAAAFASLARPGAQTPFSVTS
FT                   PELRDGGRVSAAQRYGRGACRGENRSPALAWQNPPRGTRSYAITMFDLDAPGRGWWHWA
FT                   VADIPASASGVPANASGSGFLGRLGAVEARNDFGSDGYGGPCPPPGKPHRYVITVYALD
FT                   IERLRADQGRPPQLFDHEISVSALASARLTVTDER"
FT   gene            complement(239089..239775)
FT                   /locus_tag="bglu_1g02280"
FT   CDS_pept        complement(239089..239775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02280"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27429"
FT                   /db_xref="GOA:C5A900"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C5A900"
FT                   /protein_id="ACR27429.1"
FT                   /translation="MTGFDRQTISDTTAKILLEVQAVHFNAEKPFIFTSGWASPVYIDC
FT                   RKLISYPRVRRGLMEMAEATILRDVGFEQIDAVAGGETAGIPFAAWIADRMMLPMQYVR
FT                   KKPKGFGRNAQIEGHLEEGSRVLLVEDLTTDSRSKVNFINALRTAGATVNHCFVLFHYN
FT                   IFKESVSVLKDIDVDLHALATWWDVLRVAKASGYFETKTLDEVEKFLHAPAEWSAAHGG
FT                   ATSPKE"
FT   gene            240235..242511
FT                   /locus_tag="bglu_1g02290"
FT   CDS_pept        240235..242511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02290"
FT                   /product="malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27430"
FT                   /db_xref="GOA:C5A901"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C5A901"
FT                   /protein_id="ACR27430.1"
FT                   /translation="MDEQLKQSALAYHQNPKPGKISVTPTKPLSNQLDLSLAYSPGVAA
FT                   ACMAIHDEPLDAQKYTSRGNLVGVVTNGTAVLGLGNIGPLAAKPVMEGKGCLFKKFAGI
FT                   DVFDIELAESDPDKLVEAIAMLEPTLGGINLEDIKAPECFYIEQKLRERMKIPVFHDDQ
FT                   HGTAIIASAAILNGLKVVGKSLAEVKLVCSGAGAAAIACLDLLVNLGLTKANVLVTDSK
FT                   GVIHVGRGQLDPSKQRYAATTEARTLADAIQGADVFLGCSSAGVLKPEMVQTMGAQPLI
FT                   LALANPEPEIRPEAAKAVRPDAIVATGRSDYPNQVNNVLCFPFIFRGALDVGATTITEE
FT                   MKLACVRAIAELAQETDQSEEVAKAYEGHSLEFGPDYLIPKPFDPRLIIKIAPAVAQAA
FT                   MDSGVATRPIADMDAYREELGATVYRTGMVMRPVFASAKAKQARIVFAEGEDERVLRAA
FT                   QFVLQEKIARPIIVGRPAVVEMRLKKIGSKLCAGTDFEIVDPEDDPRYQRCWQAYHELG
FT                   ARDGVTPEVAKAALRKANTLIGAILVRLGEADGMICGMIDTFHSHLKYVEQVLGHAPGA
FT                   EHLAAMNLLMLPGRNLFICDTYVNELPSAEQLADMTIQAAAEIERFGIVPKAALLSNSN
FT                   FGSAPSASSRRMAEARRLIAERAPQLEVDGEMHGDAALSEMVRKAAFPGTTLSGEANLL
FT                   IMPNVEAANIAYNLLKMVGGEGVTVGPFLLGAARPVHILTPAATVRRIVNMTAVTAANV
FT                   NGVAR"
FT   gene            complement(242621..246208)
FT                   /locus_tag="bglu_1g02300"
FT   CDS_pept        complement(242621..246208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02300"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27431"
FT                   /db_xref="GOA:C5A902"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5A902"
FT                   /protein_id="ACR27431.1"
FT                   /translation="MNAPLDAGQRATLEAALQSVTLDDKYTLERGRAYMSGVQALVRLP
FT                   MLQQARDRAAGLNTAGFISGYRGSPLGGLDQALWKAQKHLAANRIVFQAGLNEDLAATA
FT                   VWGSQQVNLYPGAKFDGVFGMWYGKGPGVDRSGDVLKHANSAGSSVHGGVLVLAGDDHA
FT                   AKSSTLAHQSEHLLKACGLPVLFPANVQEYLDFGLHGWAMSRYSGLWVSLKCVTDVVES
FT                   SASVDLDPQRASIVLPADFMMPEGGLNIRWPDPPLAQEARMIDYKWYAALAYVRANRLD
FT                   RIEIDSPQARFGIMTAGKAYLDVRQALTDLGLDDATCARIGIRLYKVGCVWPLEAQGAQ
FT                   QFARGLDEILVIEEKRQILEYAIKEELYNWPDGQRPRIFGKFDEKDGAGGEWSVPMGNW
FT                   LLPAHYELSPAIIAKAIATRLDKFELPSDVRARIAARIAVITAKEAALARPHVTAERKP
FT                   WFCSGCPHNTSTQVPDGSRAIAGIGCHYMTIWMDRNTSGFSQMGGEGVPWIGQAPFTDE
FT                   KHVFANLGDGTYFHSGLLAIRAAIASKANITYKILYNDAVAMTGGQPVDGTLTVPQITH
FT                   QVAAEGAAKIVIVTDEPEKYEGARERLAPDVAIHHRDRLDAVQRELREIAGTTVLIYDQ
FT                   TCATEKRRRRKRGSFPDPARRVVINEAVCEGCGDCSVQSNCLSVEPLDTEFGTKRQINQ
FT                   SSCNKDFSCVKGFCPSFVTVEGAQLRKPKAVAVDAASLPALPEPTLPAIARTYGVLVTG
FT                   VGGTGVVTIGALIGMAAHLENKGVTVLDVTGLAQKGGAVMSHVQIARAPEDIHATRIAM
FT                   GEADLVIGGDALVTASDECTSRMRLGETRVVVNSAKTPTADFIKQPQWSFPGASAEHDI
FT                   RASAGEAVDLVDANHFAVALLGDAIYANPFVLGYAWQRGWLPLTHASLTRAIVLNGVQV
FT                   EKNLAAFEWGRRAAHDPASVRQAASSRQPGKGADGATVIALHTRKAVDTLIATRVAQLG
FT                   AYQNAAYAARYASVVERVREAERRLDGEHAQEPLTEAVARNLYKLMAYKDEYEVARLQS
FT                   DPAFLAKLAAQFDGELTLRYHLAPPIFAKRDEHGRLVKRAYGPWMLSAFRLLAKLKGLR
FT                   GTAFDPFGRTEERRTERALIGEYVALVDALIARLTPQRLPLALELANLPDGIRGYGHVK
FT                   ENNLRAVRGKWDALLARWNGPETETRHVA"
FT   gene            246519..246701
FT                   /locus_tag="bglu_1g02310"
FT   CDS_pept        246519..246701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02310"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27432"
FT                   /db_xref="UniProtKB/TrEMBL:C5A903"
FT                   /protein_id="ACR27432.1"
FT                   /translation="MNTRNIQNFLMVSAAFFAMTGPVRSQGASALATAGTQMQRIAGDA
FT                   IAPAGVTVTTGAPKR"
FT   gene            complement(246854..247951)
FT                   /locus_tag="bglu_1g02320"
FT   CDS_pept        complement(246854..247951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02320"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27433"
FT                   /db_xref="GOA:C5A904"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:C5A904"
FT                   /protein_id="ACR27433.1"
FT                   /translation="MQIPTWDNPVGTDGFEFIEYTAPDPKALGQLFERMGFTAIARHRH
FT                   KDVTLYRQGEINFLINAEPDSFAQRFARLHGPSICAIAFRVRDAALAYRHALEQGAWGF
FT                   DNKTGPMELNIPAIKGVGDSLIYFVDRWRGKHGAAPGSIGDIGIYDVDFEPIPGADPAP
FT                   VGHGLTYIDHLTHNVHRGRMREWAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGK
FT                   IRIPINEEGSDTPGQIQEYLDAYRGEGIQHIALGTENIYATVDGLRGKAVTLLDTIDTY
FT                   YELVDRRVPNHGEPLDELRKRKILIDGAHDDLLLQIFTENQIGPIFFEIIQRKGNQGFG
FT                   EGNFKALFESIELDQIRRGVVQDKA"
FT   gene            248118..248624
FT                   /locus_tag="bglu_1g02330"
FT   CDS_pept        248118..248624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02330"
FT                   /product="Transcriptional regulator, AsnC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27434"
FT                   /db_xref="GOA:C5A905"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5A905"
FT                   /protein_id="ACR27434.1"
FT                   /translation="MARVELDTIDRRILAILQENGRLSNQEIAERVSLSPSPCLRRIRR
FT                   LEEMGVITGYVALLDPKRLGLDLLAYISVRLEKRGGAAAAAGGARAGTTHADRFRVAVQ
FT                   AWPEVVACHAMTGEMDYLLRVQVEDMAHFSRFVQDQLLHHPSVVDVRTSFALESFKETT
FT                   ALPIR"
FT   gene            complement(248721..249416)
FT                   /locus_tag="bglu_1g02340"
FT   CDS_pept        complement(248721..249416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02340"
FT                   /product="GNAT family acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27435"
FT                   /db_xref="GOA:C5A906"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5A906"
FT                   /protein_id="ACR27435.1"
FT                   /translation="MLLHCTTGCMVFEEPTMNAHPLRPAAPTGNVGQAPVLVRELRSAD
FT                   RESMLTHFLALDDDDRLLRFGQLVPDHVLDNYVRTIDFGRDTVFGVFDHALELVGVGHL
FT                   AYLPDDGGKRTAEFGVSVLESARGQGVGSKLFERAAIRSRNTQVSTLYMHCLSRNATMM
FT                   HIAKKSGMRIEYAYGEADAYLSLPPADQSTILAEMLQEQAAVFDYAMKRQARRATQIFE
FT                   SLLPAGIAA"
FT   gene            complement(249599..250231)
FT                   /locus_tag="bglu_1g02350"
FT   CDS_pept        complement(249599..250231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02350"
FT                   /product="Putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27436"
FT                   /db_xref="GOA:C5A907"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:C5A907"
FT                   /protein_id="ACR27436.1"
FT                   /translation="MARTRAPDHESQREQILDLAASKFAQTSYPSTSMTDLAAASGTSK
FT                   ARLYHYYESKEAILFDLLDRYTKRLMLIIAEVQGTSQRRGLSEREAFAELIRAFLSEYE
FT                   TSHSRHVALLNDVKYLENTQRQVILDRQRDIVAAFTRQIERAYPGRVSRENQTAVTMMV
FT                   FGMINWTFTWLKPGGRLGYRDFAEQVIGLIERGLGGENAGADPTRAA"
FT   gene            complement(250295..251116)
FT                   /locus_tag="bglu_1g02360"
FT   CDS_pept        complement(250295..251116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02360"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27437"
FT                   /db_xref="InterPro:IPR014973"
FT                   /db_xref="InterPro:IPR022123"
FT                   /db_xref="UniProtKB/TrEMBL:C5A908"
FT                   /protein_id="ACR27437.1"
FT                   /translation="MSTLHVTVGGSAAESLRAALAAAGRDNAVVELLDDLAVGPLRGID
FT                   DAPEPRAAFWERIFADTPPDWDSRLAAELDKLARLAAGSGQVVIWHAQSAADQLMLRRV
FT                   AYHLRHAPQRLNEVRLSAADLGPRTHPPGREAAVSVDMFGPERLRAKLPEAAPISVLRI
FT                   GRLALEWQEAKQVNAELRYWIDNTFKSGHYADIDALALEQAGEAWMPAARVVGAIIALA
FT                   NRGHLRLGDSIAFWRCRELAAAGRLELRGGAPGPDNLRAASLRAVPAAAPR"
FT   gene            complement(251244..252332)
FT                   /locus_tag="bglu_1g02370"
FT   CDS_pept        complement(251244..252332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02370"
FT                   /product="Flavodoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27438"
FT                   /db_xref="GOA:C5A909"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011884"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5A909"
FT                   /protein_id="ACR27438.1"
FT                   /translation="MATPQFHPLRIRDVQPETADAVTVAFEVPAELREQYRFTQGQFVT
FT                   LRAQIGGEETRRSYSICVGTTDYDRDGELRIGIKRVRGGRFSNFAFDTLKAGDTIDVMT
FT                   PDGRFFTHLNAEHGKHYVAFSGGSGITPVLAIVRTTLELEPRSTFTLIYGNRSVDSIMF
FT                   AEQLEDLKNRFMQRFSLYHVLSDELQDVDLFNGVLDQAKCAAFLDTLVPAASIDEAFIC
FT                   GPAPMMDAAEAALGAAGVARERIHVERFGTPLPQAGAPVVEITEATPAAALEIMLDGKT
FT                   RKLRLPYEGVSLLDVGLRAGLALPYACKGGVCCTCRAKVVEGEVRMDRNYTLEEQEVRD
FT                   GFVLTCQCHPVSERVVVSFDER"
FT   gene            complement(252334..252927)
FT                   /locus_tag="bglu_1g02380"
FT   CDS_pept        complement(252334..252927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02380"
FT                   /product="Phenylacetate-CoA oxygenase, PaaJ subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27439"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C5A910"
FT                   /protein_id="ACR27439.1"
FT                   /translation="MSAPPASVASVASVDADAELARARAALDTVPDPEIPVVSIGELGI
FT                   LREVRRAADATLEIVITPTYSGCPAMSQIAEDIGAALDRAGVPAYRIVTVLSPAWTTDW
FT                   ITDAAREKLRAYGIAPPVGSCASGGAAACGAASGARPAAAQVIRFAPKPGAAPACPRCG
FT                   SRHTERLAQFASTACKALYRCLDCREPFDYFKPY"
FT   gene            complement(252963..253769)
FT                   /locus_tag="bglu_1g02390"
FT   CDS_pept        complement(252963..253769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02390"
FT                   /product="Phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27440"
FT                   /db_xref="GOA:C5A911"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C5A911"
FT                   /protein_id="ACR27440.1"
FT                   /translation="MTTPRPSHLSYVLRLADSALILGQRNAEWCGHGPILEEDIALTNM
FT                   SLDLIGQARLLYAHAADLEHALHGTTRTEDDYAYFRSEREFTNLTLVELPHYGPVSGTA
FT                   HASKDYAVTIVRNFLYATLMLHLWTALEGSADPQLAAIAAKSVKETRYHEHHAREWLIR
FT                   FGDGTDESHRRAQAALDYLMPYTRECFAVDAVEREVAAAGIAPAADTLEAAWRADLDAA
FT                   LAEATLAAPAPGAYVPAGRRGEHSEHMGFLLAQMQSLARQHPGASW"
FT   gene            complement(253777..254061)
FT                   /locus_tag="bglu_1g02400"
FT   CDS_pept        complement(253777..254061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02400"
FT                   /product="phenylacetate-CoA oxygenase subunit PaaB"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27441"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9E0"
FT                   /protein_id="ACR27441.1"
FT                   /translation="MKQEWPIWEVFVRSKQGLDHKHCGSLHAADAPMALRMARDVYTRR
FT                   QEGVSIWVVPSAAITASDPNQKAELFEPAGDKIYRHPTFYTLPDEVNHM"
FT   gene            complement(254100..255098)
FT                   /locus_tag="bglu_1g02410"
FT   CDS_pept        complement(254100..255098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02410"
FT                   /product="phenylacetate-CoA oxygenase subunit PaaA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27442"
FT                   /db_xref="GOA:C5A9E1"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9E1"
FT                   /protein_id="ACR27442.1"
FT                   /translation="MYTQSLDLPGQPAVGETASAAPEQARFDAVIAADGKIEPQDWMPD
FT                   AYRKTLIRQISQHAHSEIVGMLPEGNWITRAPSLKRKAILLAKVQDEAGHGLYLYSAAE
FT                   TLGVSRDTLVDALHAGKAKYSSIFNYPTPSWADVGVIGWLVDGAAIMNQIPLCRCTYGP
FT                   YARAMIRICKEESFHQRQGFDALLAMMAGTPAQREMVQQAVNRWWWPVLMMFGPSDADS
FT                   VHSNQSAKWGIKRISNDDLRQKFVDAAVEQAKVLGVTLPDPDLKWNEARGHHDYGAIDW
FT                   DEFWRVVNGDGPCNRERLATRVKAHEDGAWVREAALAHAGKRARRAERQAA"
FT   gene            255285..256574
FT                   /locus_tag="bglu_1g02420"
FT   CDS_pept        255285..256574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02420"
FT                   /product="Lipase/acylhydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27443"
FT                   /db_xref="GOA:C5A9E2"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9E2"
FT                   /protein_id="ACR27443.1"
FT                   /translation="MSFRRCLPVWAGCLALCLSGAAFAAGDAAGSGGLPRWVAAWASAL
FT                   QPIPALASPPPLYRAPEVANRTIRQIVYPSVGGTRLRLRISNAYGRTPLSLGAVRIGRS
FT                   AAGAAVRPGDTVLVTFGGRRDLVVPAGEERDSDPVALPLEAGAPYAISLFVRGEQKMTA
FT                   WHRVANQVNYVSVPGDHSADVDGGAFRTRFTQSAWVSELAVEGSSAATGAIAAVGDSIT
FT                   DGLRSSLNRNRRWTDGLARRLDAAGERDWSVVNLGISGNRLLSDSACYGSALERRFDRD
FT                   VLARSGVKAAVLLIGINDINFAAMPPRAGLDCDAPHTRVDARMLIDGYRRVIASAHAHG
FT                   VALFGATLTPASLPPEREAIRTEVNNWIRTSGALDGVVDFDAALRDPARPQVLQRRYDS
FT                   GDGVHPSDAGYAAMADAVPIDRLLAAAKRH"
FT   gene            257132..258367
FT                   /locus_tag="bglu_1gr01"
FT   rRNA            257132..258367
FT                   /locus_tag="bglu_1gr01"
FT                   /product="16S ribosomal RNA"
FT   gene            258730..258806
FT                   /locus_tag="bglu_1gt03"
FT                   /note="tRNA-Ile1 anticodon GAT, Cove score 93.29"
FT   tRNA            258730..258806
FT                   /locus_tag="bglu_1gt03"
FT                   /product="tRNA-Ile"
FT   gene            258847..258922
FT                   /locus_tag="bglu_1gt04"
FT                   /note="tRNA-Ala2 anticodon TGC, Cove score 90.89"
FT   tRNA            258847..258922
FT                   /locus_tag="bglu_1gt04"
FT                   /product="tRNA-Ala"
FT   gene            259227..262108
FT                   /locus_tag="bglu_1gr02"
FT   rRNA            259227..262108
FT                   /locus_tag="bglu_1gr02"
FT                   /product="23S ribosomal RNA"
FT   gene            262246..262361
FT                   /locus_tag="bglu_1gr03"
FT   rRNA            262246..262361
FT                   /locus_tag="bglu_1gr03"
FT                   /product="5S ribosomal RNA"
FT   gene            263150..263235
FT                   /locus_tag="bglu_1gt05"
FT                   /note="tRNA-Tyr anticodon GTA, Cove score 66.50"
FT   tRNA            263150..263235
FT                   /locus_tag="bglu_1gt05"
FT                   /product="tRNA-Tyr"
FT   gene            263274..263347
FT                   /locus_tag="bglu_1gt06"
FT                   /note="tRNA-Gly1 anticodon TCC, Cove score 82.17"
FT   tRNA            263274..263347
FT                   /locus_tag="bglu_1gt06"
FT                   /product="tRNA-Gly"
FT   gene            263374..263448
FT                   /locus_tag="bglu_1gt07"
FT                   /note="tRNA-Thr1 anticodon GGT, Cove score 90.12"
FT   tRNA            263374..263448
FT                   /locus_tag="bglu_1gt07"
FT                   /product="tRNA-Thr"
FT   gene            263512..264702
FT                   /locus_tag="bglu_1g02430"
FT   CDS_pept        263512..264702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02430"
FT                   /product="Translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27444"
FT                   /db_xref="GOA:C5A9E3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9E3"
FT                   /protein_id="ACR27444.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAK
FT                   KYDEIDAAPEEKARGITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIIKGSAKLALEGDKGELGETAIMNLADALDSYIPTPERAVDGTFLMPVEDVFS
FT                   ISGRGTVVTGRVERGIVKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREEVERGQVLAKPGSIKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPKDKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILD"
FT   gene            264760..264835
FT                   /locus_tag="bglu_1gt08"
FT                   /note="tRNA-Trp anticodon CCA, Cove score 84.85"
FT   tRNA            264760..264835
FT                   /locus_tag="bglu_1gt08"
FT                   /product="tRNA-Trp"
FT   gene            264875..265255
FT                   /locus_tag="bglu_1g02440"
FT   CDS_pept        264875..265255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02440"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27445"
FT                   /db_xref="GOA:C5A9E4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9E4"
FT                   /protein_id="ACR27445.1"
FT                   /translation="MANPSVETVNTSGDKLMLGLGVLLVLAGFAGFFLLGGKEWYIRGA
FT                   ALAVGVIAGVAVALMSLPGKSFIAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMA
FT                   LFLWLSDKSIEWVIFSAILGWK"
FT   gene            265257..265814
FT                   /locus_tag="bglu_1g02450"
FT   CDS_pept        265257..265814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02450"
FT                   /product="Transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27446"
FT                   /db_xref="GOA:C5A9E5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9E5"
FT                   /protein_id="ACR27446.1"
FT                   /translation="MSDTPASPSGKRWYVVHAYSGMEKSVQRALQERIERAGMQDKFGQ
FT                   ILVPTEEVVEVRGGHKAVTERRFFPGYVLVEMEMTDETWHLVKNTAKVTGFVGGARNRP
FT                   SPISPREVEKIMSQMQEGVEKPRPKTLFEVGEMVRVKEGPFTDFNGTVEEVNYEKSRVR
FT                   VSVTIFGRATPVELEFGQVEKV"
FT   gene            265958..266389
FT                   /locus_tag="bglu_1g02460"
FT   CDS_pept        265958..266389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02460"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27447"
FT                   /db_xref="GOA:C5A9E6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9E6"
FT                   /protein_id="ACR27447.1"
FT                   /translation="MAKKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQ
FT                   TQGMEPGLPVPVVITAFADKSFTFVMKTPPATVLIKKAAKVDKGSAKPHTDKVGSITRA
FT                   QAEEIAKTKMPDLTAADLDAAVRTIAGSARSMGITVEGV"
FT   gene            266390..267088
FT                   /locus_tag="bglu_1g02470"
FT   CDS_pept        266390..267088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02470"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27448"
FT                   /db_xref="GOA:C5A9E7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9E7"
FT                   /protein_id="ACR27448.1"
FT                   /translation="MAKISKRRQAFAAKVDRQKLYAIEDALALVKECASAKFNESIDVS
FT                   VQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAEQI
FT                   KAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQY
FT                   RVDKAGIIHATIGRASFESAALRSNLTALIEALQKSKPATSKGVYLRKIALSSTMGVGV
FT                   RVDQTSLAAQ"
FT   gene            267387..267884
FT                   /locus_tag="bglu_1g02480"
FT   CDS_pept        267387..267884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02480"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27449"
FT                   /db_xref="GOA:C5A9E8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9E8"
FT                   /protein_id="ACR27449.1"
FT                   /translation="MPLNREDKQAVVAEVSAQVAKAQTVVLAEYRGIAVGDLTKLRAQA
FT                   REKQVYLRVLKNTLARRAVEGTPFAPLAEQMTGPLIYGISEDAIAAAKVVNDFAKSNDK
FT                   LIIKAGAFDGKVMDKAGVQALATIPSREELLSKLLFVMQSPVSGFARALAALAEKKQAE
FT                   AA"
FT   gene            267945..268319
FT                   /locus_tag="bglu_1g02490"
FT   CDS_pept        267945..268319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02490"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27450"
FT                   /db_xref="GOA:C5A9E9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9E9"
FT                   /protein_id="ACR27450.1"
FT                   /translation="MAIAKEDILAAVEGMTVLELNELVKAFEEKFGVSAAAVAVAGPAG
FT                   GGAAAAVEEKTEFSVILAEVGANKVSVIKAVRELTGLGLKEAKDLVDGAPKPVKEGVDK
FT                   AASEEAKKKLEEAGAKVEIK"
FT   gene            268691..272800
FT                   /locus_tag="bglu_1g02500"
FT   CDS_pept        268691..272800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02500"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27451"
FT                   /db_xref="GOA:C5A9F0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9F0"
FT                   /protein_id="ACR27451.1"
FT                   /translation="MQYSFTEKKRIRKSFAKRSIVHQVPFLLATQLESFSTFLQAEVSA
FT                   AQRKSEGLQAAFTSVFPIVSHNGFARLEFVSYALSPPAFNIKECQQRGLTYCSALRAKV
FT                   RLVLLDKESPSKPVVKEVKEQEVYMGEIPLMTPTGSFVINGTERVIVSQLHRSPGVFFE
FT                   HDKGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDVLYFRVDRRRKMPVTILLKAIGLTP
FT                   EQILANFFVFDNFTLMDEGAQMEFVPERLRGEVARFDITDRDGKVIVQKDKRINAKHIR
FT                   DLEAAKTKFISVPEDYLLGRVLAKNVVDGDTGEVIANANDEITESVLDKLREAKIKDIQ
FT                   TIYTNDLDQGPYISSTLRVDETADKTAARIAIYRMMRPGEPPTEEAVEALFNRLFYSED
FT                   AYDLSKVGRMKFNRRVGRDEIVGPMTLQDDDILATIKILVELRNGKGEVDDIDHLGNRR
FT                   VRCVGELAENQFRAGLVRVERAVKERLGQAESENLMPHDLINSKPISSAIREFFGSSQL
FT                   SQFMDQTNPLSEITLKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIG
FT                   LINSLALYAHLNEYGFLETPYRKVTDGKVTDQIDYLSAIEEGRYVIAQANASVDEATGE
FT                   LTDELVSAREAGETMMVTPDRIQYMDVAPSQIVSVAASLIPFLEHDDANRALMGSNMQR
FT                   QAVPCLRPEKPVVGTGIERTCAVDSGTTVQAERGGVVDYVDAGRIVIRVNDDEAVAGEV
FT                   GVDIYNLIKYTRSNQNTNINQRPIVKMGDKVSRGDVLADGASTDLGELALGQNMLIAFM
FT                   PWNGYNFEDSILISEKVVADDRYTSIHIEELNVVARDTKLGPEEITRDISNLAEVQLGR
FT                   LDESGIVYIGAEVEAGDVLVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPSG
FT                   MSGTVIDVQVFTREGIVRDKRAQQIIDDELKRYRLDLNDQLRIVEGDAFQRLARMLDGK
FT                   VANGGPKKLAKGTQIDQAYLSDLDHYHWFDIRLADEEAAAQLEAIKNSIEEKRHQFDLA
FT                   FEEKRKKLTQGDELPPGVLKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIVPVEDMPY
FT                   MADGRPADVVLNPLGVPSRMNVGQVLEVHLGWAAKGLGWRIGEMLQRQAKIEELRVFLT
FT                   KIYNESGRAEDLDSFSDDEILELARNLREGVPFATPVFDGATEEEMSKMLDLAFPDEIA
FT                   QQLGMTPSKNQVRLYDGRTGEAFERTVTVGYMHYLKLHHLVDDKMHARSTGPYSLVTQQ
FT                   PLGGKAQFGGQRFGEMEVWALEAYGASYVLQEMLTVKSDDVNGRTKVYENLVKGDHVID
FT                   AGMPESFNVLVKEIRSLGIDIDLDRN"
FT   gene            272822..277087
FT                   /locus_tag="bglu_1g02510"
FT   CDS_pept        272822..277087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02510"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27452"
FT                   /db_xref="GOA:C5A9F1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9F1"
FT                   /protein_id="ACR27452.1"
FT                   /translation="MKALLDLFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTLAKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAYVVIEPGMTPLKARQIMTEE
FT                   DYYNKVEEYGDEFRAEMGAEGVRELLRAINIDEQVETLRTELKNTGSEAKIKKYAKRLK
FT                   VLEAFQRSGIKPEWMILEVLPVLPPELRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLELKAPEIIVRNEKRMLQEAVDSLLDNGRRGKAMTGANKRPLKSLADMIKGKGGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPTLKLHQCGLPKLMALELFKPFIFNKLEVMGVATTIKAAKK
FT                   EVENQTPVVWDILEEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHVPLSLEAQMEARTLMLASNNVLFPANGDPSIVPSQDIVLGLYYATREA
FT                   VNGKGEGMSFTGVSEVLRAYENKEVELASRVNVRITEMVHNEDKSEGAPQFVPKVSLYA
FT                   TTVGRAILSEILPAGLPFSVLNKPLKKKEISRLINTAFRKCGLRATVVFADQLMQSGFR
FT                   LATRAGISICVDDMLVPPQKEVIVGDAAKKVKEYDRQYMSGLVTAQERYNNVVDIWSAT
FT                   SEAVGKAMMEQLSTEPVTDRDGNETRQESFNSIYMMADSGARGSAVQIRQLAGMRGLMA
FT                   KPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQDL
FT                   VVVEDDCGTSNGVAMKALVEGGEVVEALRDRILGRVAVADVVNPETQETLYETGTLLDE
FT                   TAVEEIERLGIDEVRVRTALTCETRYGLCAACYGRDLGRGSLVNVGEAVGVIAAQSIGE
FT                   PGTQLTMRTFHIGGAASRAAVASSVEAKSNGVVRFTATMRYVTNAKGEQIVISRSGEAM
FT                   ITDDIGRERERHKIPYGATLLQLDGDTIKAGTQLATWDPLTRPIITEYGGTVKFENVEE
FT                   GVTVAKQIDDVTGLSTLVVIDVKRRGSQASKSVRPQVKLLDANGEEVKIPNTEHSVQIG
FT                   FQVGALITVKDGQQVQVGEVLARIPTEAQKTRDITGGLPRVAELFEARSPKDAGILAEV
FT                   TGTTSFGKDTKGKQRLVITDLEGNQHEFLIAKEKQVLVHDAQVVNKGEMIVDGPADPHD
FT                   ILRLQGIEALSRYIVDEVQDVYRLQGVKINDKHIEVIVRQMLRRVQITDNGDTRFIPGE
FT                   QVERSDMLDENDRMIAEGKRPATYENILLGITKASLSTDSFISAASFQETTRVLTEAAI
FT                   MGKRDDLRGLKENVIVGRLIPAGTGLAFHKARRNKEVSDRERFDQIAQEEAFEFGIPET
FT                   PAAADPTDAVESQQHPSAE"
FT   gene            278069..279916
FT                   /locus_tag="bglu_1g02520"
FT   CDS_pept        278069..279916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02520"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27453"
FT                   /db_xref="GOA:C5A9F2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9F2"
FT                   /protein_id="ACR27453.1"
FT                   /translation="MSRALEILNEVFGYPAFRGQQGEIVEHVSAGGDCLVLMPTGGGKS
FT                   LCYQIPALVRHEAGQGAGIVVSPLIALMQDQVAALTEVGVRAAYLNSTLSGAEAAATER
FT                   ALREGELDLLYVAPERLMTPRFLDLLERTRIGLFAIDEAHCVSQWGHDFRPEYIQLSVL
FT                   HERFPYVPRIALTATADAITRDEIIQRLALDDARVFVSSFDRPNIRYRIVEKDNARSQL
FT                   LDFIRAEHTNADGTTDAGVVYCLSRRKVEETAEWLKTQGVRALPYHAGMEFEIRQRHQE
FT                   MFQREEGIVMCATIAFGMGIDKPDVRFVAHLDLPKSVEGYYQETGRAGRDGLPANAWMA
FT                   YGLGDVVQQRKMIDESDADDAHKRVQTGKLDALLGLCETASCRRVRLLGYFGEASQPCG
FT                   NCDTCLEPPATWDATREAQMALSCVFRAQRASGFNFGASHLIEILRGVKTEKVQQRGHD
FT                   TLSTFGIGAELSEPEWRAIFRQLVAFGYLAVDHGGFGALVLTEASKPVLKGEQTVTLRR
FT                   YVKPKSSRQSSARSGARADPTAGMSARERACWERLRAWRAETAKSDGVPAYVIFHDATL
FT                   AEIARNAPESIEDLRHIPGIGARKLDRFGDEILEVVEAA"
FT   gene            280196..280576
FT                   /locus_tag="bglu_1g02530"
FT   CDS_pept        280196..280576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02530"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27454"
FT                   /db_xref="GOA:C5A9F3"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9F3"
FT                   /protein_id="ACR27454.1"
FT                   /translation="MPTINQLVRKGRESETTKSKSPALQNCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDT
FT                   QGVKDRKQARSKYGAKRAKAAK"
FT   gene            280750..281220
FT                   /locus_tag="bglu_1g02540"
FT   CDS_pept        280750..281220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02540"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27455"
FT                   /db_xref="GOA:C5A9F4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9F4"
FT                   /protein_id="ACR27455.1"
FT                   /translation="MPRRREVPKREVLPDPKYGNVDVAKFMNMLMLSGKKSVAERIVYG
FT                   AFEQIQTKGGKDPLEVFTVALNNVKPVVEVKSRRVGGANYQVPVEVRPSRRMALAMRWL
FT                   REAAKKRSEKSMALRLAGELSEAAEGRGGAMKKRDEVHRMAEANRAFSHFRF"
FT   gene            281340..283442
FT                   /locus_tag="bglu_1g02550"
FT   CDS_pept        281340..283442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02550"
FT                   /product="Translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27456"
FT                   /db_xref="GOA:C5A9F5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9F5"
FT                   /protein_id="ACR27456.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWKGMGGNYPEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYDQLRLRLK
FT                   ANPVPVVVPIGSEENFKGVVDLLKMKAIIWDEASQGTKFDYVDIPAELADTCQEWREKM
FT                   VEAAAEASEDLMNKYLEEGDLPEADIVKALRDRTIACEIQPMLCGTAFKNKGVQRMLDA
FT                   VIDFLPSPVDIPPVKGELDNGESAERQASDEEKFSSLAFKIMTDPFVGQLIFFRVYSGV
FT                   VNSGDTLLNSTKGKKERLGRILQMHANQREEIKEVRAGDIAAAVGLKEATTGDTLCDPA
FT                   HPIVLERMVFPEPVISQAVEPKTKADQEKMGLALNRLAQEDPSFRVQTDEESGQTIISG
FT                   MGELHLEILVDRMKREFGVEATVGKPQVAYRETIRSTAKDVDGKFVKQSGGRGQYGHAT
FT                   ITLEPNEQGKGYEFFDEIKGGVIPREYIPAVDKGIQDTLKSGVLAGFPVVDVKVHLTFG
FT                   SYHDVDSNENAFRMAGSMAFKEAMRRANPVVLEPMMAVEVETPEDYMGNVMGDLSGRRG
FT                   IVQGMEDMVGGGKIVRAEVPLSEMFGYSTSLRSLTQGRATYTMEFKHYAEAPRNVAEAI
FT                   ISAKSK"
FT   gene            283486..284676
FT                   /locus_tag="bglu_1g02560"
FT   CDS_pept        283486..284676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02560"
FT                   /product="Translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27457"
FT                   /db_xref="GOA:C5A9E3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9E3"
FT                   /protein_id="ACR27457.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAK
FT                   KYDEIDAAPEEKARGITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIIKGSAKLALEGDKGELGETAIMNLADALDSYIPTPERAVDGTFLMPVEDVFS
FT                   ISGRGTVVTGRVERGIVKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREEVERGQVLAKPGSIKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPKDKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILD"
FT   gene            284822..285133
FT                   /locus_tag="bglu_1g02570"
FT   CDS_pept        284822..285133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02570"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27458"
FT                   /db_xref="GOA:C5A9F7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9F7"
FT                   /protein_id="ACR27458.1"
FT                   /translation="MQKQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTR
FT                   IQRFDILRSPHVNKTSRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ"
FT   gene            285308..285970
FT                   /locus_tag="bglu_1g02580"
FT   CDS_pept        285308..285970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02580"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27459"
FT                   /db_xref="GOA:C5A9F8"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9F8"
FT                   /protein_id="ACR27459.1"
FT                   /translation="MEKTMSLGLVGRKVGMTRIFTADGDSIPVTVLDVSDNRVTQIKTV
FT                   ETDGYTAVQVAFGSRRASRVTKPLAGHLAKAGVEAGEILKEFRIDATKAAELSNGAIVG
FT                   PDLFEVGQKVDVQGVSIGKGYAGTIKRYNFSSGRATHGNSRSHNVPGSIGMAQDPGRVF
FT                   PGKRMTGHMGDVTVTVQNLEIARIDAERKLLLVKGAIPGTKGGKVFVTPAVKTKGAK"
FT   gene            285970..286590
FT                   /locus_tag="bglu_1g02590"
FT   CDS_pept        285970..286590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02590"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27460"
FT                   /db_xref="GOA:C5A9F9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9F9"
FT                   /protein_id="ACR27460.1"
FT                   /translation="MELKLLNANGQEGAVVNASDVVFGRDYNEALIHQIVVAYQANARQ
FT                   GNRAQKDREQVKHTTKKPWRQKGTGRARAGMSSSPLWRGGGRIFPNSPEENFSHKVNKK
FT                   MHRAGLCSIFSQLAREGRLSVVEDLTLEAPKTKLLAEKFKAMGLESVLVITDTVDENLY
FT                   LASRNLPNVAVVEPRYADPLSLIYFKKILVTKAAVAQIEELLS"
FT   gene            286587..286901
FT                   /locus_tag="bglu_1g02600"
FT   CDS_pept        286587..286901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02600"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27461"
FT                   /db_xref="GOA:C5A9G0"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9G0"
FT                   /protein_id="ACR27461.1"
FT                   /translation="MSEIRKNDHRLMQVLLAPVVSEKATLVADKNEQVVFEVAPDATKQ
FT                   EVKAAVELLFKVEVDSVNVLVQKGKQKRFGRSMGRRKDVKKAYVCLKPGQEINFEAEAK
FT                   "
FT   gene            286904..287731
FT                   /locus_tag="bglu_1g02610"
FT   CDS_pept        286904..287731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02610"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27462"
FT                   /db_xref="GOA:C5A9G1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9G1"
FT                   /protein_id="ACR27462.1"
FT                   /translation="MAIVKVKPTSPGRRAMVKVVNKDLHKGKPFAALLDTQSSTAGRNN
FT                   NGHITTRHKGGGHKQHYRIVDFRRNKDGIPAKVERLEYDPNRSANIALVLYADGERRYI
FT                   IAPKGVVVGQQLMSGSEAPIRAGNTLPIRNIPVGTTIHCVEMLPGKGAQIARSAGTSAM
FT                   LLAREGVYAQVRLRSGEIRRVHIECRATIGEVGNEEHSLRQIGKAGANRWRGIRPTVRG
FT                   VAMNPIDHPHGGGEGKTAAGRDPVSPWGTPAKGFRTRSNKRTTTMIVQRRHKR"
FT   gene            287742..288017
FT                   /locus_tag="bglu_1g02620"
FT   CDS_pept        287742..288017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02620"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27463"
FT                   /db_xref="GOA:C5A9G2"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9G2"
FT                   /protein_id="ACR27463.1"
FT                   /translation="MARSVKKGPFCDAHLLKKVEAAAASRDKKPIKTWSRRSTILPDFI
FT                   GLTIAVHNGRQHVPVYISENMVGHKLGEFALTRTFKGHAADKKAKK"
FT   gene            288030..288359
FT                   /locus_tag="bglu_1g02630"
FT   CDS_pept        288030..288359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02630"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27464"
FT                   /db_xref="GOA:C5A9G3"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9G3"
FT                   /protein_id="ACR27464.1"
FT                   /translation="MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAG
FT                   IVKKVVLSAIANAEHNEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHIT
FT                   VTVGN"
FT   gene            288371..289171
FT                   /locus_tag="bglu_1g02640"
FT   CDS_pept        288371..289171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02640"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27465"
FT                   /db_xref="GOA:C5A9G4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9G4"
FT                   /protein_id="ACR27465.1"
FT                   /translation="MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKK
FT                   KLKNASVGRVVIERPAKNARITIYSSRPGVVIGKKGEDIELLKTELQRRMGVPVHVNIE
FT                   EIRKPETDAQLIADSITQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVTED
FT                   KRPRRNARPGDRRPRRDGEGGGPGARRGAPRRAAGKPEDGKTGE"
FT   gene            289174..289590
FT                   /locus_tag="bglu_1g02650"
FT   CDS_pept        289174..289590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02650"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27466"
FT                   /db_xref="GOA:C5A9G5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9G5"
FT                   /protein_id="ACR27466.1"
FT                   /translation="MLQPKRRKYRKEQKGRNTGIATRGNAVSFGEYGLKAIGRGRLTAR
FT                   QIEAARRAMTRHIKRGGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLY
FT                   EMDGVTEELAREAFRLAAAKLPLKTAFIVRQLGA"
FT   gene            289600..289794
FT                   /locus_tag="bglu_1g02660"
FT   CDS_pept        289600..289794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02660"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27467"
FT                   /db_xref="GOA:C5A9G6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9G6"
FT                   /protein_id="ACR27467.1"
FT                   /translation="MKASELLQKDQAALNKELSDLLKAQFGLRMQLATQQLTNTSQLKK
FT                   VRRDIARVRTVLTQKANQK"
FT   gene            289791..290063
FT                   /locus_tag="bglu_1g02670"
FT   CDS_pept        289791..290063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02670"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27468"
FT                   /db_xref="GOA:C5A9G7"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9G7"
FT                   /protein_id="ACR27468.1"
FT                   /translation="MNDSVKTSLKRTLVGRVVSNKMDKTVTVLIENRVKHPIYGKYVVR
FT                   SKKYHAHDEANTYNEGDLVEIQETRPLSKTKAWTVSRLIEAARVI"
FT   gene            290365..290733
FT                   /locus_tag="bglu_1g02680"
FT   CDS_pept        290365..290733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02680"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27469"
FT                   /db_xref="GOA:C5A9G8"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9G8"
FT                   /protein_id="ACR27469.1"
FT                   /translation="MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKE
FT                   ATPRGRVKKGEIYNAVVVRTAKGVRRQDGSLIKFDGNAAVLLNNKLEPIGTRIFGPVTR
FT                   ELRSERFMKIVSLAPEVL"
FT   gene            290743..291048
FT                   /locus_tag="bglu_1g02690"
FT   CDS_pept        290743..291048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02690"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27470"
FT                   /db_xref="GOA:C5A9G9"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9G9"
FT                   /protein_id="ACR27470.1"
FT                   /translation="MNKIRKGDEIIVITGKDKGKRGVVLAVGAEHVTVEGINLVKKHVK
FT                   PNPMKGTTGGVEAKAMPLHISNVALVDANGKASRVGIKVEEGKKVRFLKTTGAVLA"
FT   gene            291063..291602
FT                   /locus_tag="bglu_1g02700"
FT   CDS_pept        291063..291602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02700"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27471"
FT                   /db_xref="GOA:C5A9H0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9H0"
FT                   /protein_id="ACR27471.1"
FT                   /translation="MARFQEFYKEKVVPGLIEKFGYKSIMEVPRITKITLNMGLGEAVA
FT                   DKKIIENAVGDLTKIAGQKPVVTKARKAIAGFKIRQGYPIGAMVTLRGRAMYEFLDRFV
FT                   TVALPRVRDFRGVSGRAFDGRGNYNIGVKEQIIFPEIDYDKIDALRGLNISITTTAKTD
FT                   DEAKALLASFKFPFRN"
FT   gene            291610..291915
FT                   /locus_tag="bglu_1g02710"
FT   CDS_pept        291610..291915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02710"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27472"
FT                   /db_xref="GOA:C5A9H1"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9H1"
FT                   /protein_id="ACR27472.1"
FT                   /translation="MAKLALIEREKKRARLAAKFAPKRAALKAVIDDASKSDEERYAAR
FT                   LELQQLPRNSNPTRKRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW"
FT   gene            291930..292325
FT                   /locus_tag="bglu_1g02720"
FT   CDS_pept        291930..292325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02720"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02720"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27473"
FT                   /db_xref="GOA:C5A9H2"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9H2"
FT                   /protein_id="ACR27473.1"
FT                   /translation="MSMSDPIADMLTRIRNAQMVEKVSVAMPSSKVKVAIAQVLKDEGY
FT                   IDDFAVKTEGAKAELNIALKYYAGRPVIERLERVSKPGLRVYRGRNDIPQVMNGLGVAI
FT                   VSTPKGVMTDRKARATGVGGEVICYVA"
FT   gene            292344..292874
FT                   /locus_tag="bglu_1g02730"
FT   CDS_pept        292344..292874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02730"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27474"
FT                   /db_xref="GOA:C5A9H3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9H3"
FT                   /protein_id="ACR27474.1"
FT                   /translation="MSRVGKSPIALQGAEVTLANGSITVKGPLGTISQVVNPLVTVAND
FT                   NGTLNLAPVDESREANALSGTMRAIIANMVHGVTKGFERKLTLVGVGYRAQAQGDKLNL
FT                   SLGFSHPVVHQMPEGVKAETPTQTEILIKGIDKQKVGQVAAEVRGYRPPEPYKGKGVRY
FT                   ADEVVILKETKKK"
FT   gene            292887..293252
FT                   /locus_tag="bglu_1g02740"
FT   CDS_pept        292887..293252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02740"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27475"
FT                   /db_xref="GOA:C5A9H4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9H4"
FT                   /protein_id="ACR27475.1"
FT                   /translation="MDKTQSRLRRARQTRIKIAELQVARLAVHRTNSHIYAQVFSPCGT
FT                   KVVASASTLEAEVRAQLADQSGKGGNVNAATLIGKRIAEKAKAAGIESVAFDRSGFRYH
FT                   GRVKALADAAREAGLKF"
FT   gene            293266..293784
FT                   /locus_tag="bglu_1g02750"
FT   CDS_pept        293266..293784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02750"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02750"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27476"
FT                   /db_xref="GOA:C5A9H5"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9H5"
FT                   /protein_id="ACR27476.1"
FT                   /translation="MAKMQAKVQADERDDGLREKMISVNRVTKVVKGGRILGFAALTVV
FT                   GDGDGRVGMGKGKAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAP
FT                   AKEGTGVIAGGPMRAVFDVMGVQNVVAKSHGSTNPYNLVRATLDGLRKQSTPADIAAKR
FT                   GKSVEDILG"
FT   gene            293791..293982
FT                   /locus_tag="bglu_1g02760"
FT   CDS_pept        293791..293982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02760"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02760"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27477"
FT                   /db_xref="GOA:C5A9H6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9H6"
FT                   /protein_id="ACR27477.1"
FT                   /translation="MVTMSEKTVKVQLVKSLIGTRETHRATVRGLGLRRLNSVSELQDT
FT                   PAVRGMINKVSYLVKVIG"
FT   gene            294010..294444
FT                   /locus_tag="bglu_1g02770"
FT   CDS_pept        294010..294444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02770"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02770"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27478"
FT                   /db_xref="GOA:C5A9H7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9H7"
FT                   /protein_id="ACR27478.1"
FT                   /translation="MELNNLKPAEGAKHAKRRVGRGIGSGLGKTAGRGHKGQKSRSGGF
FT                   HKVGFEGGQMPLQRRLPKRGFTSLTKEFVGEVRLGDLEKLPVEEIDLLALKQAGLVGEL
FT                   TKSAKIIATGELKRKIVVKGLGATKSARAAIEAAGGSFAE"
FT   gene            294488..295834
FT                   /locus_tag="bglu_1g02780"
FT   CDS_pept        294488..295834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02780"
FT                   /product="Preprotein translocase SecY"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02780"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27479"
FT                   /db_xref="GOA:C5A9H8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9H8"
FT                   /protein_id="ACR27479.1"
FT                   /translation="MANSPSLAKPGRSTAKFGDLRRRAMFLLLALIVYRIGAHIPVPGI
FT                   DPDQLAKLFQSQAGGILGMFNMFSGGALSRFTIFALGIMPYISASIIMQLLAIVSPQLE
FT                   ALKKEGQAGQRKITQYTRIFTVVLATFQAFGIAAALENQPGLVIDPGMLFRLTTVVTLV
FT                   TGTMFLMWLGEQITERGLGNGISIIIFGGIAAGFPNAVGGLFELVRTGSMSIISAIIIV
FT                   VLIGAVTYLVVFIERGQRKILVNYAKRQVGNKVYGGQSSHLPLKLNMSGVIPPIFASSI
FT                   ILFPATILSWFSSGDRKSWLSDTLHNVAEALKPGQPVYVLLYTLAIVFFCFFYTALVFN
FT                   SRETADNLKKSGAFVPGIRPGDQTARYIDRILTRLTLAGAIYIVFVCLLPEFLVLRWNV
FT                   PFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKANFKGSNIPMR"
FT   gene            295844..296062
FT                   /locus_tag="bglu_1g02790"
FT   CDS_pept        295844..296062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02790"
FT                   /product="Translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02790"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27480"
FT                   /db_xref="GOA:C5A9H9"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9H9"
FT                   /protein_id="ACR27480.1"
FT                   /translation="MAKDDVIQMQGEVVENLPNATFRVKLENGHVVLGHISGKMRMHYI
FT                   RILPGDKVTVELTPYDLSRARIVFRAK"
FT   gene            296059..296199
FT                   /locus_tag="bglu_1g02800"
FT   CDS_pept        296059..296199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02800"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02800"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27481"
FT                   /db_xref="GOA:C5A9I0"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9I0"
FT                   /protein_id="ACR27481.1"
FT                   /translation="MICKKGNIMKVMASVKRICRNCKIIKRKGVVRVICSSDPRHKQRQ
FT                   G"
FT   gene            296238..296603
FT                   /locus_tag="bglu_1g02810"
FT   CDS_pept        296238..296603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02810"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02810"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27482"
FT                   /db_xref="GOA:C5A9I1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9I1"
FT                   /protein_id="ACR27482.1"
FT                   /translation="MARIAGVNIPNHQHTEIGLTAIFGVGRTRARSICVAAGVDFSKKV
FT                   KDLNDADLEKLREEVGKFVVEGDLRREVTMNIKRLMDLGCYRGVRHRKGLPMRGQRTRT
FT                   NARTRKGPRRAAQALKK"
FT   gene            296627..297028
FT                   /locus_tag="bglu_1g02820"
FT   CDS_pept        296627..297028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02820"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02820"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27483"
FT                   /db_xref="GOA:C5A9I2"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9I2"
FT                   /protein_id="ACR27483.1"
FT                   /translation="MAKASNNAAQRVRKKVKKNVAEGVVHVHASFNNTIITITDRQGNA
FT                   LAWATSGGQGFKGSRKSTPFAAQVAAESAGRVAMEYGVKNLEVRIKGPGPGRESAVRAL
FT                   HGLGIKITAISDVTPIPHNGCRPPKRRRI"
FT   gene            297176..297799
FT                   /locus_tag="bglu_1g02830"
FT   CDS_pept        297176..297799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02830"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02830"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27484"
FT                   /db_xref="GOA:C5A9I3"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9I3"
FT                   /protein_id="ACR27484.1"
FT                   /translation="MARYTGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRIS
FT                   GARTSDYGTQLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVY
FT                   RMGFGSTRAEARQLVSHKAITVNGVASNIPSLQVKPGDVIAIREKSKKQARIVEALSLA
FT                   EQGGMPSWVAVDAKKFEGTFKQVPERAEIAGDINESLIVELYSR"
FT   gene            297922..298899
FT                   /locus_tag="bglu_1g02840"
FT   CDS_pept        297922..298899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02840"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02840"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27485"
FT                   /db_xref="GOA:C5A9I4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9I4"
FT                   /protein_id="ACR27485.1"
FT                   /translation="MQTSLLKPKIIAVESLGENHAKVVMEPFERGYGHTLGNALRRVLL
FT                   SSMVGYAPTEVTIAGVVHEYSTLDGVQEDVVNLLLNLKGVVFKLHNRDEVTVTLRKEGE
FT                   GIVTAGDIELAHDCEVINPDHVIAHLTKGGKLDVQIKIEKGRGYVPGNVRRYGEETAKI
FT                   IGRIVLDASFSPVRRVSYAVESARVEQRTDLDKLVMNIETSGVITPEEAIRQSARILVD
FT                   QLSVFAALEGTETAAEAPSRAPQIDPILLRPVDDLELTVRSANCLKAENIYYIGDLIQR
FT                   TENELLKTPNLGRKSLNEIKEVLASRGLTLGMKLENWPPAGLDK"
FT   gene            299046..299438
FT                   /locus_tag="bglu_1g02850"
FT   CDS_pept        299046..299438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02850"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02850"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27486"
FT                   /db_xref="GOA:C5A9I5"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9I5"
FT                   /protein_id="ACR27486.1"
FT                   /translation="MRHRHGLRKLNRTSSHRLAMLRNMSNSLIEHEVIKTTLPKAKELR
FT                   KVVEPLITLGKKPSLANRRLAFNRLRDRDSVTKLFDVLGPRFANRPGGYLRILKFGFRV
FT                   GDNAPMALVELLDRPEVAEDNVQEAE"
FT   gene            299571..299897
FT                   /locus_tag="bglu_1g02860"
FT   CDS_pept        299571..299897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02860"
FT                   /product="Putative periplasmic cytochrome biogenesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02860"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27487"
FT                   /db_xref="GOA:C5A9I6"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9I6"
FT                   /protein_id="ACR27487.1"
FT                   /translation="MVIVLMMTTVPDAATARALADGALGARLAACASELGTIRSSYHWQ
FT                   GKIESAQEIQLLFKTSAVRALELERFITSHHPYETPEIVSWQATASVPYGTWVAAETQR
FT                   LFHV"
FT   gene            299890..301818
FT                   /locus_tag="bglu_1g02870"
FT   CDS_pept        299890..301818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02870"
FT                   /product="Putative thiol:disulfide interchange protein
FT                   DsbD"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02870"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27488"
FT                   /db_xref="GOA:C5A9I7"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9I7"
FT                   /protein_id="ACR27488.1"
FT                   /translation="MSDRHFSAAACLRLLLACLVLFGALFGLSPAARADGDFLDPSLAF
FT                   RFSSSESPGQVNLHFSIADGYYMYRERFAFAVKSGTATLGEAQIPPGHVKYDETFAKNV
FT                   ETYRGELTIHVPVVKAAGPFELSVTSQGCADGGICYPPAEHVVRVDGTALAAAPAAGSP
FT                   AQSSVPAAAPQAPAPAAQGAVAPASLAPPAADGSWYERVTSADYARSLLEGRGFLTVVA
FT                   LFFVAGMVLSLLPCSYPMIPILSAIIIGEGTRATRARGFALSLTYVVGMALVYTVLGIV
FT                   AALIGQSLGAWLQNPWMLGAFALLLTVFALTLIGGIDIALPQRWQDGAAQASSRRSGGR
FT                   FAAVAAMGALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFAMGIGLGVPLLIIGL
FT                   GAGTLLPRAGAWMEGVKVFFGVVLLAAALWIVWPVLGAAVQIALAALWLLIAAAATGLF
FT                   TPAAGGASIWRRLGRGVGAAFAIWAAVLLVGLAAGSTDPLRPLSVFAARGAGAAAGAAA
FT                   GTGAHEGPSFAPVRSSAELDRIIQTAGRPVLLDFYADWCVSCKEMEHLTFTDPRVQARL
FT                   GQLQLVRADVTANNGDDQALLKRFGLFGPPGIIVFGLDGRELGRVVGYQDAERFLRSLD
FT                   RAGAPSA"
FT   gene            complement(301905..302903)
FT                   /locus_tag="bglu_1g02880"
FT   CDS_pept        complement(301905..302903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02880"
FT                   /product="Porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02880"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27489"
FT                   /db_xref="GOA:C5A9I8"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9I8"
FT                   /protein_id="ACR27489.1"
FT                   /translation="MSLHPLHRPRRMRRDDFSRRLMRENLLTTNDLILPVFVVEGTNVR
FT                   QGVASMPGVERVSVDLLMGVAEQCVELGVPVLSLFPAIEPALKTPDGHEAGNPEGLIPR
FT                   AVRELKRRFPELGVLTDVALDPYTSHGQDGVLDEHGYVINDATIEILLEQARAQAEAGV
FT                   DIVAPSDMMDGRIGSIREMLESDGHIHTRIMAYSAKYASAFYGPFRDAVGSAANLGKSN
FT                   KMTYQMDPANSDEALREIRLDIDEGADMVMVKPGMPYLDIVRRVKDEFRFPTYVYQVSG
FT                   EYAMLKAAALNGWLDHDKVVLESLLAFKRAGADGVLTYFALEAARLLRDQK"
FT   gene            complement(303149..303808)
FT                   /locus_tag="bglu_1g02890"
FT   CDS_pept        complement(303149..303808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02890"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02890"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27490"
FT                   /db_xref="GOA:C5A9I9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9I9"
FT                   /protein_id="ACR27490.1"
FT                   /translation="MAFLLHQARFYTTVNHLRDLPPTVIPEIAFAGRSNAGKSTAINIL
FT                   CNQKRLAFASKTPGRTQHINYFSVGPEAEPVANLVDLPGYGYAEVPGAAKAHWEALLSA
FT                   YLKTRPQLRGMILMMDSRRPLTELDQRMIEWFAPTGKPIHTLLTKCDKLTRQESVNALR
FT                   NTKKALAAYRDAGYEGELTVQLFSALKRTGLDEAHALIESWLRPPVAGENDAAVGE"
FT   gene            304055..304714
FT                   /locus_tag="bglu_1g02900"
FT   CDS_pept        304055..304714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02900"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02900"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27491"
FT                   /db_xref="GOA:C5A9J0"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9J0"
FT                   /protein_id="ACR27491.1"
FT                   /translation="MRMNRLCKSLIALQVAAGFVGFVAEANAADAAKPDLERGRTIATQ
FT                   VCASCHGADGNSATGAFPKLAGQHPEYLVKQLHDFKTQPGAQGPARNSAVMAGFASALS
FT                   DADARDVAAYYAAQTPKPGVARNAATVALGRQIYRGGIADKGVPACASCHGPTGQGVPV
FT                   QYPRLSGQWADYTAAQLAAFQQGAGARNNNEPMHQIASRLSDSEVKAVADYIAGLH"
FT   gene            304841..307021
FT                   /locus_tag="bglu_1g02910"
FT   CDS_pept        304841..307021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02910"
FT                   /product="Putative cytochrome C biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02910"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27492"
FT                   /db_xref="GOA:C5A9J1"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9J1"
FT                   /protein_id="ACR27492.1"
FT                   /translation="MSVTTSGIRANSRRRMLNAAVELISSMRFAIALLVVLAIASIIGT
FT                   VLTQDDPYPNYVNQFGPFWADIFRALGLYTVYSAWWFMLILLFLVASLSLCVIRNGPKM
FT                   LADARSWKDKVREGSLRAFHHKAEYAAAGTRAQVAASLAGFIGKAGYRLVVRESEAATL
FT                   ISAKRGAMTRYGYIAAHLAIVVICLGGLLDSNLPIHFQMWLFGKSPVNTSAAISEISAD
FT                   HRLSASNPTFRGYAWVPEGQYVSTAILNQPNGSLIQDLPFSIQLDKFIVDYYSTGMPKL
FT                   FASDIVVIDRETGKRIPARVEVNKPFTYKGVSIYQSSFQDGGSQMRMTAFPMTGARDAT
FT                   FPVNGTIGNAVPLAGHDGETIEFADFRAINVENLTDASGKTDARGVSMTHSLKEAFDER
FT                   LGSGAKTSTPVNLRNVGPSVQYKVRGKDGQAREFNNYMLPVEVGGDRVFLAGVRASPND
FT                   PFRYLRIPADADDSIEGWMRIRAALADPAVRAEAARRFAQGSLPGADAALRTRLDDSAL
FT                   RVLTLFAGADASSGRQPDGAPVGGFQAVASFIDQSVPKAEQEKAAGLLLRMLEGAMWQV
FT                   WEVARERAGLKPVAQSAEAARFVQNTINALSDSFLYGAPVYLRLDSYKQVQASVFQLTR
FT                   APGKNLVYLGSLLLVFGIFSMFYVRERRLWFWLKDTQAGTSVVMAMSSARKTLDFEKEF
FT                   AQTRDAVGAVLGAAPAAAGAAERKTDPHDSPR"
FT   gene            307026..308222
FT                   /locus_tag="bglu_1g02920"
FT   CDS_pept        307026..308222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02920"
FT                   /product="Cytochrome c assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02920"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27493"
FT                   /db_xref="GOA:C5A9J2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9J2"
FT                   /protein_id="ACR27493.1"
FT                   /translation="MDLTRVSSSPAPRGRTQAPAPAPLFDERPFLRRLSVVDWLFALAM
FT                   VAGAGFALVRYQARMDYYDQAVMTGSAAALIVLGWRWKPARALMASIAVLSLLSLNLYH
FT                   GELSRADSVFLLKYLLSSQSAILWMSALFVFATVFYWIGMLSRSETGTAIGQKMTWAAV
FT                   LMGFTGLMVRWYESYLIGADVGHIPVSNLYEVFVLFSLITALLYLYYEGHYGTRALGAF
FT                   VLLVISAAVGFLMWYSIARDAQQIQPLVPALQSWWMKIHVPANFIGYGSFALSAMVSVA
FT                   YLLKERGVLADRLPALEVLDDVMYKSIAVGFAFFTIATILGALWAAEAWGGYWSWDPKE
FT                   TWALIVWLNYAAWLHMRLMKGLRGTVAAWWALTGLVVTTFAFLGVNMFLSGLHSYGKL"
FT   gene            308389..309381
FT                   /locus_tag="bglu_1g02930"
FT   CDS_pept        308389..309381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02930"
FT                   /product="putative sulfite oxidase subunit YedY"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02930"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27494"
FT                   /db_xref="GOA:C5A9J3"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9J3"
FT                   /protein_id="ACR27494.1"
FT                   /translation="MLIRTTRRRLLTGGDIAPHDITAPSVFAARRGMLRAAGAAVAAGL
FT                   GVPGAASAAYRSPDPAAHPLAAATNAKFVVPDKVTPYQDVTTYNNFYEFGTDKGDPARH
FT                   AGSLRPHPWRVSVEGEVKAPKVYDIDALLKLAPLEERVYRHRCVEGWSMVIPWIGIPLA
FT                   DLIRRVQPTANAKYVQFVTLADPSQMPGLAEPILDWPYSEGLRLDEAMNPLTLLTMGVY
FT                   GQVLPNQNGAPVRIVVPWKYGFKSAKSIVKIRFVEQMPKTSWNTYAPNEYGFFSNVNPE
FT                   VDHPRWSQATERRIGEDGFFTPKRKTLMFNGYGDLVASMYRGMDLRKNF"
FT   gene            309392..310075
FT                   /locus_tag="bglu_1g02940"
FT   CDS_pept        309392..310075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02940"
FT                   /product="putative sulfite oxidase subunit YedZ"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02940"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27495"
FT                   /db_xref="GOA:C5A9J4"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9J4"
FT                   /protein_id="ACR27495.1"
FT                   /translation="MDENLQGASRAVRGGGPRGSTAVPAAPRALRIAKVAVFTAGLYPL
FT                   ARLVLLGATGGLGANPIEFVTRSTGLWTLVILCVTLAVTPLRRLTGVAALLRLRRMIGL
FT                   FAFFYATLHFITYFWFDKWFDLAAILKDVVKRPFITVGFAAFVLLIALALTSPRAMVRR
FT                   LGRHWQRLHRLIYAIALLAILHFWWMRAGKHDLALPKLYGAIVLVLLGWRLVAVLARRR
FT                   ARAAG"
FT   gene            complement(310161..311432)
FT                   /locus_tag="bglu_1g02950"
FT   CDS_pept        complement(310161..311432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02950"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02950"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27496"
FT                   /db_xref="GOA:C5A9J5"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9J5"
FT                   /protein_id="ACR27496.1"
FT                   /translation="MTHRAFDYVDGTLHAEGIPADKLADHFDTPLYVYSRAALTAAYQA
FT                   YAKACEGRRASLHVAVKANSNLGVLNVFARLGAGFDIVSGGELARVLAAGGKAEHVVFS
FT                   GVAKSADEMRLALEAGVKCFNVESVPELDRLNAVAGSLGKRAPVSLRVNPDVDPKTHPY
FT                   ISTGLKANKFGVAFADARATYRAADALPNLQVAGIDCHIGSQITELSPYLDALDKVLDL
FT                   VEQIEADGIAIHHVDVGGGLGITYADETPPDIGAFVQALFAKLDARGHGHRELCFEPGR
FT                   SLTGNAGILLTRVEFLKPGEEKNFAIVDAGMNDLARPAMYEAYHAIVPVRQTSAHASAV
FT                   YDVVGPVCESGDWLGRERTLAIAAGDLLAIRSAGAYGFAMSSNYNTRPRAAEVLVDGQN
FT                   AYLVRQRETIASLYENEAILPEEA"
FT   gene            complement(311439..311711)
FT                   /locus_tag="bglu_1g02960"
FT   CDS_pept        complement(311439..311711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02960"
FT                   /product="Lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02960"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27497"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9J6"
FT                   /protein_id="ACR27497.1"
FT                   /translation="MRVVFQMSAIVAALALAGCGQRGALYLPTVPPLPPKPIEMTQPPA
FT                   ADDAASAPAAASAADPAPDDAAGASLTLSPSLASPGAASDATPNR"
FT   gene            311748..312074
FT                   /locus_tag="bglu_1g02970"
FT   CDS_pept        311748..312074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02970"
FT                   /product="frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02970"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27498"
FT                   /db_xref="GOA:C5A9J7"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9J7"
FT                   /protein_id="ACR27498.1"
FT                   /translation="MSDTEYLTRAEAVLAAVERCVDEANEGDLDIDLGRNGSVVTLTFE
FT                   NGTKIIVNLQPPMKEVWIAAKSGGYHFRYVDGAWRDTRSGNEFFAALTQYATEQAGEPV
FT                   RFSA"
FT   gene            complement(312156..314597)
FT                   /locus_tag="bglu_1g02980"
FT   CDS_pept        complement(312156..314597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02980"
FT                   /product="Penicillin-binding protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02980"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27499"
FT                   /db_xref="GOA:C5A9J8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9J8"
FT                   /protein_id="ACR27499.1"
FT                   /translation="MPMHPTTPPPPPPASEPPPPQPPAVEPPPPPPPPPRKRPLWLKLL
FT                   LGFVGLCVALALCAGLVLGYALVVAWPNMPSLDALTDYRPKVPLRIYTADHVLIGEFGE
FT                   ERRDVVHIQDVPDSLKKAILAIEDARFYEHGGVDLMGIARAGMVALTNGHATQGASTIT
FT                   MQVARNFFLSSEKTYTRKIYEMLLSYRIERALTKDQILEVYMNQIYLGQRAYGFASAAR
FT                   VYFGKDLKDLTLAEAAMLAGLPKAPSAYNPVVNPKRAKVRQQYILERMLELNFITRAQY
FT                   DEAVAQPLVVKSATREYSVHAEYIAEMVRQMMYAQYKDETYTRGFNVVTTVDSADQTLA
FT                   YQALRRGLMDYERRHGYRGPEAFIELPAEPAQREQAIADALLDHPDNGELIAAVVTDAN
FT                   PKQVRIAFADGSGTTLEGPGLRFAAASLAANAQPNRRIRPGAIVRVMKNDGGDWAITQL
FT                   PQIEGAFVSIVPQDGAIRSLVGGFDFNKNKFNHVTQAWRQPGSSFKPFIYSASLDKGLG
FT                   PATIINDAPLFFSAAETGGQPWEPKNYGGGFDGPEPMRTALMRSRNLVSIRILNYIGTK
FT                   YAQQYITRFGFDAERHPAYLPMALGAGLVTPLQMAGAYSVFANGGYRVNPYLIAEVTDS
FT                   SGNVVARAQPLVAGQSAPRAIDARNAYVMNSLLQSVAQRGTGAKTNVLKRTDLGGKTGT
FT                   TNDSRDAWFAGFQHTLAAIAWIGYDNPRSLGDRETGGGLALPVWIDYMGPSLKNVPEYK
FT                   MPMPDGVTTIGDELFFSEFTPGHGFVSTIGVQAASPDDASIPHVDAQEKQDIMNLFQGG
FT                   N"
FT   gene            314783..315733
FT                   /locus_tag="bglu_1g02990"
FT   CDS_pept        314783..315733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g02990"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g02990"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27500"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9J9"
FT                   /protein_id="ACR27500.1"
FT                   /translation="MTGYRQWMAGRRLAAGIDVGQDVVRVAFVSRRGSVIGIERLECEP
FT                   LDASHDVAGGDWAAVTRALARVAGRAGARLPVGRMPAAMALSCREVAMSMLDARLAADG
FT                   PLEPAVLVEAERATGMARDSLAIDWCVNDILHPGRVMIASTDRARIDVRVEAAAAAGFG
FT                   LTAIDGEPHAALRAIRQVAALEVEADAPYAAIWIGAGGMDGWRVEATTATTHVRAPSPA
FT                   RASVADALRELARRGGEIDCAFVGGALDEGVEDDARGGPGAIAARLAEIGDLLGCAALP
FT                   FECAAYCRRPGIDAAACHSPRFAVAFGLGLRGVCE"
FT   gene            315730..316416
FT                   /locus_tag="bglu_1g03000"
FT   CDS_pept        315730..316416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03000"
FT                   /product="Putative PilN protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03000"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27501"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9K0"
FT                   /protein_id="ACR27501.1"
FT                   /translation="MSARRRLAVVPPRAVMRDPARCRAWLGGFNLMPYRQREARLRRRR
FT                   RAAEFAGAACVGLAAAALSCAGQVRERMRLDTRRMAIEQQLAQWAPQLRAADAAARESA
FT                   ARRRHETVAAEQARPLARAVALFDALRALDYRAVRLLGLRQADGGARLDAQARGPLAAA
FT                   RWVERLRETRADWRVEVAGIDAGEREPATGGSRAIRFVVRVRWPHGGQRPPAVVSRGGA
FT                   SGGERG"
FT   gene            316449..317384
FT                   /locus_tag="bglu_1g03010"
FT   CDS_pept        316449..317384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03010"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27502"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9K1"
FT                   /protein_id="ACR27502.1"
FT                   /translation="MTMLRIPAYHGATKLVVLGCVAGAVGVVLRAAGDERDLSGLGQAR
FT                   RRLDAAISARGQAERRLRAGRPGQAAPRTAPARARAAALPHEAPLPAPRAAASAAPIAA
FT                   AARGSRPPFVASQPSRHDGPFVRDAVWLLAIAAHESGLRIGRLGPAPAEHGKHGAAAGR
FT                   RYDLAGTGSFGEVARWLRALAREPATFAPLSLEVTRRGGGAVFSARFSVHDGGGRPAAG
FT                   SGLAPAALPAADAFEFGGAEAVAMPRVAGILRDARGGLALLDAGGRARSAAVGERIGAE
FT                   RITRIAADGVWLEADDGREQRVALGAETIR"
FT   gene            317381..319330
FT                   /locus_tag="bglu_1g03020"
FT   CDS_pept        317381..319330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03020"
FT                   /product="Type II/III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27503"
FT                   /db_xref="GOA:C5A9K2"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9K2"
FT                   /protein_id="ACR27503.1"
FT                   /translation="MSRLAGLMVRMMAVAGLVVAAEAAAPASLPPLPVAVSTNAGVGAA
FT                   GVPPIGDGDDARPLDAGDDGERGMSGLDGAAGRNDGGDDDAAPAEPRHGAARGRASGSA
FT                   AAANALSPAGLPVALPGASVDARAPASGTASGAVPDGVDPAGDRPPAGAGTRAAGAAEA
FT                   GSAAAPPALEGPPITMPAPVRLSAAPASVHGSHGLHGHRRISLDLQQAPLAAVFDAFAR
FT                   FTGQSIVLSGRVQGAATLRLRDVPWRDAFDALLDANGLAMARRGGVIWVAPVAELAARE
FT                   RARFETHARTAALEPLASRAFVLRYPRAKDVARLLTGGAAGQRVLSRRGSVLADPRTNL
FT                   LFVTDLDGRLAQIAALLAQLDRPSRQVLIEARIVEGERGFSRELGARLALRSSAWGGSR
FT                   AGAGAGGSGGSDGGAGGAAMPDSNPGGAATGIVGGPGGRLLDLSARPLAGFEAATAGLT
FT                   LFVAGASRLLDLELSALEAQGRGRIVSSPRIVTADRAPALIEQGTELPYQAKVGLGVSG
FT                   VQFRRATLKLEVEPQITPEGHVVLDLDVAKDSVGESTDAGPAIHTKHVRTRVEIENGGT
FT                   VSIGGIYESDRRDDVTRVPVLGKIPMLGALFRHRARRQRTAELVVYITPRVVGAQNGPP
FT                   AGGPGSGDESAAAR"
FT   gene            319367..319972
FT                   /locus_tag="bglu_1g03030"
FT   CDS_pept        319367..319972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03030"
FT                   /product="Shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27504"
FT                   /db_xref="GOA:C5A9K3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9K3"
FT                   /protein_id="ACR27504.1"
FT                   /translation="MPVSCATPPARLKQRKPLQARDPYASVFFVGLMGAGKTTVGRAVA
FT                   RRLDRPFFDSDHEIEARTGTRIPVIFELEGETGFRDREEKMIHELTLRGNVVLATGGGA
FT                   VMRPANRDALRSRGIVIYLRANPHDLWLRTRKDKNRPLLQTEDPKARLEALYEVRDPLY
FT                   RECAHFVIETGRPSVNGLVNMVLMQLELAGIVAKPLQA"
FT   gene            319969..321048
FT                   /locus_tag="bglu_1g03040"
FT   CDS_pept        319969..321048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03040"
FT                   /product="3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27505"
FT                   /db_xref="GOA:C5A9K4"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9K4"
FT                   /protein_id="ACR27505.1"
FT                   /translation="MITVNVDLGDCAYPIHIGDGLIGRTELFAPHIKGAAVTVVTNTTV
FT                   DPLYGDALRAALAPLGKQVDTVVLPDGESYKQWETLNLIFDGLLGSRADRRTTLVALGG
FT                   GVVGDMTGFAAACYMRGVPFIQVPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPQAV
FT                   IADIGVLRTLPARELAAGIAEVIKTGAIADSAFFDWIEANVEALNRRDPAALAEAVRRS
FT                   CEIKASVVAADEREGGLRAILNFGHTFGHAIEAGLGYGEWLHGEAVGCGMVMAADLSVR
FT                   VGRLDDAARQRLNRVIAAAHLPVRAPDLGAGRYLELMQVDKKAEAGAIKFILLDRIGAS
FT                   SITSAPDEAVRATLEAAIR"
FT   gene            321088..322398
FT                   /locus_tag="bglu_1g03050"
FT   CDS_pept        321088..322398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03050"
FT                   /product="Deoxyguanosinetriphosphate triphosphohydrolase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27506"
FT                   /db_xref="GOA:C5A9K5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9K5"
FT                   /protein_id="ACR27506.1"
FT                   /translation="MSETPRELPHPIDDRRAAAAPSGPRPAPPAAPASPGPAVCPATPA
FT                   ERGGRASGPVAAPTVAALEAHLAPYAAHASRTRGRRHPESPPAARTEFQRDRDRIVHST
FT                   AFRRLEYKTQVFVNHEGDLFRTRLTHSLEVAQIARSVARNLRLNEDLVEAISLAHDLGH
FT                   TPFGHAGQDALNACMREHGGFEHNLQSLAVVDELEQHYGAFDGLNLCFETREGILKHCS
FT                   RENARRLGALGERFLEGRQPSLEAQIANIADEIAYNNHDVDDGLRSGLISFEQLAGVAL
FT                   WRRHYDAALADFPSIEGRRLVHETVRRIINTLIVDLIDATTRNLTEHAPASLDDVRRCP
FT                   PLVAHSAVIAAEAAELKRFLFQNLYRHYKVMRMANKAQRVIKGLFDAFTGDSRLLPPAY
FT                   QHADPALQARLVAHYIAGMTDRFALKEYQRLFVMDEN"
FT   gene            322494..323819
FT                   /locus_tag="bglu_1g03060"
FT   CDS_pept        322494..323819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03060"
FT                   /product="glycerol-3-phosphate transporter periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27507"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9K6"
FT                   /protein_id="ACR27507.1"
FT                   /translation="MRVNTVVRSLAAGGAIWFGMQGAAFAATEIQFWHAMEAALGDKVN
FT                   AIAEQFNASQSDYRIVPVFKGTYDQALAAGIAAYRSGNAPAILQVYEVGTATMMQAKKA
FT                   VLPVSEVFRQAGVPLDEKAFVPTVASYYSDAKTGHLMSMPFNSSTPLLYYNKDWFKKAG
FT                   LDPNQPPKTWAEVKTDAEKLRRAGATCGYTTGWQGWIQIENYSAWHGLPVATRNNGFDG
FT                   TDAVLEFNKPQQVAHIQFLQQMARDGTYTYAGRKDEATGKFYSGDCAIMTTSSGALATI
FT                   RKYAKFDFGTGMMPYDDNVKGAPQNALIGGASLWVLGGKDANTYKGVAKFLAYLSSPAV
FT                   AAKWHQDTGYLPVTTAAYDLTREQGFYARNPGADTAIKQMLNKPPLPFTKGLRLGNMPQ
FT                   IRTIVDEELEQVWAQKKTPQAALDSAVARGNELLRRFEKQGS"
FT   gene            323880..324776
FT                   /locus_tag="bglu_1g03070"
FT   CDS_pept        323880..324776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03070"
FT                   /product="glycerol-3-phosphate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27508"
FT                   /db_xref="GOA:C5A9K7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9K7"
FT                   /protein_id="ACR27508.1"
FT                   /translation="MSSRTRSRSRFGAGLLPYLLVAPQLAITAVFFLWPAGVALWQSTQ
FT                   SQDAFGTTSEFVGFANFAHLFGDPLYLDSLRTTLVFSGLVTVIGLAVSLLLAACADRVV
FT                   RGSRTYRTLLIWPYAVAPTVAAVLWAFLFNPSIGVITYALARLGIVWNHALDADQAMAL
FT                   VVIASVWKQVSYNFLFFYAGLQAIPRSLIEAAALDGAGPARRFVDIALPLLSPTSFFLL
FT                   IVNLVYAFFDTFPVIDAATAGGPGQSTKTLIYKIFTEGFQGLDIGSSGAQSVVLMVIVV
FT                   ALTVVQFRFVERRVQYA"
FT   gene            324773..325618
FT                   /locus_tag="bglu_1g03080"
FT   CDS_pept        324773..325618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03080"
FT                   /product="glycerol-3-phosphate transporter membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27509"
FT                   /db_xref="GOA:C5A9K8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9K8"
FT                   /protein_id="ACR27509.1"
FT                   /translation="MIENRKGFDRFCHAVLIAGAALLLFPVYVGFCAATMSSAEVFTVP
FT                   MSLVPSTHLFENIATIWHRGSGATTAPFGVLLMNSLVMALAIAFGKIAVSILSAYAIVY
FT                   FRFPLRNAAFWVIFVTLMLPVEVRIFPTVQVVSTLGMTNGYAGLTLPLMASATATFLFR
FT                   QFFMTLPDELMDAARIDGAGPLRFFWDVVLPLSHTSIAALFVITFIYGWNQYLWPILIT
FT                   TDGAMSTAVVGIKTMIASGDAATEWHLVMAATLLTMLPPLVVVLAMQRWFVRGLVDTEK
FT                   "
FT   gene            325646..326731
FT                   /locus_tag="bglu_1g03090"
FT   CDS_pept        325646..326731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03090"
FT                   /product="glycerol-3-phosphate transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27510"
FT                   /db_xref="GOA:C5A9K9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9K9"
FT                   /protein_id="ACR27510.1"
FT                   /translation="MAALSLNGVRKTYDGKHAVLHGIDVEIADGEFVVLVGPSGCGKST
FT                   LLRMIAGLESISEGEIAIGGQVVNTLEPKDRDIAMVFQNYALYPHMTVAQNMGYGLKIR
FT                   GIERAVIEQRVASAARILELEPLLARRPRELSGGQRQRVAMGRAIVREPAVFLFDEPLS
FT                   NLDAKLRVQMRLEIQRLHGRLRTTSVYVTHDQIEAMTLAQRVIVMNLGRAEQIGAPVDV
FT                   YEKPATVFVAGFIGSPAMNLLRGRLSADGALFEVNDGGPRLPVAGAAGIGREVAPGREW
FT                   VLGVRPEHMTPQPGMPVAPLVVDSCELLGADNLVHGRWGPYDLAVRLPYAERPARGTAL
FT                   AVSLPAHRLHFFDPVTGRRAN"
FT   gene            326799..327578
FT                   /locus_tag="bglu_1g03100"
FT   CDS_pept        326799..327578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03100"
FT                   /product="cytoplasmic glycerophosphodiester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27511"
FT                   /db_xref="GOA:C5A9L0"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9L0"
FT                   /protein_id="ACR27511.1"
FT                   /translation="MSDTHAPIGWPYAGLARIVAHRGGGRLAPENTLAALEEGARRGHR
FT                   MVEFDAKLSADGVSFLLHDDTVERTSNGRGAAAAMAYRELAALDAGAWFDARFAGERMP
FT                   TLEQAAARCLALGLAANVEIKPCPGREAETGERVACDAARLWHDAAVPPLLSSFSVAAL
FT                   AAARAAAPALPRGLLVETLPADWRALTAELGCVSLHASHLALDAASVAAIRAAGLHVLA
FT                   YTVNEPARASELLDWGVDLICTDRIDSIGPQFAKSGE"
FT   gene            complement(327724..328455)
FT                   /locus_tag="bglu_1g03110"
FT   CDS_pept        complement(327724..328455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03110"
FT                   /product="Outer membrane protein, OmpW family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27512"
FT                   /db_xref="GOA:C5A9L1"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9L1"
FT                   /protein_id="ACR27512.1"
FT                   /translation="MKQQLAITGAVALALLTAGTTAQAQSAGSFYVTTGWFHLAPQDSS
FT                   DPLKVMSVGGTPVNRSVANTGAGISDADTLGITTGYFVTDHIAAEFVYGIPPKFNLNGK
FT                   GSLSPFGTLGHAYQWSPAVLLKYYFNSAEAKFRPYVGVGASYIYFTGAKLTNRTFENNV
FT                   LGGPTNVTTSNQWAPVFNAGFNYNFTKHWFAGVSISYIPVSLTATLTTQRPTQVGTLTQ
FT                   TSQAHIKLNPIVSYVNIGYRF"
FT   gene            328648..329376
FT                   /locus_tag="bglu_1g03120"
FT   CDS_pept        328648..329376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03120"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27513"
FT                   /db_xref="GOA:C5A9L2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9L2"
FT                   /protein_id="ACR27513.1"
FT                   /translation="MARLARLYVPDQPQHVILRGLDQQPAFVDDQDYELFIDCLKAAAR
FT                   DHQLAVHAYVLLPRQVQLLVTPSDEASLPKAMQAVGRRYVAHFNRRYSRRGTLWEGRYR
FT                   ATVIEGERYFLLASRVVELSPVRAQLAQTAEGYRWSSYRHHIGLTVDSLITDHPLYWAL
FT                   GNTPFERQRAYKELCEQPLDERQTEQLQQATLKGWVLGGETYREWAARTANRRVSPLPR
FT                   GRPRKVRENNGPHNPPAHQQ"
FT   gene            329646..334346
FT                   /locus_tag="bglu_1g03130"
FT   CDS_pept        329646..334346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03130"
FT                   /product="glutamate synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27514"
FT                   /db_xref="GOA:C5A9L3"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9L3"
FT                   /protein_id="ACR27514.1"
FT                   /translation="MNDHQEPHGAAPAAQGLYDPQNEHDACGVGFVAHIKGKRSHEIIE
FT                   QGLKILENLDHRGAVGADPLMGDGAGILIQIPDAFYREEMAKQGVTLPPAGEYGVGMIF
FT                   LPKENASRIACEQELERTVKAEGQVVLGWRDVPVDSSMPVSPTVKASEPLIRQIFIGRG
FT                   KDVIVTDALERKLYVIRKTASHRIQALKLKHGKEYFVPSMSARTIVYKGLLLAGQVGVY
FT                   YLDLQDARVVSALALVHQRFSTNTFPAWELAHPYRMIAHNGEINTVKGNVNWLNARTGA
FT                   IASHVLGDDLPKLWPLIYPGQSDTASFDNCLELLVMAGYPLVHAMMMMIPEAWEQHTLM
FT                   DDNRRAFYEYHAAMMEPWDGPAAIAFTDGRQIGATLDRNGLRPARYIVTDDDLVIMASE
FT                   AGTLPIPESKIVKKWRLQPGKMFLIDMEHGRIIDDKELKDNLANAKPYKSWIDAVRIKL
FT                   DEIDPKDEDVAAERRAAASLLDRQQAFGYTQEDLKFLMAPMAQQGEEAVGSMGNDSPLA
FT                   VMSNKNKTLYHYFKQLFAQVTNPPIDPIRENMVMSLVSFIGPKPNLLDTQNVNPPMRLE
FT                   VSQPVLDFKDIAKIRSIDRYTGGKFSAYELSICYPASWGKEGIEARLASLCAEAADAVK
FT                   SGYNILIVSDRKTDAETVAIPALLATSAIHSHLVDQGLRTSTGLVVETGSARETHHFAL
FT                   LAGYGAEAVHPYLAMETLAKMAEGLPGELSAEKAIYNFTKAVGKGLYKVMSKMGISTYM
FT                   SYTGAQIFEAVGLASELVNKYFKGTASKVGGIGLFEVAEEALRLHRDAFGDNPLLRDML
FT                   DAGGEYAFRVRGEDHMWTPDSIAKLQHATRSNSYQTYKEYAHLINDQTRRHMTFRGLFE
FT                   FKVDPSKAISIDEVEPAKEIVKRFATGAMSLGSISTEAHATLAVAMNRIGGKSNTGEGG
FT                   EDVNRYHNELRGIPIKSGETLRSVIGEEVVRDIPLKDGDSLRSKIKQVASGRFGVSAEY
FT                   LSSADQIQIKMAQGAKPGEGGQLPGHKVTEYIGKLRYAVPGVGLISPPPHHDIYSIEDL
FT                   AQLIHDLKNVNPASSISVKLVSEVGVGTVAAGVAKAKADHVVIAGHDGGTGASPLSSLK
FT                   HAGTPWELGLAETQQTLVLNGLRGRIRVQADGQMKTGRDVAIGALLGADEFGFATAPLV
FT                   VQGCIMMRKCHLNTCPVGVATQDPVLRAKFSGQPEHVVNYFFFVAEEVREIMAQLGIAK
FT                   FDDLIGRADLLDTRKGVEHWKAKGLDFTRVFYQPRVENASTRHVDVQDHGLERALDHTL
FT                   IEKARAAIDNGEHVSFIQPVRNVNRTVGAMLSGVIAKKHGREGLADDAIHIQLKGTAGQ
FT                   SFGAFLAKGVTLDLVGDGNDYVGKGLSGGRIIIRPTNDFRGKSEENIICGNTVMYGALE
FT                   GEAFFRGVAGERFCVRNSGATAVVEGTGDHGCEYMTGGTVVVLGETGRNFAAGMSGGLA
FT                   YVYDPDGTFAAKCNKAMVALDPVLQQAEQERTVDRAIWHAGQTDEALLKGLVERHFQFT
FT                   GSPRAKSLLENWDAARRQFVKVFPHEYKRALGEIAAAKAAKEAVAA"
FT   gene            334451..335917
FT                   /locus_tag="bglu_1g03140"
FT   CDS_pept        334451..335917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03140"
FT                   /product="glutamate synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27515"
FT                   /db_xref="GOA:C5A9L4"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9L4"
FT                   /protein_id="ACR27515.1"
FT                   /translation="MGKATGFLEFERRHEAYEAPLTRVKHYKEFVAALSDDDAKIQGAR
FT                   CMDCGIPFCNNGCPVNNIIPDFNDLVYRQDWQQAIEVLHSTNNFPEFTGRICPAPCEAA
FT                   CTLGINNDPVGIKSIEHAIIDKAWAEGWVKPLPAEHKTGKKVAVVGSGPAGLAAAQQLA
FT                   RAGHEVTVFEKNDRIGGLLRYGIPDFKLEKWLIDRRMRQMEAEGVTFRTSVFIGKEALP
FT                   DMIGNMAKETISPEQLKETFDAVVIAGGSETPRDLPVPGRELEGVHFAMDFLPQQNRVN
FT                   AGDKLADQLLAKGKHVVVIGGGDTGSDCVGTSNRHGAKSVTQFELLPQPPETENKPLVW
FT                   PYWPIKLRTSSSHEEGCERDWAVATKRLEGKNGKVEKLIAVRVEWKDGKMVEVAGSEFE
FT                   MKADLVLLAMGFTQPAAPVLDAFGVAKDARGNARAATEGERAYTTSVDKVFAAGDMRRG
FT                   QSLVVWAIREGRQCARAVDAFLMGHSELPR"
FT   gene            complement(336008..337756)
FT                   /locus_tag="bglu_1g03150"
FT   CDS_pept        complement(336008..337756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03150"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27516"
FT                   /db_xref="GOA:C5A9L5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9L5"
FT                   /protein_id="ACR27516.1"
FT                   /translation="MTAPSPVARAANVPSPDDIRVSAWSLIKPYWVSSEWKIAWSLLLS
FT                   IIAMNLANVWISVRINAWYADFNNALQQKHAAQFPHLLLVFAGLAFASIILFVYSRYLR
FT                   QLLGFRWRQWVTNSALDEWFGDRAFYRIERDRLADNPDQRITNDLNALATTTLALSLDL
FT                   LSTVVTLFSFITILWGLAGALSIPLGGSTIQIPGYMVWAAALYALVGSFVMHKAGHPLV
FT                   SINYQQERVEADFRFGLIRIRENAEQIAFYDGMALEKQGAQDLFQRIRDNWWRLMAYTR
FT                   RLNFVLNFYGQLAMIFPLMVAAPRYFAGAFSFGVLMQITNAFGTVSDSFSWFINSYGTL
FT                   VEWRATINRLREFMRVTRSSHLKETLSPATEHGGINLHYVDAPSLTTRGLRLALPDGTP
FT                   LSSIADVTIEPGSRWLVRGPSGAGKSTLMRALAGLWPFGNGAIDAPVGARMMFVPQQSY
FT                   LPIGSLKAALTYPSPAARFDDETCRAALRDCGLAEYATRLDEAAHWTRVLSPGEQQRLA
FT                   GARVLLHKPDYLFLDEATSALDADNEANLYSLMAARLPGAAIVSIAHREALAAFHDRRL
FT                   DVRRTA"
FT   gene            338474..339640
FT                   /locus_tag="bglu_1g03160"
FT   CDS_pept        338474..339640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03160"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27517"
FT                   /db_xref="GOA:C5A9L6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9L6"
FT                   /protein_id="ACR27517.1"
FT                   /translation="MSAAATRADVAVLGGGLVGRLIAWRLAGAGLRVTLYERGDAAGSG
FT                   AAAWVAAAMLAPLAEAASAELLITELGAASLERWPAWLAELPEPVFFQRNGTLVVWHHA
FT                   DRAEAPLFERRVRANAPATLVDGGLVALAGEQVGAAEPALAGRFARALLLPREGQLDNR
FT                   QTLAALAAGLAARRVGMHWNTAVEAAPEPRAGLTIDCRGLGAKAALPALRGIRGEVARI
FT                   HAPGIGLARPVRLLHPRYPLYLAPKQDDLYVIGATEVEGEDLSPVSVRSALELLSAAFS
FT                   VHPGFGEARILELGSQCRPTLPDHRPAIVWSGGATLAVNGLYRHGFMIAPEVAQAAVEF
FT                   VHAWFGGEFGTGGGETGGAGEGRDALAAWRRAVRWPTLFQYQSDPVCA"
FT   gene            339669..339866
FT                   /locus_tag="bglu_1g03170"
FT   CDS_pept        339669..339866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03170"
FT                   /product="sulfur carrier protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27518"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9L7"
FT                   /protein_id="ACR27518.1"
FT                   /translation="MDIQINQQTLTLPDGATVADALAAYQARPPFAVAVNGAFVARAQH
FT                   AERTLAAGDRLDVVHPVAGG"
FT   gene            339915..340730
FT                   /locus_tag="bglu_1g03180"
FT   CDS_pept        339915..340730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03180"
FT                   /product="thiazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27519"
FT                   /db_xref="GOA:C5A9L8"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9L8"
FT                   /protein_id="ACR27519.1"
FT                   /translation="MTLRSPTDSLTLYGTVLQSRVLLGTSRYPSLQSLSDSIAASRPGM
FT                   VTVALRRQMNAGTAEAGFFDLLRRHEVPLLPNTAGCQTVAEAVSTAQMAREVFETDWIK
FT                   LELIGDDYTLQPDPVGLIEAAALLVKDGFKVLPYCTEDLVIGRRLLDAGCEALMPWGAP
FT                   IGTGKGVMNPYALRVLRERLPDVPLIVDAGLGVPSHACQVMEWGFDGVLLNTAVSQATH
FT                   PERMARAFAQAVEAGRDAWLAGPMDPRETAHASTPVVGMPFWHHDGGGQ"
FT   gene            340727..341824
FT                   /locus_tag="bglu_1g03190"
FT   CDS_pept        340727..341824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03190"
FT                   /product="Thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27520"
FT                   /db_xref="GOA:C5A9L9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9L9"
FT                   /protein_id="ACR27520.1"
FT                   /translation="MSTGFGDMFWPPVDDLAAAAERIRARLGEWPVRRAPMRICVAAPE
FT                   RAQPGDLLVVTSGDAEAGRAAEVIAAGGAALEIDERHATLTHAGARYALTAAAPLADDW
FT                   IAALAAFADCGFEAHDALVLALAWRDGDEAADGDPWPTDPARFPSIAAAPGAPEPAFAP
FT                   CPARLGLYPVVPSAEWVERVLDYGARTVQLRVKDAAPNALAAEIARAVAAGRRYPEARV
FT                   FINDHWRLAIEAGAYGVHLGQEDLQEAGLGAIAAAGLRLGLSSHGYYEMLVALRLRPSY
FT                   LALGPVFATATKAVAAPPQGLARLARYARFAGRRAPLVAIGGVTAASLPEVIAAGVGSV
FT                   AVVSAITQAADPRAAVGALAACFER"
FT   gene            342129..342947
FT                   /locus_tag="bglu_1g03200"
FT   CDS_pept        342129..342947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03200"
FT                   /product="ABC transporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27521"
FT                   /db_xref="GOA:C5A9M0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9M0"
FT                   /protein_id="ACR27521.1"
FT                   /translation="MSSPPESLLELRDVDFGYGDRLVLSNLNLRFGRGQVVAVMGGSGC
FT                   GKTTVLRLIGGLVRARRGQVLFDGADVGAQSRDGLYALRRKMGMLFQFGALFTDMSVFD
FT                   NVAFALREHTDLPEPLIRDLVLMKLNAVGLRGARDLMPSEVSGGMARRVALARAIALDP
FT                   QLIMYDEPFAGLDPISLGITANLIRTLNEALGATSILVTHDVPESFAIADYVYFLGNGG
FT                   VLAEGTPDELRASTEPSVRQFIDGVPDGPFRFHYTSPPLDADFGLGGGRR"
FT   gene            342944..343711
FT                   /locus_tag="bglu_1g03210"
FT   CDS_pept        342944..343711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03210"
FT                   /product="ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27522"
FT                   /db_xref="GOA:C5A9M1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9M1"
FT                   /protein_id="ACR27522.1"
FT                   /translation="MISAIGRFVLGGLERTGYATRLFVRLVLEFFPLLRRPRLVTKQIH
FT                   FLGNYSFVIIAVSGLFVGFVLGLQGYYTLNRYGAEQSLGLLVALSLVRELGPVVTALLY
FT                   AGRAGTSLTAEIGLMKAGEQLTALEMMAVDPIKTVIAPRMWAGIIAMPLLSAIFCAVGV
FT                   IGGYVVGVILIGVDPGAFWSQMQGGVDAWSDVGNGVLKSVVFGFAVTFVALYQGYEAKP
FT                   TPEGVSRATTRTVVYASLAVLGLDFLLTALMFS"
FT   gene            343728..344234
FT                   /locus_tag="bglu_1g03220"
FT   CDS_pept        343728..344234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03220"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27523"
FT                   /db_xref="GOA:C5A9M2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9M2"
FT                   /protein_id="ACR27523.1"
FT                   /translation="MTMKKTALDFWVGLFVLVGFLALLFLALKVGNMSSLSFQPTYPVK
FT                   MRFDNIGGLKPRAAVKSAGVVVGRVGTIGFDTNTYQALVTIELDKQYAFPKDSSAKILT
FT                   SGLLGEQYIGLEPGGDTEMLKPGDTITMTQSAIVLENLIGQFLYSKAADAGGGKPAAAP
FT                   GAAAH"
FT   gene            344299..345285
FT                   /locus_tag="bglu_1g03230"
FT   CDS_pept        344299..345285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03230"
FT                   /product="VacJ-like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27524"
FT                   /db_xref="GOA:C5A9M3"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9M3"
FT                   /protein_id="ACR27524.1"
FT                   /translation="MQTMRLRNAGLTVAAVAALSGCATVQTPTKGDPFESFNRTIYKFN
FT                   DTVDTYALKPVAQGYQWAVPQPVRSSVTNFFSNIGDVYIAANNLVQLRIADGVGDIMRV
FT                   VINTVFGVGGLFDVATVAKLPKHSNDFGITLGHYGVPSGPYVVLPFLGPSTVRDTAGLG
FT                   VDYVGNPLTWVNSDAVSWSLFGVNLINTRANLLGAGDILDAAAIDKYSFVRNAYLQRRQ
FT                   SLIAASGGPGGKAAAANVPDYGAEALPKYDLPEDGAAPAAAASSTAAGGAAAGAAAPAQ
FT                   DAASAASAPAAASAAAMPNPASATHVPAQNIVPPSPNGFHWPSLRLR"
FT   gene            345393..346019
FT                   /locus_tag="bglu_1g03240"
FT   CDS_pept        345393..346019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03240"
FT                   /product="toluene tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27525"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9M4"
FT                   /protein_id="ACR27525.1"
FT                   /translation="MKKLFLIPVVAAFFSFGSAAYAQVDQSNPQALIKTATEQVMNEVR
FT                   TQSIKPGDIGRITDIVNRDILPYTDFRRTTQLVMGRNWRAATPDQRDKVVEQFKMLLIR
FT                   TYSGAIAQLKADQQIQYLPFRADPGATDVVVRTLASNNGQPVQIDYRLYKTPQGWRVYD
FT                   LNVLGAWLIQTYQQQFNEKIQQSGVDGLIQFLTQRNEQLAAGKAS"
FT   gene            346016..346285
FT                   /locus_tag="bglu_1g03250"
FT   CDS_pept        346016..346285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03250"
FT                   /product="anti-anti-sigma regulatory factor"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27526"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9M5"
FT                   /protein_id="ACR27526.1"
FT                   /translation="MSQFATGASLTYASAKAALDDGLGRIAGGATAVDCAALAQFDSAA
FT                   LAVLLAWQRAARSRGAALAILNLPPTLASLARAYGIDSLLDERH"
FT   gene            346452..347393
FT                   /locus_tag="bglu_1g03260"
FT   CDS_pept        346452..347393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03260"
FT                   /product="Putative ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27527"
FT                   /db_xref="GOA:C5A9M6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9M6"
FT                   /protein_id="ACR27527.1"
FT                   /translation="MPRSVMSAIEIRNVKKRYASLQALKGVSLSVEEGEFFGLLGPNGA
FT                   GKTTLISILAGLARADEGRISVRGHDVVADFRDARRALGVVPQELVFDPFFSVRETLRL
FT                   QSGYFGLRRNDDWIDEVMANLDLSDKADANMRALSGGMKRRVLVAQALVHRPPVIVLDE
FT                   PTAGVDVELRQTLWKFISRLNREGHTIVLTTHYLEEAEALCDRIAMLRRGEVVALERTS
FT                   ALLQRFAGLQLYLRLAQGELPAELRALQTEPAAPGSREYLLRLTSYDEVERILSACRAA
FT                   GCAFDEIEVRKADLEDVFVQVMNGADVIEGLA"
FT   gene            347390..348145
FT                   /locus_tag="bglu_1g03270"
FT   CDS_pept        347390..348145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03270"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27528"
FT                   /db_xref="GOA:C5A9M7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9M7"
FT                   /protein_id="ACR27528.1"
FT                   /translation="MSGFRTLFYKEILRFWKVSFQTVLAPVVTALLYLTIFGHALSGRV
FT                   EVYPGVEYVSFLVPGLVMMSVLQNAFANSSSSLIQSKITGNLVFVLLPPLSYAEIFSAY
FT                   VLAAVVRGLAVGLGVFVVTAWFIPVGFAAPLFALLFALLGSAILGTLGLIAGIWAEKFD
FT                   QLAAFQNFLIMPLTFLSGVFYSTHSLPPMWREVSRLNPFFYMIDGFRYGFFGVADINPY
FT                   ASLAIVAGFFVLLALVAMRLLATGYKLRH"
FT   gene            348169..348408
FT                   /locus_tag="bglu_1g03280"
FT   CDS_pept        348169..348408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03280"
FT                   /product="BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27529"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9M8"
FT                   /protein_id="ACR27529.1"
FT                   /translation="MLPTPEQVKQYIAGGLACTHLEVEGDGQHFFATIVSEQFEGKRPI
FT                   QRHQLVYAALGDRMKQEIHALSMKTLTPAEWQNA"
FT   gene            348425..349771
FT                   /locus_tag="bglu_1g03290"
FT   CDS_pept        348425..349771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03290"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27530"
FT                   /db_xref="GOA:C5A9M9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9M9"
FT                   /protein_id="ACR27530.1"
FT                   /translation="MQVSVNERDAVSHVATANPSAGRVSQGQPERLVITGGRRLSGEIR
FT                   VSGAKNAALPILCAGLLSAEPLRLDNVPDLQDVRTMLALLGGMGVKSAVDGARVTLDAA
FT                   SVTDPVAPYELVKTMRASILVLGPLLARFGYAKVSLPGGCAIGARPVDQHIKGLQAMGA
FT                   EITIEHGYIEARATRLKGARLVTDMITVTGTENLLMAATLADGETVIENAAREPEVTDL
FT                   ANLLVAMGARIDGIGTDRLVIQGVERLHGASHAVVPDRIEAGTFLCAAAAAGGELTLRG
FT                   MRANLLDAVLGKLRETGAKLDERDDALRVTMDRRPAAVAIRTSEYPAFPTDMQAQFMTL
FT                   NAVAAGTAHVVETIFENRFMHVQELNRLGADIVVDGNTALVTGVTQLSGARVMATDLRA
FT                   SASLVIAGLCADGETVIDRIYHLDRGYDRMETKLNAVGADVRRITGSAA"
FT   gene            349768..350424
FT                   /locus_tag="bglu_1g03300"
FT   CDS_pept        349768..350424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03300"
FT                   /product="ATP phosphoribosyltransferase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27531"
FT                   /db_xref="GOA:C5A9N0"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9N0"
FT                   /protein_id="ACR27531.1"
FT                   /translation="MTAPLTLALSKGRIFEETVPLLAAAGIEVAGDPESSRKLILPTND
FT                   PNVRVIIVRATDVPTYVEYGAADFGVAGKDVLIEHGGGGLYQPIDLSIARCRMSVAVQA
FT                   GFDYANAVRQGARLRVATKYVSTAREHFAAKGVHVDLIKLYGSMELAPLVGLADAIVDL
FT                   VSSGGTLRANNLVEVEEIMPISSRLVVNQAALKLKRAALKPILDAFERASKQSGS"
FT   gene            350465..351790
FT                   /locus_tag="bglu_1g03310"
FT   CDS_pept        350465..351790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03310"
FT                   /product="Histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27532"
FT                   /db_xref="GOA:C5A9N1"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9N1"
FT                   /protein_id="ACR27532.1"
FT                   /translation="MPIKIRKLDSRSEGFGAALRAVLAFEASEDEAIERSVAGILADVK
FT                   VRGDAAVLDYTNRFDRLGAPSVAALELRQDALEAALETLEPKRRAALEAAAARVRGYHE
FT                   KQKLECGSHSWQYTESDGTVLGQKVLPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVG
FT                   EIVMVVPTPDGVKNDLVLAAAYLGGVDRVFTIGGAQAVAALAYGTETVPAVDKICGPGN
FT                   AYVASAKRRVFGTVGIDMIAGPSEILVLCDGTTDPHWVAMDLFSQAEHDELAQSILLCP
FT                   DAGFIERVEKAIDELLPAMPREAVIRASLEGRGALITVRDMAEACKIANEIAPEHLEIS
FT                   ALEPQQWGKLIRHAGAIFLGRYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRS
FT                   SLIEVSADGAHTLGEIASELAYGEGLQAHAKSAEYRMRNHGN"
FT   gene            351941..353011
FT                   /locus_tag="bglu_1g03320"
FT   CDS_pept        351941..353011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03320"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27533"
FT                   /db_xref="GOA:C5A9N2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9N2"
FT                   /protein_id="ACR27533.1"
FT                   /translation="MTTPQDIIRPDVLAMTSYPVPDAAGLVKLDAMESPYGLPAPLAAG
FT                   LGERLAQLALNRYPPPRPAALIAKLRAAMGIPDGCEVLLGNGSDEIIGMLAVACARPGA
FT                   KVLMPVPGFVMVEQYARLAQMAFVGVPLRADMSLDVDALLAAIAEHRPALIHLAYPNNP
FT                   TGTLYAEADIERVIAAARTSLVVIDEAYQPFAERSWLARVPEFDNVVVMRTVSKLGLAG
FT                   VRFGYLVGAPAWLAEIDKVRPPYNVNLLTQGCIDYLLDHLDVLDAQAAQLRAERGRLAA
FT                   AVAALPGATVFPSAGNFLLVRVPDACALFDALLIERVLIKNVSKMHPLLANCVRLTVGS
FT                   PEENAALLAALRLVLR"
FT   gene            353087..353674
FT                   /locus_tag="bglu_1g03330"
FT   CDS_pept        353087..353674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03330"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27534"
FT                   /db_xref="GOA:C5A9N3"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9N3"
FT                   /protein_id="ACR27534.1"
FT                   /translation="MRVAEVVRDTSETQIRVKINLDGTGQQKLATGVPFLDHMLDQIAR
FT                   HGLIDLDIEAHGDTHIDDHHTVEDVGITLGQAVAKAIGERKGIRRYGHAYVPLDEALSR
FT                   VVIDFSGRPGLEFHVPFTRARIGTFDVDLSIEFFRGFVNHAGVTLHIDNLRGINAHHQL
FT                   ETVFKAFGRALRMAAEIDERAAGQIPSTKGSL"
FT   gene            353772..354392
FT                   /locus_tag="bglu_1g03340"
FT   CDS_pept        353772..354392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03340"
FT                   /product="MarC membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27535"
FT                   /db_xref="GOA:C5A9N4"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9N4"
FT                   /protein_id="ACR27535.1"
FT                   /translation="MDLLKSFISLLALINPLGAVPFFLSLTAALTDAERRRTVRIAAVS
FT                   VFCVIAVTTLLGQQIIRFFGISVGSLEVGGGIIMLLMAINMLNAQMGNTRSTPEERDEA
FT                   ESKHSIAVVPLAIPLLTGPGSISTVIVYSAGAVHWYDRIGLIAIGAVLALLCFLAMRLA
FT                   EPIANWIGRTGINIATRLMGLMLSALAVEFIVDGLKALLPALK"
FT   gene            354389..355030
FT                   /locus_tag="bglu_1g03350"
FT   CDS_pept        354389..355030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03350"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   HisH"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27536"
FT                   /db_xref="GOA:C5A9N5"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9N5"
FT                   /protein_id="ACR27536.1"
FT                   /translation="MKTSIAIVDYGMGNLRSVAQALMKAEPEAQVAIVDRPEAIRAADR
FT                   VVLPGQGAMPDCMRCLGESGLQEALLEASRSKPLLGVCVGEQMLFDWSEEGATPGLGLL
FT                   PGKALRFDLAGRVQDDGSRFKVPQMGWNRVRQTLAHPLWAGVPDQAFFYFVHSYYVVPD
FT                   DAAHAAGETSYGEPFVSAVARDNIFATQFHPEKSAEVGLRLYRNFVHWQP"
FT   gene            355195..355950
FT                   /locus_tag="bglu_1g03360"
FT   CDS_pept        355195..355950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03360"
FT                   /product="Phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27537"
FT                   /db_xref="GOA:C5A9N6"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9N6"
FT                   /protein_id="ACR27537.1"
FT                   /translation="MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGAR
FT                   RLHLVDLNGAFAGKPKNLEAIEAILAEVGDEIPVQLGGGIRSLETIEKYLDAGLSYVII
FT                   GTAAVKDPGFLQDACTAFAGSIIVGLDAKDGKVATDGWSKLTGHEVIDLAQKFEDYGVE
FT                   SIVYTDIGRDGMLQGINIEATVKLAQAVGIPVIASGGLSNLSDIEQLCGVEDEGIEGVI
FT                   CGRAIYSGDLDFSAAQKRADELNGELDDA"
FT   gene            356035..356808
FT                   /locus_tag="bglu_1g03370"
FT   CDS_pept        356035..356808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03370"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27538"
FT                   /db_xref="GOA:C5A9N7"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9N7"
FT                   /protein_id="ACR27538.1"
FT                   /translation="MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGA
FT                   DELTFLDITATSDQRDLILPIIEAVASQVFIPLTVGGGVRAVEDVRRLLNAGADKISMN
FT                   SSAVANPQLVADAAGKYGSQCIVVAIDAKRVSAEGETPRWEVFTHGGRKATGLDAIAWA
FT                   RRMAELGAGEILLTSMDRDGTKSGFDLALTRGVSDAVPVPVIASGGVGSLEHLADGIVE
FT                   GHADAVLAASIFHYGEHTVGEAKRFMAGRGIPVRL"
FT   gene            356811..357230
FT                   /locus_tag="bglu_1g03380"
FT   CDS_pept        356811..357230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03380"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27539"
FT                   /db_xref="GOA:C5A9N8"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9N8"
FT                   /protein_id="ACR27539.1"
FT                   /translation="MTTTQAAARPAWLDKVRWDANGLVPVIAQEVGTNDVLMFAWMNRE
FT                   ALAKTVETGRAVYYSRSRQRLWFKGEESGHVQHVHEVRLDCDEDVVLLKIDQVSGIACH
FT                   TGRHSCFFQKFEGTAEGGDWVAVEPVLKDPEHIYK"
FT   gene            357227..357592
FT                   /locus_tag="bglu_1g03390"
FT   CDS_pept        357227..357592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03390"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27540"
FT                   /db_xref="GOA:C5A9N9"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9N9"
FT                   /protein_id="ACR27540.1"
FT                   /translation="MTQTTNDTLLRLAAVIDSRKGGDPEQSYVSRLFHKGDDAVLKKIG
FT                   EEATEVVLAAKDVRQGGAPAALVGEVADLWFHCLVMLSHFELSPADVLAELERREGLSG
FT                   LEEKALRKRRERENGDG"
FT   gene            357639..358055
FT                   /locus_tag="bglu_1g03400"
FT   CDS_pept        357639..358055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03400"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27541"
FT                   /db_xref="GOA:C5A9P0"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9P0"
FT                   /protein_id="ACR27541.1"
FT                   /translation="MEDPSWRPGGASVPDRYPAYPGAAAAGSRDGSLRTLTHVLYALYA
FT                   VHWLTGGITGLIAIIINYVKRPDVVGTRYQQHFEWQIRTFWRALILYLIGIMLSFVVIG
FT                   FFVLGAAWVWTLYRIIKGWLFLNDDKALDPRAWF"
FT   gene            358087..358452
FT                   /locus_tag="bglu_1g03410"
FT   CDS_pept        358087..358452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03410"
FT                   /product="HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27542"
FT                   /db_xref="GOA:C5A9P1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9P1"
FT                   /protein_id="ACR27542.1"
FT                   /translation="MSHDPDCLFCKIAAGEIPSEMVHQDDEFVAFRDIRPAAATHVLVI
FT                   PRRHLPTLSAATLEDAPLLGRMLVLVARLAEQLGCAYTGGETGFRTVINTGPGGGQEVF
FT                   HLHAHLLAGPRPWKRMG"
FT   gene            358575..358808
FT                   /locus_tag="bglu_1g03420"
FT   CDS_pept        358575..358808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03420"
FT                   /product="Twin argininte translocase protein A"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27543"
FT                   /db_xref="GOA:C5A9P2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9P2"
FT                   /protein_id="ACR27543.1"
FT                   /translation="MGGLSIWHWLIVLLIVALVFGTKKLRNIGSDLGGAVKGFKDGMKE
FT                   SETPADAQQLPRSGSVNVDAKEAARSSDSNKA"
FT   gene            358835..359377
FT                   /locus_tag="bglu_1g03430"
FT   CDS_pept        358835..359377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03430"
FT                   /product="sec-independent translocase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27544"
FT                   /db_xref="GOA:C5A9P3"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9P3"
FT                   /protein_id="ACR27544.1"
FT                   /translation="MLDLGLSKMALIGVVALVVLGPERLPRVARTAGALFGRAQRYIND
FT                   VKAEVSREIELDALRTMRTDFESAARNVENTIHDNLRQHEADLNDAWSSAVSGEAASPV
FT                   AVSADGAAGAGSMSWQGSGTAASAGFTPKRRNWRVRQAATPVWYKRASLRRTHLQSGAA
FT                   RVARHRPASLRRPVRFF"
FT   gene            359431..360213
FT                   /locus_tag="bglu_1g03440"
FT   CDS_pept        359431..360213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03440"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27545"
FT                   /db_xref="GOA:C5A9P4"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9P4"
FT                   /protein_id="ACR27545.1"
FT                   /translation="MSDPQHNPDEGREETFISHLVELRDRLIRAGGAVLVVFVGLVYWA
FT                   PDIFRLLARPLMQNLPKDGKMIVTDVTGSFFVPMKVTMLVALVIALPIVLYQIWAFVAP
FT                   GLYQHEKRLVLPLVSSSYFLFLCGMAFAYFVVFPTIFRVMAHYNAPLGAEMSTDIDNYV
FT                   SFVLGMFLAFGVTFEVPVIVVLLVRMGVLPLKKLKEIRPYVIVGAFVVSAVVTPPDVFS
FT                   QLMLALPLVVLYEVGLLAARIFVGTGAAVKDEESGATG"
FT   gene            complement(360527..361732)
FT                   /locus_tag="bglu_1g03450"
FT   CDS_pept        complement(360527..361732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03450"
FT                   /product="Trypsin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27546"
FT                   /db_xref="GOA:C5A9P5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9P5"
FT                   /protein_id="ACR27546.1"
FT                   /translation="MLRRFWLFFAQAVTVLLALMFIVATLKPQWLQRQGQLGKQLAAPI
FT                   VALREVTPGVAGAPAQTSYADAAQKAMPAVVNVFSSKDGSLPPDPRAKDPLFRYFFGDR
FT                   NPRRQQEEPASNLGSGVIVSPEGYILTNQHVVDGADQIEVALADGRTATAKVIGSDPET
FT                   DLAVLKINLTNLPTITLGRSDRARVGDVVLAIGNPFGVGQTVTMGIISALGRNHLGINT
FT                   FENFIQTDAPINPGNSGGALVDVNGNLLGINTAIYSRSGGSLGIGFAIPVSTARTVLES
FT                   IITTGTVTRGWIGVEPQDVTPEIADSFGLAQKTGAIVAGVLQGGPADKAGIKPGDILTT
FT                   VNDEPITDTTKLLNVVAQIKPGTPTKVQVVRKTRTFDVTVVIGKRPPPPKQANDDQNDD
FT                   AE"
FT   gene            361754..362500
FT                   /locus_tag="bglu_1g03460"
FT   CDS_pept        361754..362500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03460"
FT                   /product="NIF3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27547"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9P6"
FT                   /protein_id="ACR27547.1"
FT                   /translation="MDRIELELYLNNTLETARFKDYCPNGLQVEGRRRIERIATGVTAS
FT                   AAFLERAIEWGADAVLVHHGYFWRNEPAQVTGRKYQRLKLLIGAELNLFAFHLPLDAHP
FT                   DFGNNAQLGERLGLIADAHFGEQDLGWMARLPMPVSLEHFTAKIEHTLGRTPLVLGDSD
FT                   QQLRRVAWCTGGAQSYFDAAIEAGADVFLTGEASEFVTHAAAESGVAFVAAGHHATERY
FT                   GIQALGRHLSEHFGLEHTFIDIPNPV"
FT   gene            362720..363340
FT                   /locus_tag="bglu_1g03470"
FT   CDS_pept        362720..363340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03470"
FT                   /product="Ubiquinol-cytochrome c reductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27548"
FT                   /db_xref="GOA:C5A9P7"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9P7"
FT                   /protein_id="ACR27548.1"
FT                   /translation="MRDKEEKRVDSGRRTWLIATSVASGVGGVATVIPFAASLAPSAKA
FT                   KAAGAPVEVDIGGLKPGEIVTVAWRGKPVWILNRTDAMLADVKKADPELADPQSKSTYS
FT                   MPLPAYCANEYRSRAEHKHILVVMAVCTHLGCTPTSRFTPGPQPNLPDDWPGGFLCPCH
FT                   GSTYDLAGRVFKNKPAPQNLDIPPYMFTSATTVVIGKDEKGEA"
FT   gene            363340..364722
FT                   /locus_tag="bglu_1g03480"
FT   CDS_pept        363340..364722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03480"
FT                   /product="Cytochrome b/b6"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27549"
FT                   /db_xref="GOA:C5A9P8"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9P8"
FT                   /protein_id="ACR27549.1"
FT                   /translation="MATDDKTVATTGLMGWIDARFPFTVTLKKHVTEYYAPKNFNFWYF
FT                   FGSLALLVLVNQIVTGIFLTMNYKPDATLAFASVEYIMREVPWGWLIRYMHSTGASMFF
FT                   IVVYLHMFRGLLYGSYRKPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVN
FT                   LFSAIPFIGPDLSLWIRGDYVVSDVTLNRFFAFHVIAIPLVLVGLVVAHLIALHETGSN
FT                   NPDGIEIKDKKDERGIPLDGIPFHPYYSVHDYFGVCVFLMIFALVVFFAPEMGGYFLEA
FT                   NNFVPANPLQTPPEIAPVWYFTAFYAMLRATTDPFKIVLMVVIAVLGLTALWRARGKWR
FT                   IGLPVLAAALIAFMALTESKFWGVVVMGGAVISLFFLPWLDRSPVKSIRYRPTFHKVFL
FT                   GMFVVAFLTLGFLGTQSPSPAKTLIAQVCALVYFAFFLGMPLWTPLGTFKQPPERVKFR
FT                   PH"
FT   gene            364745..365503
FT                   /locus_tag="bglu_1g03490"
FT   CDS_pept        364745..365503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03490"
FT                   /product="Cytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27550"
FT                   /db_xref="GOA:C5A9P9"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9P9"
FT                   /protein_id="ACR27550.1"
FT                   /translation="MRTLLKTFLLIGATSLALLGGTARAGEGNFPLDRAPDNAENLVAL
FT                   QHGAQLFVNYCLNCHSANLMRYNRLTDLGISQKEIEANLLFTTDKVGNTMSVAMRPDDA
FT                   KRWFGVAPPDLSVEARARGRDWLYTYLRSFYRDETRPTGWNNAVFENVSMPHVLWQLQG
FT                   QRVPKYEEATNEETGEKERKLVGFQTVTPGTLSPVDYDAAVADLVAYLGWMSEPEQQTR
FT                   KRVGVWVLLFLGILTFFAWRLNAAYWKDIK"
FT   gene            365600..366211
FT                   /locus_tag="bglu_1g03500"
FT   CDS_pept        365600..366211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03500"
FT                   /product="Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27551"
FT                   /db_xref="GOA:C5A9Q0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9Q0"
FT                   /protein_id="ACR27551.1"
FT                   /translation="MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMN
FT                   PYGQVPILVERDLILYESNIINEYIDERFPHPQLMPADPVQRARARLFLLNFEKELFVH
FT                   VSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLLWRL
FT                   DHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR"
FT   gene            366275..366793
FT                   /locus_tag="bglu_1g03510"
FT   CDS_pept        366275..366793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03510"
FT                   /product="ClpXP protease specificity-enhancing factor"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27552"
FT                   /db_xref="GOA:C5A9Q1"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9Q1"
FT                   /protein_id="ACR27552.1"
FT                   /translation="MQETSTKPYLLRALYEWCTDNGYTPHIAVRVDNSTRVPRQYVRDG
FT                   EIVLNISFEATTALQMGNDWIEFTARFAGKAHKLEVPVANVLAIYARENGQGMAFQVDL
FT                   AADEPGETTLVEADEAESGGAGGSRSAAGAAEPSEGADVPSGSAPPSPSPDDDGSSGKS
FT                   NRPRLKIVK"
FT   gene            366812..366887
FT                   /locus_tag="bglu_1gt09"
FT                   /note="tRNA-Thr2 anticodon TGT, Cove score 81.30"
FT   tRNA            366812..366887
FT                   /locus_tag="bglu_1gt09"
FT                   /product="tRNA-Thr"
FT   gene            367058..367939
FT                   /locus_tag="bglu_1g03530"
FT   CDS_pept        367058..367939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03530"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27553"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9Q2"
FT                   /protein_id="ACR27553.1"
FT                   /translation="MSSIIQLTLDGSLVRDQHQVSLRVLGRSMVSIQAAVDRAYLDVKY
FT                   GHVWKHARLPIAFYEDADFIVGDPEEGSYVLKFLSDQGEAIVKRLREAISDPYRKAVEG
FT                   GEQEIFAINRQIEARKNQVENKIIVPQSFQQFIAQPDQLVTRAYGDKSINKNIDQMLSP
FT                   VRKGDGAILKLALKPSYRERTETFVFTKAEALAFKTVIGQRQLGNPVVYRGKLRALDRG
FT                   HNQKTNFRGKFINAENDRDMFIFIQSEEDYSALVPYMDRDDFTIVACPIVEYESFDPMA
FT                   GDIQFVKILGDG"
FT   gene            367926..368627
FT                   /locus_tag="bglu_1g03540"
FT   CDS_pept        367926..368627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03540"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27554"
FT                   /db_xref="GOA:C5A9Q3"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9Q3"
FT                   /protein_id="ACR27554.1"
FT                   /translation="MAMADGALDKIKEQCLELVLNIIPMSQLGFVFVTAVVAQRLKDGH
FT                   GKSTFDALGGLGLKNMFGLSDGMFWSVNVLAIGACFFLALVNAYFLKKILRRSFDSSRI
FT                   SAKLDHWLKAALEAVKDLDKDDRAPIRESIKGELERRLKKYQAKRLLSEVLFSVCVFLG
FT                   YTSIYVFALCDYDFSKVTVSWAEIVVGMLSALCCFLSHRNSVSYALAKVVPLQVYLSAA
FT                   TGEISFFIDAD"
FT   gene            complement(368726..369745)
FT                   /locus_tag="bglu_1g03550"
FT   CDS_pept        complement(368726..369745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03550"
FT                   /product="Phage-related integrase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27555"
FT                   /db_xref="GOA:C5A9Q4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9Q4"
FT                   /protein_id="ACR27555.1"
FT                   /translation="MGRKPTKNLHLPPRMRIKQTSSGKTYYYYDIGGKPRRWKALGGDF
FT                   VEALRLYADLEQGDRTASTLVTFRHVAERYLVDVLPSKAVETRRTNLLQLEKLYSFFDS
FT                   PPAPLDEIKPIHIRKYLDWRKASPVSANREIALFSHIFNKAREWGATDRPNPCAGVRKH
FT                   REAGRDVYVGDQLYRRVWEKADIPLREAMDLAYLTGQRPADVLKMDERDIRDGVVTVRQ
FT                   NKTGARLRIEIVGELATLLDRIAARKIDHNPRSTRLIVDEQGRPLGQSALRFRFDRTRE
FT                   AAGIAKAEFQFRDLRAKAGTDKESASDLRGAQSLLGHGSVAMTEHYVRKRGTTTTPTR"
FT   gene            complement(369749..370042)
FT                   /locus_tag="bglu_1g03560"
FT   CDS_pept        complement(369749..370042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03560"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27556"
FT                   /db_xref="InterPro:IPR025319"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9Q5"
FT                   /protein_id="ACR27556.1"
FT                   /translation="MTGVRRTGTRSLGVFGYQLGRPKLSDMFLSPIELVVLTGRKIKSK
FT                   QIEALRRMGVPFLVNACGRAVVARSAIDGRSNSAGRTASVGRAIWNPTVLGR"
FT   gene            complement(369975..370754)
FT                   /locus_tag="bglu_1g03570"
FT   CDS_pept        complement(369975..370754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03570"
FT                   /product="putative bacteriophage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27557"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9Q6"
FT                   /protein_id="ACR27557.1"
FT                   /translation="MHDGSIGDFSAFRREWVVRGRNFGDGQVEITATRFDRYMGAQGLS
FT                   TLPRAKRGESKNTEQNLMDAAKRAKQQVRLRCKAIGADRMITLTYRENMVDKVRLKKDF
FT                   DALRRRLGRIQDFQYVAVAERQKRGAWHLHIAVKGRQNYRVLRSIWRHIVGEDNGNIDV
FT                   RNPFREKGLRHKLASYLSKYITKDFAEHALNEKRYWTSRGVEVPTQHPIAHLIFEGAVE
FT                   AIKTAFEAAGRVGATFDRCQTYWNEELGCFWLSTREA"
FT   gene            complement(371225..372574)
FT                   /locus_tag="bglu_1g03580"
FT   CDS_pept        complement(371225..372574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03580"
FT                   /product="Type II secretory pathway, component PulD"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27558"
FT                   /db_xref="GOA:C5A9Q7"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9Q7"
FT                   /protein_id="ACR27558.1"
FT                   /translation="MRRLAVVLWFFAGVSCAAGSPVPASMPGLPPLPSVAGLSTGAGQA
FT                   PLPAPPLVPLKIGDAKSVDLRFVNVAQVIDLVYADMLQSQYVISPDVLADTRLVSFRFD
FT                   RTKGDIRDVLGDFLSSLGFGVTARNGVDYVFKRKDDDQKEADKQVFVYSPKYRTADYLS
FT                   RLVQPLFSGQFTMNRAVPAAVGSRAKADAPPTSAAAMVDQSSDTMVFLSSAKEIALLKS
FT                   VLPQVDTKTGEVAIRAWVYEVSTENDRTTGFQLAASILGGKLGVSLGVGTVDESANALR
FT                   LHAGFLDAAIAALDSDSRFHVITSPNLRVESGKHGRLNVGQSVPVIDSVTYPNSSAAPL
FT                   QSVTYQDAGVIFDVQPTVKDDVIDTDVTVEISDFQRTSTGVNNSPTKNTRKVETSMTLR
FT                   DGEVVVMGGLSEGKDSIVTSGIRWLPSFMDGRSLSGSHSDIVLVLQVSRI"
FT   gene            complement(372571..373689)
FT                   /locus_tag="bglu_1g03590"
FT   CDS_pept        complement(372571..373689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03590"
FT                   /product="Zonular occludens toxin"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27559"
FT                   /db_xref="GOA:C5A9Q8"
FT                   /db_xref="InterPro:IPR008900"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9Q8"
FT                   /protein_id="ACR27559.1"
FT                   /translation="MAINVYSGVMGSGKSYEVVQGPLLDAIASGRRVVTNVDGINEDRI
FT                   HEFLVSKGRGDDTAFGSVVHVRTDEFLQPAFFPVEHESSEGATVTPGFVQPGDLVVVDE
FT                   AWKLWNSDKKISDEHMAFFRMHRHFTHAQTGVACDVVLMVQDIGDLHRKVKPVVELSFR
FT                   MHKLKSLGLSSGYRVEQYEGWKQNGRTRVATYVRKYSKQIFPLYKSYAGAGGKEAVVDK
FT                   RQNILNNKRLWALVAVLVVTPVVAGWFIYAFFHRVSHKPTAGAAVPAVASSPAVGAGAA
FT                   RASGAAVGGSKPSFSENWRIVGSYTAPGRSWVVLADSAGRLRMESPSMFQNTGVVRMGM
FT                   IDGEAVTTFSGTKPSNLGTGGAVSGGLVGVAK"
FT   gene            complement(373694..373987)
FT                   /locus_tag="bglu_1g03600"
FT   CDS_pept        complement(373694..373987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03600"
FT                   /product="Putative phage-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27560"
FT                   /db_xref="GOA:C5A9Q9"
FT                   /db_xref="InterPro:IPR019670"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9Q9"
FT                   /protein_id="ACR27560.1"
FT                   /translation="MFAILVSAANVALGFLLRSVIAKFFLYFGLYFFVTEAVSFLQSAN
FT                   VLPSAASLAGAFGSIGSDVWYFLDLCAFSYGAPLLVSAFVTHFIIRRLPIIG"
FT   gene            complement(373997..375640)
FT                   /locus_tag="bglu_1g03610"
FT   CDS_pept        complement(373997..375640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03610"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27561"
FT                   /db_xref="GOA:C5A9R0"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9R0"
FT                   /protein_id="ACR27561.1"
FT                   /translation="MVSRDVRFRHGLRVGSDRRIQGGVMRFRHAVLFVTLSCVVGAQMA
FT                   HAQALLAPVEDLVINRAEAAIISRVAISRGFAANDPRIAATLTGMGQVSTALNVVSTGA
FT                   AVGLGFAGAPVWLTIAAGVGILAAGSALYAGSVSLSRSQDGKTISATQPLPSLPTYSGT
FT                   AYQGTPPAAGTMQSPFVYGITSLGMQAYRTSACLATDASCAGFPSMPSLTTSGMNFVRN
FT                   FNTAVLVAGTIQDVQSFDLYEQQYNGAGGMVGGGTSTDSLGFDVVGVSVYWQANADNTN
FT                   ETLMESRTLTTWKTDANGNNYKSTDTGVQPVTWWAAGPGVAPVSGTDLSQIYPKLSSAS
FT                   LKTPLDPMTLAQLTNQTWQQAANQPGYQGLPYSVTQPISYSDVQPWAQANPSSVPDVGD
FT                   LFTPASDPGSSVSIDPAVQPGQSSSTSPASNPSTTTGNEVNVVNTPNVNVTNKVSVDLG
FT                   PDPGVGSPALEATPTISMILSPVLNLLPDLKHWSVPSHSSVCPEPSFTAFGHSFTLTAQ
FT                   CDLAESNRTSIYTAFAAMFTLAAMFIVLRA"
FT   gene            complement(375720..375953)
FT                   /locus_tag="bglu_1g03620"
FT   CDS_pept        complement(375720..375953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03620"
FT                   /product="Putative phage-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27562"
FT                   /db_xref="GOA:C5A9R1"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9R1"
FT                   /protein_id="ACR27562.1"
FT                   /translation="MKKKLEQFKKIAAHSIVVGAAAATFEAHAAGTDFSTLTSGIDFST
FT                   VTTGILAVAATLITVYVAIKGAKILIGMVRGA"
FT   gene            complement(375993..376175)
FT                   /locus_tag="bglu_1g03630"
FT   CDS_pept        complement(375993..376175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03630"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27563"
FT                   /db_xref="GOA:C5A9R2"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9R2"
FT                   /protein_id="ACR27563.1"
FT                   /translation="MTAMQAYVLVPSSASYIDAVAQPFDYAQAAGFWGVAFTTVITLWL
FT                   VSHGAGAIVNFVRRA"
FT   gene            complement(376296..376613)
FT                   /locus_tag="bglu_1g03640"
FT   CDS_pept        complement(376296..376613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03640"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27564"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9R3"
FT                   /protein_id="ACR27564.1"
FT                   /translation="MSSKQKLTILSINTRSGVSQKSGRPYTIREAQCILEQTVDGLQNV
FT                   VVGVINLPESLADRSAGEYLAEFALAQGNGQDAGRLVPRIISLLPYGLPRAQPKADAKA
FT                   A"
FT   gene            376730..377443
FT                   /locus_tag="bglu_1g03650"
FT   CDS_pept        376730..377443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03650"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27565"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9R4"
FT                   /protein_id="ACR27565.1"
FT                   /translation="MTHPDDVKSKDELPAYNIELRMRLLSQWITKGRNDWKQLEEATGI
FT                   KAVKWRHAQAGVTRPSLEMFEALCKLHPEHAFWLATGIADNEGGHKAPQVNLAFPGGFG
FT                   TIMPDDSLSTSAYFRQCMSALDTTWKALVQYMNRQRPKRNEAEDKAHVTKDDLVQSFRA
FT                   GINVSIQLAAGEANIALGKEQQKQLIDRLIGARWDHWQEMTQRLRENAGVDEMIDQGRQ
FT                   REKQLLDDLYKDNTR"
FT   gene            complement(377518..377988)
FT                   /locus_tag="bglu_1g03660"
FT   CDS_pept        complement(377518..377988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03660"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27566"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9R5"
FT                   /protein_id="ACR27566.1"
FT                   /translation="MHNTRDKLSLFLDFDGVLHPAEEIVRFGRTNILGNARLFVWLPVL
FT                   EHILKPYPEVDIIVSSSWRLKLDDQSLVRVLGDLGSRFVGVVDNWQESRADEIRAEVAR
FT                   RKLTKWLAVDDHPTVIVASRRDSRFIACHPDTGLGEQTVQAHLRAVLSEIYK"
FT   gene            complement(378341..379369)
FT                   /locus_tag="bglu_1g03670"
FT   CDS_pept        complement(378341..379369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03670"
FT                   /product="Phage integrase:Phage integrase, N-terminal
FT                   SAM-like"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27567"
FT                   /db_xref="GOA:C5A9R6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C5A9R6"
FT                   /protein_id="ACR27567.1"
FT                   /translation="MAGKAQTPGAIPRFRSRKNADGSLRYYYDHGEVDGRRILEPLGTD
FT                   RVVALQRWAELEGARAPSSETTRHTFAMLEQAYRIRELPQKSAATQRMYDLFLSRLAGV
FT                   IGDRELDTLTPADVATIWRATAEKRGVVTANRTKAVLSLVLNCGRLWGMMTIANPCAGV
FT                   RGKKETGRQAILIDDELYAAVYTVADQPLRNAMDLADLCAQRPSDVLRVQRSNIVRGNL
FT                   IFRTQKTGAFVTVQITGDLAALIERLLAWRGSKVDVSPYLLRDEEGYPLTKGKLRSRFD
FT                   KARERAGIDKAKFQFRDLRARGVTHKTIDEGLEAGQRLAGHSGPGMTARYVRGTRPVKP
FT                   SR"
FT   gene            complement(379369..379647)
FT                   /locus_tag="bglu_1g03680"
FT   CDS_pept        complement(379369..379647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03680"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27568"
FT                   /db_xref="InterPro:IPR025319"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA45"
FT                   /protein_id="ACR27568.1"
FT                   /translation="MKITMQEYSRRGSQRGTGAYLGRQELRELTGTPQRARQILWLARQ
FT                   GWPHVVDVHGRVLVARAYHDKQMGIAESKQVRAPQAAGLTSLNLGAV"
FT   gene            complement(379752..380300)
FT                   /locus_tag="bglu_1g03690"
FT   CDS_pept        complement(379752..380300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03690"
FT                   /product="Baseplate J family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27569"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA46"
FT                   /protein_id="ACR27569.1"
FT                   /translation="MRPPCGRTPSLILSGRVAALYSGFRCVRRCAQESAHVATRPPCCP
FT                   VPPVPPASRNGRATTPPLREGDRPDRFFHSERAGSAENSGIPGLFARKSLIVEKTPAPC
FT                   GITFAPIRADFAPSPIFAPAAVAPFSSLSNSLKKKKKEYEERQGIDSNAMPRVTPVLPS
FT                   IANTAYFLGPQLERGALYI"
FT   gene            complement(380315..383110)
FT                   /locus_tag="bglu_1g03700"
FT   CDS_pept        complement(380315..383110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03700"
FT                   /product="Zinc finger protein, CHC2-type"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27570"
FT                   /db_xref="GOA:C5AA47"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA47"
FT                   /protein_id="ACR27570.1"
FT                   /translation="MASIDELKQRIDLHDLADRLGLKRGRGGDRALYHSPQHDDKSPSL
FT                   SIYVNHPKHGTGWRDHSADAGGSCIDLVIHARGGTVADAVRYLHDTYGIPLDRQAPAER
FT                   REKTTVEYIADRCFAERDQARDYLVGRGISAAAIDAAIAARSLGFNTWTSSKVAAGEVG
FT                   HAGSAAAFIVRAPGDGRVVAVDMRYVDPALNGGVKTQTQGDKAGYGWTADPRRLDKAKR
FT                   VFIVESAINALSIDTCAMPGAAALALRGLANVDGIDFAFLRGKQVVICLDNDEPFADGH
FT                   PRAGRRPGPEAAWALYERLTALNISAVLVDQANWFADLADGEKAVKPINDVNDYLQLRG
FT                   PADLQRALDQLEPWLIAGLAGDATRRGRPRIFLPSHDFAQYWRFRVRPDFTSYITKMDK
FT                   NEESGVETPVMTDLCGFRIAGISRVSVASATSTMTGDADQAPTVYFAVSVQAPRHGAQL
FT                   VRRVMLDDQLHNVDQWGKFGPIWAPAPFKRMVNILERGADLGARQAANFVGLAWRDGRL
FT                   IVNEGPDCYFTEADKQCPYHNLTFPTGPASDARRVIAAYQATFKQNAATIPLVWALGGH
FT                   LKALLGFWPHITIQANKGAGKSTLIKRLERSLAFTMFSGQSLQTEFRLLTSISHTSHPV
FT                   GWEELSARRQDVIDKAVGLLQENYQYTVTRRGTDMTEYLLCAPVMLAGEDVPVRSLLGK
FT                   LVRTTLTGKRGPLMPDDLPRFPVRQWLEFLAGLDKRAVSDQYATLRDKALANCRASGED
FT                   DGAKRMAGNYAAVALAWRYLCEFAGMDPSEGDFPRDLLAEMNGHIAETSADREPWVWIM
FT                   ETALSEMDCGNYKHPYTFDTVDGEFCLLINTGHVMDHIAHTSALRDKWNGLPVKSDRVF
FT                   KAQLKHAGVIVGDKEVERRIYTRRVRYLTPISLERLAAFGLHVSIREDLATDALQGGAA
FT                   A"
FT   gene            complement(383113..383361)
FT                   /locus_tag="bglu_1g03710"
FT   CDS_pept        complement(383113..383361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03710"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27571"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA48"
FT                   /protein_id="ACR27571.1"
FT                   /translation="MTHSTTPHDAALAASIAAAADVLRFDHEAGSLQRIAALALFVSVL
FT                   GDRLALAFPASAGALRALVDSPATPGNPAALSLHQQH"
FT   gene            complement(383358..383720)
FT                   /locus_tag="bglu_1g03720"
FT   CDS_pept        complement(383358..383720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03720"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03720"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27572"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA49"
FT                   /protein_id="ACR27572.1"
FT                   /translation="MKHEPTIRYELLTPAGLRTVAGDHVVIPNDAGAAFGIHVEPHLRD
FT                   GHPEKWIVTHLASGIRIGHGATHDAARANASANVDRNRDRLRATLDQATTSRYELQHAV
FT                   QRLQQNHHDILGGTAA"
FT   gene            complement(383724..383918)
FT                   /locus_tag="bglu_1g03730"
FT   CDS_pept        complement(383724..383918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03730"
FT                   /product="putative phage-encoded membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27573"
FT                   /db_xref="GOA:C5AA50"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA50"
FT                   /protein_id="ACR27573.1"
FT                   /translation="MKPYVFGIGVLLMLSFSLYGVYCLAADVLRLFDVRNARAIAFVIG
FT                   VVAYAALVAAIVWSVPPRG"
FT   gene            complement(383964..384158)
FT                   /locus_tag="bglu_1g03740"
FT   CDS_pept        complement(383964..384158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03740"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27574"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA51"
FT                   /protein_id="ACR27574.1"
FT                   /translation="MRAPLTDLDLRAMWRRLRMVGNFDALCPAARHAFECTANVWRDRE
FT                   PAPELPAVDGKRRAANDFD"
FT   gene            complement(384163..384357)
FT                   /locus_tag="bglu_1g03750"
FT   CDS_pept        complement(384163..384357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03750"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03750"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27575"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA52"
FT                   /protein_id="ACR27575.1"
FT                   /translation="MQTLITTPIAALAQSLSYDERVAYLTKISAADVRADVFVASARAL
FT                   GFVVSWDLAHGTPVLEWMH"
FT   gene            complement(384446..384694)
FT                   /locus_tag="bglu_1g03760"
FT   CDS_pept        complement(384446..384694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03760"
FT                   /product="Phage transcriptional activator, Ogr/delta"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03760"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27576"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA53"
FT                   /protein_id="ACR27576.1"
FT                   /translation="MKLKCHHCGSRAVIRTSRTLSALVREAYCQCTNIECATTYKIHVA
FT                   TVHTIAPSLNPNPHVYVPIGKVDRLPTDSRQLPLLDA"
FT   gene            complement(384722..384913)
FT                   /locus_tag="bglu_1g03770"
FT   CDS_pept        complement(384722..384913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03770"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03770"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27577"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA54"
FT                   /protein_id="ACR27577.1"
FT                   /translation="MPELEITFTEQDAELLERVRQQEGLATLQQAAEWLVKRRLRLGTR
FT                   RLTGRDRALYVVHNSSRS"
FT   gene            385172..386686
FT                   /locus_tag="bglu_1g03780"
FT   CDS_pept        385172..386686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03780"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03780"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27578"
FT                   /db_xref="GOA:C5AA55"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA55"
FT                   /protein_id="ACR27578.1"
FT                   /translation="MITVGILAKIRRMYFREKVPLREIARRTGLSRNTVRRWLRQTDAV
FT                   EPKYPKRVSPSVIDDWAAQLTGWLRADSHRPKRDRRTARFMFEAIRAEGYAGSYGRVSA
FT                   FVRRWHEEQAEAPRRKAFVPLAFEPGEAFQFDWSCEYAFVGGLRRRLEVAHVKLNSSRA
FT                   FWLVAYPTQSHEMLFDAHARAFAAFGGVPRRGIYDNMKTAVDKVGRGKERAVNARFEAM
FT                   CSHYLFEPEFCNRAAGWEKGIVEKNVQDRRRQIWHEAALRRWETLEILNEWVAGQCREA
FT                   WQMRHPQWPELTVEDVLQDERIRLMPNPRPFDGYIEQTLRVSSTSLIHFQRNRYSVPTE
FT                   YTNQLVSVRCYPAYLSVVANAQEIARHERSFERHMTFYDWRHYVTLVERKPGALRNGAP
FT                   FITMPQPLQLLQRHLLKHPGGDRVMTQVLAAVREHGLDAVLLAVQAALDSGRPSAEHVL
FT                   NVLSRLKAPTTSTNLATTKLQLTEEPAADVSRYETLRANPPEDRHV"
FT   gene            386679..387476
FT                   /locus_tag="bglu_1g03790"
FT   CDS_pept        386679..387476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03790"
FT                   /product="IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03790"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27579"
FT                   /db_xref="GOA:C5A967"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C5A967"
FT                   /protein_id="ACR27579.1"
FT                   /translation="MSNDIAAQLKGLKLHGMASTWPELLAQSRHTEFNPERFMKQLLMA
FT                   ETAERQVRSIAYQMTAARFPAHRDLKGFDFAQAHVDEALVRELSELSFLASAHNVVFIG
FT                   GPGTGKTHLASAIGIEAVQRHGKRVRYFSTVELTNALEQEKSIGKQGQIAHKLMYVDLV
FT                   ILDELGYLPFSQTGGALLFHLLSKLYEHTSVAITTNLSFGEWASVFGDAKMTTALLDRV
FT                   THHCHIVETGNESWRFRTSSAKAKTTRKRAAKPAGNEELSTPE"
FT   gene            387549..388082
FT                   /pseudo
FT                   /locus_tag="bglu_1g03800"
FT                   /note="disrupted gene"
FT   gene            complement(388506..389768)
FT                   /locus_tag="bglu_1g03810"
FT   CDS_pept        complement(388506..389768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03810"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03810"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27580"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA57"
FT                   /protein_id="ACR27580.1"
FT                   /translation="MRATEVFTPGQTPTITLVRDHLAPREQTFKDAREQHLLITISGPS
FT                   KSGKTVFVREVVGADNLVPVTGTGVQSPDQLWLKVFHQIGTTIPTTKAAESNSSSAGGG
FT                   GAKGQFKLFGSGIELSGNVTETTGSKTVETVTAVGFDHLQLLIKELAGSGLVVFIDDFH
FT                   YIPRDVQKQVAEQIKDAIDKGVEIVCASVPYHSEDILRANPDLQGRFVAIDFDYWDMAT
FT                   LTQIAQRGFTELGLNVAPELMTSFAAEAAGSPQLMQSICLNACFQLDTRDTRTVPLDVP
FT                   LEKQFIKNVCSRTSSTDFSSTIEKLREGPKTRGTVRLNYRLADGDTADVYTIVLRALAA
FT                   DPPQLRFTYSQLLARIEAVCEDKTPSGSSTSGACLHISQLANDGQSKILIEWDSDDEIL
FT                   DIREPYLLFYMRWSDTIVRLN"
FT   gene            complement(390167..391003)
FT                   /locus_tag="bglu_1g03820"
FT   CDS_pept        complement(390167..391003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03820"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03820"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27581"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA58"
FT                   /protein_id="ACR27581.1"
FT                   /translation="MDTARCNTDGRVYTAPEFEALPANEIAHMRRSLVCVECNGPGFFR
FT                   RKSRSGQAACFGARPHAPSCTTPDTESRTLTGTPEDHEPLVNLGDHVEVDLTFGSRQVH
FT                   VVPPRDGDERPTPGDERRGRRFTGTAGRTAVSRRRPSSLLRMLVESENFRNSNTTISIP
FT                   DHIQGTPREVFVEFSEIEQDALVGQYRGYWGFVAEGKMDANSALWLNSGGTGDVSVLIP
FT                   PDLVGVLFERYGATDAEDFTGAYVLVFGYLRLSKRNKQFVRVEDVDTCVLYEPPVH"
FT   gene            complement(391355..391942)
FT                   /locus_tag="bglu_1g03830"
FT   CDS_pept        complement(391355..391942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03830"
FT                   /product="putative neutral zinc metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03830"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27582"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA59"
FT                   /protein_id="ACR27582.1"
FT                   /translation="MVVTGDQQFGSKGKRPRGYKVAGANSLQLRKTAETLIPFLQKEGC
FT                   FQRGEYFLDANHLLENVLQRAGYNYHVAEDAELTDTAAFTIPEEHLIVIKQEVYDGLAR
FT                   DDPFSRFTVVHEFSHIYLKHSVTLHRNATLGNHEWWEDSEWQANNLAAELMIPMGAVNQ
FT                   YGQQPLLLMAECGVSAPSVAHRLDNVAKRGWK"
FT   gene            395986..397173
FT                   /locus_tag="bglu_1g03840"
FT   CDS_pept        395986..397173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03840"
FT                   /product="Diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03840"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27583"
FT                   /db_xref="GOA:C5AA60"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA60"
FT                   /protein_id="ACR27583.1"
FT                   /translation="MSAITVALATTALFGLVMLVLLGSLVRTGAAGVREWFAANLMLSV
FT                   SLALLLARGRMPDIFTVVLGNGMLVLSGVTLYAGYARFLGLPPRWPWLALFTGLTLPAL
FT                   VYWHYMADSIPTRVGITTSYTAIVCIAIAVIVIRRYRTGQSRYPYVATAGLAALFAISQ
FT                   ILRGAYFMMLPGPVGAQAYLGTFNISLLCVGAAIMPVMSMCAIMMVHDSMQLAARRVID
FT                   HDFLTRALSRQRFEVVARARVRDAERDGTPLSLLLIDLDHFKSINDTYGHAGGDAVLRE
FT                   FAELMLQKLRGGDALGRLGGEEFAVLLPRTTLSDALRIADRLRDEVSRHTVETAAGLCS
FT                   YSTSGGLASRMPGETFEQMSARADRALYDAKVSGRNRVCAHAGMSQSAIAQFDSV"
FT   gene            complement(397352..398143)
FT                   /locus_tag="bglu_1g03850"
FT   CDS_pept        complement(397352..398143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03850"
FT                   /product="OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03850"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27584"
FT                   /db_xref="GOA:C5AA61"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA61"
FT                   /protein_id="ACR27584.1"
FT                   /translation="MSYAPSLFGGNTPPPSSAPHSASSTDASFQARSLLDLLYDGFFMM
FT                   FLLKNGREPGEANEFRGRIQEFLADFERGAKKLNVGADDVYAAKFAFCAAIDEAVLSSQ
FT                   FKVRAEWEQRPLQLVLFGEQLAGEKFFQYLEECRARGAARLQSLEVFHMCLLLGFQGKY
FT                   LLEGPEKLAYLTARIGDEIAQMKGKRAPFAPHWALPDQIAHRLKREVPLWAIGAVFALV
FT                   GLLAFIGLNTYLRDHTLKALAPYSQIIKVGPESANLTISLP"
FT   gene            complement(398140..399486)
FT                   /locus_tag="bglu_1g03860"
FT   CDS_pept        complement(398140..399486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03860"
FT                   /product="putative type VI secretion system protein TssK"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03860"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27585"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA62"
FT                   /protein_id="ACR27585.1"
FT                   /translation="MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESVQAIQPYNWGV
FT                   RSVKLDRDAISSNVLRLSELSLIFPDGALYSAPQADDLPPPVALDTLPEGINEFTFYLA
FT                   LHPLRETGSNYVEDADGGFTSRFTSENNPISDQFTDAAEADITFLKTNVKLIAHSEPRD
FT                   QLLAIPLVRVRRTATSGFEFDDTFVPPCLAIEASGILMQRLRQLIDALQAKVNALYGFH
FT                   REPTKNIIEFRSGDIASFWLLHTANAAFASLAHLYQHCALHPERLFQELLRLAGQLMTF
FT                   SKSYALADLPAYRHDDPGPPFARLDTMLRELLETVISTRYFAITLEEVRPSFHIGRLDS
FT                   GKIDDKTEFYLAVSADMASVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPP
FT                   AIPVRPGACYFALDARSPLYERMLQSQSAMIYAPSGINDLKFELIAVTS"
FT   gene            complement(399588..400205)
FT                   /locus_tag="bglu_1g03870"
FT   CDS_pept        complement(399588..400205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03870"
FT                   /product="putative type VI secretion system protein TssJ"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03870"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27586"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA63"
FT                   /protein_id="ACR27586.1"
FT                   /translation="MTPFLSRFALPLAACALLAGCAAAVPLLGSAGSAALQMVGIGKPD
FT                   VPDAQKPPRNLAVTLYAAPNLNAANDNRPLALVVRLYTLKDPTSFMQAPFDAFTDPAKE
FT                   KATLGADLLSVREVTLIPGQHYNATEKVSREAQAFGVVALFRSPALQRWKLAFDPAKSE
FT                   KSGIIIGLHNCAMTVTGGNVIAPQQGMPAQQLNMLSSVSCGG"
FT   gene            400575..401219
FT                   /locus_tag="bglu_1g03880"
FT   CDS_pept        400575..401219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03880"
FT                   /product="TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03880"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27587"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA64"
FT                   /protein_id="ACR27587.1"
FT                   /translation="MKDRLFAKLSVVVMACGVIAGCATQPSAPPTPEAFNKSLEDADAV
FT                   AKAGDQDKAIGLYQQLAKSDPTREEPWARIAQIQFQQGHYGQAIVAAQEALQRDNTDRQ
FT                   SKSVLAVAGLRIATESLSELRQDSSLAGDAKSDAQVLAKQLRDTLGEDALFPPEQADKP
FT                   QPKRRKVYRRHVAREAAPAAAAPAAEAPKPAAPAAPAAPAKGGADPFSALR"
FT   gene            401263..401802
FT                   /locus_tag="bglu_1g03890"
FT   CDS_pept        401263..401802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03890"
FT                   /product="putative type VI secretion system protein TssB"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03890"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27588"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA65"
FT                   /protein_id="ACR27588.1"
FT                   /translation="MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVGD
FT                   LAGQSEVEMPKLRDRKFVNIDRDNFDDVMKAIEPRAAYQVENKLSEDGGKFAVDLKFRS
FT                   LDDFDPDQVVNQIEPLRRLIEARSKLADLRNKMAGNDKLEDLLSEVLSNTQQLEALAKQ
FT                   SGEADGKPDDGKNSGE"
FT   gene            401817..403307
FT                   /locus_tag="bglu_1g03900"
FT   CDS_pept        401817..403307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03900"
FT                   /product="putative type VI secretion system protein TssC"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03900"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27589"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA66"
FT                   /protein_id="ACR27589.1"
FT                   /translation="MNQQTAAAQQSGALEGAETSLLDEIVEKSKVAKSQSEHARAKDLI
FT                   GELVHQVLDGTVIVSDNLSATIDARVAELDRLISAQMSAVMHAPEFQRLESTWRGLDYL
FT                   VSESNTGSTIKIKAMHAPKRELVRDFKAATEFDQSALFKKVYEEEFGTFGGAPFGALIG
FT                   DYEISRQPEDMYFIEQMSHVAAAAHAPFIASAAPELIGLESFADLGKPRDLGKVFDTVE
FT                   YAKWKSFRDSEDSRYVGLTLPRFLGRLPFHPKDGQIAESFNFVEDVDGTDHSKYLWCNA
FT                   AWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRR
FT                   EKELSDLGFIPLVHCKNSDYAAFFAAQSVQKPKKYNTDSANANAVLSAQLQYIFSVSRI
FT                   AHYLKAMMRDKIGSFASAQNVESFLNRWISQYVLLDDNATQEQKAQFPLREASVQVAEI
FT                   PGKPGSYRSVAFLRPHFQLDELSISLRLVADLPKSANS"
FT   gene            403385..403888
FT                   /locus_tag="bglu_1g03910"
FT   CDS_pept        403385..403888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03910"
FT                   /product="putative type VI secretion system protein TssD"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03910"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27590"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA67"
FT                   /protein_id="ACR27590.1"
FT                   /translation="MLDIYLNFGNPAIKGESQDKDHSGWIELKSWDWSVTQPRSATSST
FT                   SGGHTAERCEHSDMVFTKELDMASPLLYQHASGGTTFDEVSIDFMRSDGDGKRVKYLEI
FT                   KLKYVIISSVTPSVQKEGLPVEQFSLKYAAVQWKQTKQNIGGNQGGNTQGAWSLTKNDK
FT                   TYAV"
FT   gene            403965..404447
FT                   /locus_tag="bglu_1g03920"
FT   CDS_pept        403965..404447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03920"
FT                   /product="putative type VI secretion system protein TssE"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03920"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27591"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA68"
FT                   /protein_id="ACR27591.1"
FT                   /translation="MKRFEPSFLDKLFDDEPHLPASPAMRQLSLDELKNTVARDVESIL
FT                   NTRIALTDEDLAALPQCQQSVLTYGLNDFAGLSLASHYDRAFICKSIQQAIDRHEPRLR
FT                   QVAVSFELNEQSTNSLNFVIRGLLVVHPAQEPVSFDAMLQPSTLQYSVTRGRAAKT"
FT   gene            404540..406378
FT                   /locus_tag="bglu_1g03930"
FT   CDS_pept        404540..406378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03930"
FT                   /product="putative type VI secretion system protein TssF"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03930"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27592"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA69"
FT                   /protein_id="ACR27592.1"
FT                   /translation="MEELLPYYERELSFLRRYSHEFARRYPKIAARLAMTGEHCDDPHV
FT                   ERMIESFALLGARINKKLDDDYPEFTEALVDVLYPHYLRPFPSCTIAQFTPTPAISQLT
FT                   APHRVARGTELKSRAIRGVQCQFRTAYDVTIAPIRISEARYSSIAVAPAATVLPGNATG
FT                   VISITFESLAPQFDLGALGLDTLRAHLHGEQSFVAALADCLFINTLATYVEPERNGRWT
FT                   ALRRSPVTQAGFGEEDALIDYPARSHPAYRLLTEYFAFPDKFDFVDFDLAAMARRAGPC
FT                   HRLTLHVVLSDVRSDSHVARLLDMLSATHLRLFCTPVVNLFKQNGEPIRVDHQSVSYPV
FT                   IAEARRAFAYEVYSIDSVHLVRQTAHEEAVVEFRPFYSLHHGEAGHVGHYWFARRNEWV
FT                   AQHSPGYETELSIVDIDFEPAAPQTDTLSLRLTCTNRDLPAGLATGLAGGDLFADGGAD
FT                   FGDITMLRRPTASVRFARGRAAHWRLISHLALNHVSLVADGLAPLKELLTLYDLRRSAV
FT                   SMRHIDGLVAIEQRGSVQWLPGKPFATFVRGIEIRLTIDEEHFVGTSLAAFARMLDVFF
FT                   GLYVHLNSFVQLIVVSKRTGEEIMRCQPRSGESILA"
FT   gene            406342..407439
FT                   /locus_tag="bglu_1g03940"
FT   CDS_pept        406342..407439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03940"
FT                   /product="putative type VI secretion system protein TssG"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03940"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27593"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA70"
FT                   /protein_id="ACR27593.1"
FT                   /translation="MPTAKRRIDPGVVGQFLDEPYRFEFFQAVRLLETWFARRDPEKPD
FT                   ALRPGEIVERRLAFRNSLSLGFPPSEIEEAQSFDAAGEHVAEEARAAAIGSEAIDRVSI
FT                   MPAFFGLLGGQGALPHHYTEQVVAREHLKRDHAARAFFDVFSNRATALFYSAWKKYRLP
FT                   LHYELDRDERYLPLLLALAGVSHRGARRAMQEGTGAVIDEAIAGYALAARHRPVSAAYL
FT                   QRTLSDYFQVTIGVEQFVGKWYDVPPDQLSVLGEINATLGATALVGERVWQRDMRARLV
FT                   VGPLSKRDYEAFLPGGDCAVALERMLTLVAGVTLEYEVRLVLKRAEVGPTILNNGGRLG
FT                   WDAFLCTQEARHDRADARYELHVIH"
FT   gene            407505..410174
FT                   /locus_tag="bglu_1g03950"
FT   CDS_pept        407505..410174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03950"
FT                   /product="putative type VI secretion system protein TssH"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03950"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27594"
FT                   /db_xref="GOA:C5AA71"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA71"
FT                   /protein_id="ACR27594.1"
FT                   /translation="MSTPLKTLIAKLNPTCRKAAERAASQCLARGHYEVDLEHLFVALL
FT                   DETSGDMPVVLRASGVDPHALRRDLERELDTLKSGNTRTPVFSVHLSELFQQAWLIASL
FT                   DAQIGRIRSGHLLLALLSAPDLAQFAQRMSPQFAQVRVTDLKHKFDEITAGSHEAEPRG
FT                   AEAGHDGAPEAAALAGAAGGPSKTPALDTYTTNLTQRARDGKIDPVIGRDAEIRQAIDI
FT                   LMRRRQNNPIMTGEAGVGKTAVVEGLALRIAAADVPPPLAGVALHVLDMGLLQAGASVK
FT                   GEFENRLKSVIDEVKQSPHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTI
FT                   AATTWSEYKKYFEKDAALARRFQVVKIEEPSEPLAAAMLRGMAALMERHFNVRILDDAI
FT                   TEAVRLSHRYISGRQLPDKAISVLDTACAKVALAQSATPAAIDDLKKRLERTAAEIAAL
FT                   EREVAGGAAHDERLAALGAARDADLAALAAAEARYAEEQAIVAEIVALRAQIDASREAS
FT                   ADGERIDADAVRAQLAERVAALKAVQGGEPMVPLQVDAHVVAEIVAAWTGIPLGRMVKD
FT                   EIETVMNLKALLGARVIGQDHALDAVAQRVRTATAGLEDPNKPRGVFLFVGPSGVGKTE
FT                   TALALADVLYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYS
FT                   VVLLDEIEKAHPDVLEMFFQVFDKGVMDDAEGREIDFRNTLIILTSNVGSSAVMQACLN
FT                   QPAEALPDPDALAETLRPALYKAFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIARR
FT                   IEANHKARFEWDESLVDAVLARCTEVDSGARNVDHILNGTLLPEIAGHVLERLAEGSAI
FT                   ERIAVRASEAGEFEYTVK"
FT   gene            410265..411407
FT                   /locus_tag="bglu_1g03960"
FT   CDS_pept        410265..411407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03960"
FT                   /product="putative type VI secretion system protein TssA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03960"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27595"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA72"
FT                   /protein_id="ACR27595.1"
FT                   /translation="MPIHVNALLAPLSEASPCGDDLLFSSEFDAIQHARKFDDPSLDQG
FT                   EWVTEIKEADWGFVVDQSVALLGTRTKDLRLAVWLTEGLGIQEGVAGLTQGYELLAGLC
FT                   RTWWDAVHPLPEGDDLDYRLGNVGWLSGRTAELLRMVPLTDGSGSAYSALDWEVAQHVA
FT                   QAVRRDPDNAGEIARNKPTVEQIEASKRMTSVAFYAGLLANLSAFRAALDALDDELERR
FT                   AGNAAPSFRQAREAYDSVRMLAERFAKEQGYAPDAQPVAPPPPVVQGGPAERSEPSFKT
FT                   PFTPEPHPPMPTAQPVAVHVPAPTVIAGIHNRAQAVEQLRAVAKYFRATEPHSPVAYLA
FT                   DKAAEWADMPLHLWLESVVKDDGSLAHLRELLGVKRDDNA"
FT   gene            complement(411501..412568)
FT                   /locus_tag="bglu_1g03970"
FT   CDS_pept        complement(411501..412568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03970"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03970"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27596"
FT                   /db_xref="GOA:C5AA73"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA73"
FT                   /protein_id="ACR27596.1"
FT                   /translation="MTTSVLPPRRRQLAAALAAGAALCAGGLALLAAPAGAFADNAGPA
FT                   TVTRVDPSGAAVRSTALPPSGAPAQGPSGGLSAPPQAEGGTSQNGTVLTGTNVAGGTGA
FT                   GPVTGAGTGATVSVPPQASATPGQVVVGGKVPDEATKAAVLQKLRDTYGAGNVVDQIEV
FT                   GDVATPPNWSSNVQKLIGPQLKQISKGQLRIDGTSIDVKGEVRNEALRQQVASDMANQL
FT                   NPTYTIRNALRVSASEQGLLDQTLANRTIEFETGSATLTPQGRAILDQMAAAMSRMANR
FT                   SVAIIGHTDNSGNRASNIALSQARADAVKGYLVAKGIPSQQLSTTGVGPDQPIASNDTA
FT                   EGRARNRRIEFRAGQ"
FT   gene            complement(412573..413565)
FT                   /locus_tag="bglu_1g03980"
FT   CDS_pept        complement(412573..413565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03980"
FT                   /product="type VI secretion-associated protein, BMA_A0400
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03980"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27597"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA74"
FT                   /protein_id="ACR27597.1"
FT                   /translation="MTQTVQAQIAYFGKIPSRGDFVKSAHNPQLLQTLDRWIAQAMELL
FT                   ADDPRWKIVYENARPMHFAFIGTRSKLAIAGHMVASHDASNRRFPFLAATALEVDRPLT
FT                   FVARSPLAFARLWQRAATLMRPLLGSDEPPGALQALGEAQVPIDTGGPGSAHDGTFNDF
FT                   VEHQSLFGLEQMLLASGHPVKLRGAMLALGSLLRPVMQSGSSHIERGLTLPLPVDPFYR
FT                   SLVAAFWMELIAPFVSQADFELAIFIGSIAERERLIIGFNGASARTLHSVVDPQTYSQH
FT                   NIDIDDPEWVDAHAQHDPATSKLVSYLEQPQLSLRVAIDTFREAFVAGA"
FT   gene            complement(413562..417437)
FT                   /locus_tag="bglu_1g03990"
FT   CDS_pept        complement(413562..417437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g03990"
FT                   /product="type VI secretion protein IcmF"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g03990"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27598"
FT                   /db_xref="GOA:C5AA75"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA75"
FT                   /protein_id="ACR27598.1"
FT                   /translation="MQRILNVLTHPRTLSILGFIALAAILFIVADALQISFVWPIAILA
FT                   ALVVLWLLVKLVRRLRVKRANRKLGDMLEEQASVESPAAAAAPVEPAKQAELDTLRTRL
FT                   VDTVKTIKSSKIGQVSGGSALYELPWYIVIGNPAAGKSSAVINSGLQFPFADKNSAVIH
FT                   GIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKKHRPKAPINGIIVTAS
FT                   IAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSNSDRA
FT                   EYDRVWGATLPYEPDEKRDVVALFDERFEELYDGLKEISVAQLAISRGNILSPGQLSFP
FT                   LEFASIKPTLRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAARFALDG
FT                   TALPKPPSAFSKNGFFLRDLFSKVIFEDRKTVRQFASPAKTRMRYATFFAFVAALALAL
FT                   GGWTWSTIGNQQLVANVQADLDNIAKLEQNRNDLQSRLQAMDILEDRIEQLEQFRHDKP
FT                   IAVSLGLYQGDRLEEHLLTEYYNGVRQIMLAPVADNLAAFLKDVNAHPDQLAPMTRAPE
FT                   SGAVPVSDKTALASRAQGGLYNDASPTNVEDAYNALKTYLMLSDKRHVEQAHLTDQIAR
FT                   FWRGWLETNRGNMPRDEMIRSAERMITFYLSRVQDNDWPMIDANLALIDQTRENLRRVV
FT                   RGMPARQRVYEEIKARASTRYAPMTVARIVGDENASLVAGSYAIPGTFTRDAWFDYVQP
FT                   AIRDAATKELQAKDWVLNTASQDDLTLEGSPEQIQKVLVGMYKTEYAQHWQKFMQGIAV
FT                   QNFGSFGQAVDAMNRLGDPQDSPIRKILETAYEQTSWDNPSLASVTLKKAQTGVVGWVK
FT                   QWFSRQRGGQLAANIDINGNPVEVPMGPIGQEFIGLARIVQTHDGGQSMLKGYMESLSK
FT                   VRTRFNVIKNQGDPGPGARQLMQQTLDGNGSELADSLKYVDELMLTGLTDSQRRSLRPL
FT                   LVRPLMQAFAVVIQPASVEVNKVWNAQVYQPFQSSLANKYPFSPGAKVEAAASEIAQVF
FT                   GPDGSIAKFVGTTLGPLAVRRGDTLTARTWGDMGLALTPEFTNGFASWVAPLAGGAATS
FT                   SASSEPQTVFQILPQPSSGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPSGSPGATLSA
FT                   TTFDGRTLQLVNEPGRYGLEKLINSAQRTRRPDGTFDLTWTQGGVSVSVTMRIISTSQP
FT                   SGGGSGGDAPQQQSLRGMHLPSSVANTSASGAINATAQAPAATSGVSPAAAATGAAANA
FT                   SNAQGAQ"
FT   gene            complement(417703..418554)
FT                   /locus_tag="bglu_1g04000"
FT   CDS_pept        complement(417703..418554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04000"
FT                   /product="Peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysins"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04000"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27599"
FT                   /db_xref="GOA:C5AA76"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA76"
FT                   /protein_id="ACR27599.1"
FT                   /translation="MIAVVLIAYFAIAVLAAALFLLPGVRASLFGSVAQFHGRLSRRVS
FT                   DRAQRTRGHILKSAKISRNSLSDLQNLLIRRRLLIMGAAGILATPPLIAIALRGRQLFQ
FT                   YDDTIRVPDEKIAALLQGEQLVPPLPLPPEVFATREVEQIRPALKDASRDWNLLDPDFR
FT                   TRLLLVYKIMHEQYGYEMALLEGYRSPERQNRLAQMGTNVTNAAAYQSYHQFGLAADNA
FT                   FLRDGKLVISEKDPWAMRGYQLYGQVAEQVGLTWGGRWKMMDLGHVEFHKPGFKLGHPP
FT                   PQ"
FT   gene            418678..419637
FT                   /locus_tag="bglu_1g04010"
FT   CDS_pept        418678..419637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04010"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27600"
FT                   /db_xref="GOA:C5AA77"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA77"
FT                   /protein_id="ACR27600.1"
FT                   /translation="MSAPEDSNRKAPPSLLSNPGQKGGQNASRILANLEGRVSPQQSAE
FT                   SAKPSRSRKGPLAVIALAVVALAGWGAWRIQAQQGAAPAVTAAVPASAASAPAAVAAAS
FT                   GAAAAASGTQLAQAASTPQTATIVNEEPARADADADASGARGASGSRLSQALANGATDS
FT                   NAAGGAALAAAASKHEAAGEKPKTKAEKLADAKREKQEKQQERQELAAKKRHDRQLEAA
FT                   AKRHPATASQHRDDPDADLLAALVARTKPADPGPPPSAKPKKAVAKVAANEATLAARVK
FT                   ECGTRGFFEDQLCRWRVCDGHWGKDPACPNSANQNRQP"
FT   gene            420035..421057
FT                   /locus_tag="bglu_1g04020"
FT   CDS_pept        420035..421057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04020"
FT                   /product="Mg2+/Co2+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27601"
FT                   /db_xref="GOA:C5AA78"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA78"
FT                   /protein_id="ACR27601.1"
FT                   /translation="MIIPTYGADTSGMICAFRFAPDAAGVPVDAAGTGALLRPEAAGDS
FT                   NAPREFHWLHFNLAHGASERWMRANLGLPETFYEFLREGSHSTRIEQQDGVLRAVVNDV
FT                   MFSLDMEAAEVSTLWVYVDRRMMVTARLKPLRSVDTLRESVRQGERFRSPTELLIHLLR
FT                   DQADVMQHIVRRASVDVDRIEDRFLSQRPTANRDQLGSMRRTMTRLQRMLAPEPGSIFR
FT                   LLAKPPAWLLGADVQELRESTEEFSLVLADLAGLVERIKLLQEEITSRLDEQNNRTLFT
FT                   LTLVTVIALPINIIAGFFGMNVGGVPLAENKHGFWLMVLFVALFTALAAWWAFRRRGDR
FT                   "
FT   gene            complement(421130..421282)
FT                   /locus_tag="bglu_1g04030"
FT   CDS_pept        complement(421130..421282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04030"
FT                   /product="XapX domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27602"
FT                   /db_xref="GOA:C5AA79"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA79"
FT                   /protein_id="ACR27602.1"
FT                   /translation="MTDYAVSLGVGAGVGLLYGVLNVRSPAPPLVALVGLLGMVIGEAA
FT                   VRWLR"
FT   gene            complement(421324..422301)
FT                   /locus_tag="bglu_1g04040"
FT   CDS_pept        complement(421324..422301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04040"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27603"
FT                   /db_xref="GOA:C5AA80"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA80"
FT                   /protein_id="ACR27603.1"
FT                   /translation="MQRIVLTAAARDLDSLVAPLQDGPSPVTHDGQLLIDVHAAGVNPS
FT                   DVKAALGNMPHAVWPRTPGRDWAGVVRLGPPDWIGAQVWGSGGELGIRRDGSHAQQLLL
FT                   AIEQVRRKPAALTLDEAAGVGVPFITAHEGLRRAGMPQAGEVVLVFGANGKVGQAAIQL
FT                   ASARAAQVIGVERTAGSYRGHASGAVSMIDASAGDVAEAVRALTGGRGADLVYNTVGSP
FT                   YFAAANAAMATGARQIFISTIERSVPFDIFAFYRGQHTYVGVDSLALDGAACARILDEL
FT                   APAFEAGTLRPFPIAADHVYPLARARDAYRAVLGGTRERVLVRP"
FT   gene            422467..423390
FT                   /locus_tag="bglu_1g04050"
FT   CDS_pept        422467..423390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04050"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27604"
FT                   /db_xref="GOA:C5AA81"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA81"
FT                   /protein_id="ACR27604.1"
FT                   /translation="MEALFSPHLAVFVDVVELQSFSAAARRHDLAASSIARRIDQLEAQ
FT                   LGVRVLHRTTHAVRPTEAGQLLYDRAKALLAGIRGLHAELHRQRDEPGGLVRIDCPAPF
FT                   GRLHLMPAVAAFMRRHAAIVVELVLTDSMVDLPGERLGADVDLALRIGPVAATRFVATL
FT                   LAPQRRVLCASPAYLAARGTPASLDALARHDCLAWHGSPPPGAWRFGKQRHAPDAPRFR
FT                   SNHSEALLAAAVEGLGIAHLPTWLAGAALANGSLVALAIAGEAPALEDATIHLLRQQAG
FT                   GAARTLALVEFLREWFAQPPWERAAR"
FT   gene            423590..424075
FT                   /locus_tag="bglu_1g04060"
FT   CDS_pept        423590..424075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04060"
FT                   /product="water stress/hypersensitive response
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27605"
FT                   /db_xref="GOA:C5AA82"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA82"
FT                   /protein_id="ACR27605.1"
FT                   /translation="MPMQRRSAVRLLVFASLPLLTGGCAVLGRDPVRVGVVGLTPLAGQ
FT                   GLEMRFELKLRVQNPNDTPIDYDGLALDLELNGRPFASGVSDARGVVPRFGEVVIGVPI
FT                   TVTAFAAARQAFGFADAAAAGRIPYRLSGRLQAGVFGGVRFTDAGSLSLPAASGGAD"
FT   gene            424246..425379
FT                   /locus_tag="bglu_1g04070"
FT   CDS_pept        424246..425379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04070"
FT                   /product="Methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27606"
FT                   /db_xref="GOA:C5AA83"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA83"
FT                   /protein_id="ACR27606.1"
FT                   /translation="MTDYPTLQFHDANGVECALRWRSEAGLPPPKRVVIADDTTTADAA
FT                   YRLACEGTALVWQGDFQNARQLLQALARRVDRRAGRKGAPANPVDAFNLHRLAQSQRAR
FT                   TLGMLLIPLEADYSIALRRAPDLREACIEAYGPGGMPSVASLRELLGLIGAHEWRKKGV
FT                   AIPALGARIHPHYGVFSPVRGEYVELVARAPLPAATLAFDIGTGTGVLAAVLAERGVER
FT                   VVATDQDPRALACAAENLERLGYGARVELQRADLFPAGRAPLVVCNPPWVPARPGSPIE
FT                   SAVYDPDSRMLKGFLAGLAAHLTPGGEGWLVLSDFAEHLGLRTRAALLGWIEAAGLVVL
FT                   GRDDIRPVHPKSSDAADPLHRARSAELTSLWRLGARA"
FT   gene            425590..426453
FT                   /locus_tag="bglu_1g04080"
FT   CDS_pept        425590..426453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04080"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27607"
FT                   /db_xref="GOA:C5AA84"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA84"
FT                   /protein_id="ACR27607.1"
FT                   /translation="MSNKTYEVRPEQSVELLKELHILTRDGKMNQDSRRKLKQVYHLYQ
FT                   FIEPLLENVAADRGGVTLVDHGAGKSYLGFILYDLFFKSRPAANSHIYGIETREELVER
FT                   STALAARLGFGAMSFENLSVADSIRSPKLPETVDVVTALHACDTATDDAIRFALAKRAR
FT                   HIVLVPCCQAEVAGVLRRNKGKSLASALTEVWRHPLHTREFGSQITNVLRCLQLEAHGY
FT                   QVSVTELVGWEHSMKNELIIAQYKNLPRRKPAERLGEILAMFGLAELNERFFAPEASGQ
FT                   AAAAHG"
FT   gene            complement(426497..427078)
FT                   /locus_tag="bglu_1g04090"
FT   CDS_pept        complement(426497..427078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04090"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27608"
FT                   /db_xref="InterPro:IPR009858"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA85"
FT                   /protein_id="ACR27608.1"
FT                   /translation="MNDPHQDILAATRHWLTRAVIGLNLCPFAKGVHVKEQVRYAVSEA
FT                   ASLEDALDDLERELRALDAADPDAIDTTLLIYPRAFAEFAEFNDALQFADRLLRQLRLE
FT                   GTLQIASFHPQYQFDGTEADDIENYTNRAPYPILHLLREASIDRAVQAFPDAADIYERN
FT                   QATLRRLGHDGWRDWMAGGEPGPGTASTGA"
FT   gene            complement(427172..427786)
FT                   /locus_tag="bglu_1g04100"
FT   CDS_pept        complement(427172..427786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04100"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27609"
FT                   /db_xref="GOA:C5AA86"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA86"
FT                   /protein_id="ACR27609.1"
FT                   /translation="MPASPSQPARSRRSPTAAATAYTQLLDAAEALFYQEGVRAVGVEA
FT                   VVERAGVNKMSLYRQFASKDELVLAYLERKKANYFRRFDAAAARLPGDARAQLLQLVDD
FT                   LAQRARQPTYRGCPFINVAVEFPDAAHPARVSVAENKQELMQRLVALSTEAGARDPQLL
FT                   ADGLALVLEGIYAASQTYRAEHSPIGGAPQVVRMMIDAACA"
FT   gene            427951..429237
FT                   /locus_tag="bglu_1g04110"
FT   CDS_pept        427951..429237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04110"
FT                   /product="Transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27610"
FT                   /db_xref="GOA:C5AA87"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA87"
FT                   /protein_id="ACR27610.1"
FT                   /translation="MNWMMAAGARGRFHYGWIAAAVVFLVLLAAAGTRATPSVLMVPLE
FT                   HELGWSRATISLAISINIALYGLTGPFAAAAMQRFGLRPTVLAALAVMGTGVALSSMMT
FT                   ATWQMVLIWGVMVGSATGVAALTLSATFVNRWFVARRGLVMGMLTASSATGQLVFLPML
FT                   AAIAQHHGWRPVVLVVALALAVAVPLVIFLLPERPADLQLRPYGEPDNAPRLPEAAKQN
FT                   PLAAAFDALFDAARRRDFWLLFFSFFICGASTNGYIGSHLIAMCSDYGMSEVQGASLLA
FT                   AMGVFDLIGTTLSGWLSDRYDSRVLLFWYYGLRGLSLIYLPQAFGIDFFGLPLFAVFYG
FT                   LDWIATVPPTVRLATDIWGRERAPVVFGWIVAGHQLGAAFAALGAGLLRASLGTYTLAS
FT                   MISGGLCIVGAVIVLRIKRGRVRPVPQAA"
FT   gene            429390..429992
FT                   /locus_tag="bglu_1g04120"
FT   CDS_pept        429390..429992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04120"
FT                   /product="Nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27611"
FT                   /db_xref="GOA:C5AA88"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA88"
FT                   /protein_id="ACR27611.1"
FT                   /translation="MSVNSAPTAAPIHELLAGRWSPRAYSDQPVSAEHLHAVLEAARWA
FT                   PSAYNAQPWRFVVFDRSRDEAAFKKAFATLVPFNQGWNAPVPVLIAVTAHTLTSKGEPS
FT                   STALYDAGAAAMSLVLQAHALGLAAHQMSGFDPKAFREAFAVPADVEIIAMISLGHYGD
FT                   AEKLDPVLRDRERAPRTRHAIGEVIYQSGWKVPFAKR"
FT   gene            430235..431494
FT                   /locus_tag="bglu_1g04130"
FT   CDS_pept        430235..431494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04130"
FT                   /product="Molecular chaperone-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27612"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA89"
FT                   /protein_id="ACR27612.1"
FT                   /translation="MTYCAIDFGTSNSAVALPDPDHPGAMRLAPVEGDHLTLPTAIFFN
FT                   NDEGSREFGRTALASYIDGFDGRLMRSMKSILGSPLAETTTDLGDGSGIAYTEVIAIFM
FT                   QHLTRKAQACAGGVIERAVLGRPVFFVDDDPRADRLAEQQLAAAARSVGLKEVSFQYEP
FT                   IAAAFDYESRLSAESLVLVADIGGGTSDFSLVRVGPERMARLERKGDVLGHHGVHVAGT
FT                   DYDRRVELAAILPAFGYRSLDPEGRELPNRIYFDLATWHLINTVYTPKRLAELKLMKHL
FT                   YVDTRQFDRLVRVVEQRLGHALTARAEEAKIGVAAGGQTLIDLNDVEEDLQIAFDAARL
FT                   IEASADDTARIVEAARETVRLAGIAPREVGALYFTGGSTGLSFLSGALAAAFPDAEPVF
FT                   GDRLASVATGLGIHARRLFG"
FT   gene            complement(431736..431939)
FT                   /locus_tag="bglu_1g04140"
FT   CDS_pept        complement(431736..431939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04140"
FT                   /product="Cold shock-like protein CspD"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27613"
FT                   /db_xref="GOA:C5AA90"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA90"
FT                   /protein_id="ACR27613.1"
FT                   /translation="MATGTVKWFNDAKGFGFITPEGGGDDLFAHFSEIRVDGFKTLQEN
FT                   QKVEFEVKTGPKGLQAANIKPL"
FT   gene            432374..433972
FT                   /locus_tag="bglu_1g04150"
FT   CDS_pept        432374..433972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04150"
FT                   /product="Amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27614"
FT                   /db_xref="GOA:C5AA91"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA91"
FT                   /protein_id="ACR27614.1"
FT                   /translation="MNSSIQRNIGPIALMLTGLGSIIGSGWLFGAWKAAKIAGPAAICA
FT                   WIIGAVVILAIALTYAELGAMFPESGGMVRYARYSHGSLVGFISAWANWIAIVSVIPIE
FT                   AEASIQYMSTWPYQWAHNLFVDGSLTTPGLLLSALLVIVYFMLNYWGVKLFARANSAIT
FT                   VFKFLIPGLTILGLLLTSFHSDNLGMTTSDAFAPYGWSAVLTAVATSGIVFAFNGFQSP
FT                   VNLAGEARNPARSVPFAVITSILIALVIYVLLQVAYIGAVDPTEVAKGWKHFDFASPFA
FT                   ELAIALNLNWLAVLLYVDAFVSPSGTGTTYMATTTRMIYAMERNNTMPKMFGTVHPLYG
FT                   VPRNAMWFNLLVSFVFLFFFRGWSSLAAVISVATVISYLTGPISLMALRRAAQDLERPL
FT                   SIPGMKLIAPFAFVCASLILYWAKWPLTGEIILLMVVALPVYFYFQAKSGWSGWGRDLK
FT                   AAWWLVAYLPVMAILSLVGSKQFGGSGLLPYGWDMLIVALVSLGFYFWGVNTGYRTQYL
FT                   EERESHDEILDNVGA"
FT   gene            complement(434074..434865)
FT                   /locus_tag="bglu_1g04160"
FT   CDS_pept        complement(434074..434865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04160"
FT                   /product="Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27615"
FT                   /db_xref="GOA:C5AA92"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA92"
FT                   /protein_id="ACR27615.1"
FT                   /translation="MSRLPSLYLSHGAPTLPIDPSLPAPAFTQLGAELPRPRAVLMLSA
FT                   HWCTLAPAASIATRPDTIHDFHGFPRELYALRYPAPGAPELARQAAARLGGAGIAATTT
FT                   EYGLDHGAWVPMLLMFPEADIPVAQLSIQPRSDAAHHFRVGRALRSLRDEGVMVIGSGQ
FT                   ITHNLREADFGATPADADPRVDEFTSWFEERLARREIDSLLDYRRLAPHAQRMHPTDEH
FT                   LLPVFAALGAADDDYRLGIQALGTYQRVLAMTNYVFAPGAT"
FT   gene            complement(435043..435639)
FT                   /locus_tag="bglu_1g04170"
FT   CDS_pept        complement(435043..435639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04170"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27616"
FT                   /db_xref="GOA:C5AA93"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA93"
FT                   /protein_id="ACR27616.1"
FT                   /translation="MQARPAPPRRLIVAITGATGAIYGVRLLELLRAAGGVETHLLVSA
FT                   AGWLNIQHELKLSKDEVQARADVVHAVRDVGASIASGSFATDGMVIAPCSMKTLASVAH
FT                   GLSDNLIARAADVTLKERRRLVLMVRETPFNLAHLRNMTAVTEMGGVIFPPLPAFYALP
FT                   ASIDELVDHTVTRVIDMFGIGAARTAPWAGLAEAG"
FT   gene            complement(435647..435958)
FT                   /locus_tag="bglu_1g04180"
FT   CDS_pept        complement(435647..435958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04180"
FT                   /product="Glutaredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27617"
FT                   /db_xref="GOA:C5AA94"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA94"
FT                   /protein_id="ACR27617.1"
FT                   /translation="MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAIQVLKACGVD
FT                   QIKTVNVLEDEEIRQGIKSFSNWPTIPQLYVKGEFVGGSDIMMEMYQSGELQQLFAAA"
FT   gene            complement(436113..436961)
FT                   /locus_tag="bglu_1g04190"
FT   CDS_pept        complement(436113..436961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04190"
FT                   /product="HemK protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27618"
FT                   /db_xref="GOA:C5AA95"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA95"
FT                   /protein_id="ACR27618.1"
FT                   /translation="MNASPVTAAGLLRASPLDAVDARILLAHVLGWSRTQLITRADAPL
FT                   EAAAAERFRALEARRSAGEPVAQLVGSREFFGLAFEVTPDVLIPRPETELLVEAALDAL
FT                   DGIAAPAVLDLGTGSGAVALAIAAARPDARVTALDRSAAALAVARRNAARLLDDARPGG
FT                   AVSLLASDWYAALGPAARFHAIVSNPPYIARHDPHLDQGDLRFEPRGALTDEADGLAAI
FT                   RRIVAGAGAFLLPRGELWIEHGYDQAEAVRALLLQAGFREVASLADLASIERTTGGRRP
FT                   G"
FT   gene            complement(436982..438064)
FT                   /locus_tag="bglu_1g04200"
FT   CDS_pept        complement(436982..438064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04200"
FT                   /product="Peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27619"
FT                   /db_xref="GOA:C5AA96"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA96"
FT                   /protein_id="ACR27619.1"
FT                   /translation="MKTSMQSKLDQLSSRLAELNELLSRENVTADLDQYRKLTREHAEI
FT                   GPVVEQYAQWRLARGDEAAAQELLADASMREFAEEEIREARERMARLEAELQTMLLPKD
FT                   PNDDRNIFVEIRAGTGGDESALFAGDLLRMYLRYAERQRWQVEMMSESGSDLGGYKEVI
FT                   VRIAGHGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIAEVEINPADL
FT                   RIDTFRASGAGGQHINKTDSAVRITHLPTGIVVECQDDRSQHKNKDRALKVLAARIKDK
FT                   QYHEQHAREAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEAIMDGDLDEL
FT                   IASLASEHQAELLASLGEAD"
FT   gene            complement(438145..439431)
FT                   /locus_tag="bglu_1g04210"
FT   CDS_pept        complement(438145..439431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04210"
FT                   /product="Glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27620"
FT                   /db_xref="GOA:C5AA97"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA97"
FT                   /protein_id="ACR27620.1"
FT                   /translation="MQLLTIGINHHTAPVALRERVAFPLEQIKPALSTLKDVFLGRQAR
FT                   NAPEAAILSTCNRTELYCATDDRAARDAALRWLADFHRIPADELAPHVYALPQSEAVRH
FT                   AFRVASGLDSMVLGETQIVGQMKDAVRTASEAGALGTYLNQLFQRTFAVAKEVRSTTEI
FT                   GAQSVSMAAAAVRLAQRIFENVADQKVLFIGAGEMIELCATHFAAQTPRELVVANRTAE
FT                   RGAKLAERFGGHAMPLADLPARMHEFDIIVSCTASTLPIIGLGAVERAVKARRRRPIFM
FT                   VDLAVPRDIEQEVGKLKDVFLYTVDDLGAIVREGSASRQAAVAQAETIIETRVQHFMQW
FT                   LDTRSVVPIIRHMHTQADALRRTEVERAQKMLARGDDPLAVLDALSQALTNKLIHGPTS
FT                   ALNRTSGTERDQLIDLMRGFYAHGPRADN"
FT   gene            439120..439464
FT                   /pseudo
FT                   /locus_tag="bglu_1g04220"
FT                   /note="disrupted gene"
FT   gene            440042..440293
FT                   /locus_tag="bglu_1g04230"
FT   CDS_pept        440042..440293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04230"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27621"
FT                   /db_xref="GOA:C5AA99"
FT                   /db_xref="UniProtKB/TrEMBL:C5AA99"
FT                   /protein_id="ACR27621.1"
FT                   /translation="MNWPGIVVLGLAVGGLGWWLHPARTGRRGWRAALVAALAGAVVAR
FT                   LAGNLTGLFHDGGTLEWPVCAVTALVATTLTMGALARR"
FT   gene            440304..442130
FT                   /locus_tag="bglu_1g04240"
FT   CDS_pept        440304..442130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04240"
FT                   /product="Peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27622"
FT                   /db_xref="GOA:C5AAA0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAA0"
FT                   /protein_id="ACR27622.1"
FT                   /translation="MESNMNARHPDVSPVPARLALLRSAMAREGVAACLVPSADPHLSE
FT                   YLPEHWQSRRWLSGFTGSVGTLVVTADFAGLWVDSRYWVQAAAQLDGTGVQLMKMMGGQ
FT                   QTQPHVEWLAEHVPAGAAVSVDGAVLGVAAARALAAALAARGVVLRTDLDLLERIWPER
FT                   PALPAAPVFEHVAPHAQIARAAKLAQVREAMRAQGAGVHFISTLDDIAWLFNLRGADVS
FT                   YNPVFVAHALITADQATLFVVDGKLDAALQASLAADGVTVRAYETAAAALAALPAGSTL
FT                   LIDPRRVTFGSLQAVPDTVRLAEAVNPSTFAKSRKTPAEIAHVRETMARDGAALAEFFA
FT                   WFEAALGRETVTELTIDEQLNAARARQPGFVSPSFATIAGFNANGAMPHYRATPEAHAT
FT                   IEGDGLLLIDSGGQFVGGTTDITRVVPIGTPSEAQRRDFTIVLKAMIALSRARFPRGIR
FT                   SPMLDAIARAPMWAAGLDYGHGTGHGVGYFLNVHEGPQVIAHYAAADPQTAMEEGMITS
FT                   NEPGVYRPGQWGVRIENLVLNRAAGQTPFGDFLEFETLTLCPIDTRCVLAELLDAGERA
FT                   WLDDYHATVRERVGPLVTGAARAWLEARTRPL"
FT   gene            442160..442786
FT                   /locus_tag="bglu_1g04250"
FT   CDS_pept        442160..442786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04250"
FT                   /product="HAD-superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27623"
FT                   /db_xref="GOA:C5AAA1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAA1"
FT                   /protein_id="ACR27623.1"
FT                   /translation="MPAIRAVVFDFGGVLIDWNPEYLYRQLIPDAQARRRFLTEVCGMD
FT                   WVVRQDAGQTLADGTAEKVAAFPQHEALIRAFYARWPEMVAGQFDDGVALVERLDAAGV
FT                   PLFGLTNWSAETFPYAWQRYAVLRRFRDIVVSGRVKLAKPDPAIYREMFARIAAQLPGI
FT                   APGELVFIDDNPRNVQAAAALGWHGIRHTDAAATEARLRELGVPA"
FT   gene            complement(442871..444538)
FT                   /locus_tag="bglu_1g04260"
FT   CDS_pept        complement(442871..444538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04260"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27624"
FT                   /db_xref="GOA:C5AAA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAA2"
FT                   /protein_id="ACR27624.1"
FT                   /translation="MAQYVFTMNRVGKIVPPKRQILKDISLSFFPGAKIGLLGLNGSGK
FT                   STLIRIMAGVDKDIEGEATPMPNLNIGYLPQEPQLDPSKTVRETVEEGLGDVFSAQKKL
FT                   DEIYAAYAEPDADFDALAAEQAKYEAILAASDGGSPEQQIEIAADALRLPPWDAKIEHL
FT                   SGGEKRRVALCKLLLEKPDMLLLDEPTNHLDAESVEWLEQFLTRFPGTVVAVTHDRYFL
FT                   DNAAEWILELDRGHGIPWKGNYSSWLDQKEARLKQEEASESARQKAIKKELEWVRQNPK
FT                   GRQAKSKARIARFEELSSQEYQKRNETQEIFIPAGERLGNEVIEFKNVSKAYGDRLLID
FT                   NLSFKIPAGAIVGIIGPNGAGKSTLFRMLTGKEQPDSGEIIHGPTVKLAYVDQSRDALA
FT                   SEKTVFEEISGGADVLTVGKYETPSRAYIGRFNFKGGDQQKIVGNLSGGERGRLHLAKT
FT                   LIAGGNVLLLDEPSNDLDVETLRALEDALLEFAGSVMVISHDRWFLDRIATHILAFEGD
FT                   SQVVFFDGNYQEYEADKRARLGEEAAKPKRIRFKPISR"
FT   gene            complement(445063..446157)
FT                   /locus_tag="bglu_1g04270"
FT   CDS_pept        complement(445063..446157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04270"
FT                   /product="GTP-dependent nucleic acid-binding protein EngD"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27625"
FT                   /db_xref="GOA:C5AAA3"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAA3"
FT                   /protein_id="ACR27625.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTKAGIAAENYPFCTIEPNVGIVE
FT                   VPDARLKAISAIVKPERIVPAVVEFVDIAGLVAGASKGEGLGNQFLANIRETDAITHVV
FT                   RCFEDENVIHVAGRVSPLDDIEVINTELALADLATVEKALARYSKAAKSGNDKEAVKLA
FT                   AALEKVRAHLDQGKAVRGLELSDDERAILKPFCLITAKPAMYVANVKDDGFENNPHLDA
FT                   VRRYAEAEKSPVVAVCAAIEAEIADLDDADKEAFLADMGMDEPGLDRVIRAGFKLLGLQ
FT                   TYFTAGVKEVRAWTIHIGDTAPQAAGVIHTDFERGFIRAQTIGYDDYITYKGEQGAKEA
FT                   GKMRAEGKEYVVHDGDVMNFLFNV"
FT   gene            complement(446392..446757)
FT                   /locus_tag="bglu_1g04280"
FT   CDS_pept        complement(446392..446757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04280"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27626"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAA4"
FT                   /protein_id="ACR27626.1"
FT                   /translation="MSDVHHNLTHHDRVDLLCWLTVGNLGAFYLNESWPSAPFQVQAAH
FT                   KWLDRHLREADWLCIAKLAAVALDIAKKHASFVEAAWARDAVEEIIDSEDLDRQSRLVE
FT                   LVLDDCRAALADRRIAD"
FT   gene            complement(446888..447010)
FT                   /locus_tag="bglu_1g04290"
FT   CDS_pept        complement(446888..447010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04290"
FT                   /product="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27627"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAA5"
FT                   /protein_id="ACR27627.1"
FT                   /translation="MKLKRIALLATLAVALGGMLGGCIVVPDGGYHHHHDYYRY"
FT   gene            447433..448614
FT                   /locus_tag="bglu_1g04300"
FT   CDS_pept        447433..448614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04300"
FT                   /product="ubiquinone biosynthesis hydroxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27628"
FT                   /db_xref="GOA:C5AAA6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAA6"
FT                   /protein_id="ACR27628.1"
FT                   /translation="MRAMTAHTQTFDVAVVGGGLVGKTAALAMTQAGLRTALLAQPAAP
FT                   RPADLSFDARVYALSASSQALLERLRVWQALEHERLAPVYDMRVFGDAQAELHFSAFQA
FT                   AVAQLAWIGESSLVERGLDAALRFQPNLTWLDTRAQGLDVKPDVALLTLADGGVLSADL
FT                   VVGADGAHSWVRAQIGSRVARRDYRQTGVVANFKASEPHRETAWQWFRDGEIIALLPLP
FT                   DGHVSLVWSAHTAHADQLLALDPAQLAAEVERVSHRQLGTLDCVTPAQGFPLALQTVDR
FT                   LVAPRVALVGDAAHLIHPLAGQGMNLGLRDVAALADAIASREAFRDLGDLVLLRRYERA
FT                   RREDIRALMLATDGLQRLFALPGTLARAVRNTGMALVGAQPLVKRWLVATALG"
FT   gene            448840..449565
FT                   /locus_tag="bglu_1g04310"
FT   CDS_pept        448840..449565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04310"
FT                   /product="thiol:disulfide interchange protein DsbC"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27629"
FT                   /db_xref="GOA:C5AAA7"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAA7"
FT                   /protein_id="ACR27629.1"
FT                   /translation="MKTIVRIAALVLATAAATLGCTAQADQTTDKLKATLQARLGDATV
FT                   KGITKSPIPGLYEVNLGSQIVYSDAAGDYVLLGELVDTKSRKNLTEARMAEINKVDFAS
FT                   LPLGNAIKVVKGNGARKIAVFSDPNCPYCKRFESTLQSMDNVTVYTFLYPVLTPDSTVK
FT                   SKAIWCASDRAKSWEGWMINHQPPAGAGNCDTTALEKNLALGRSLNVRGTPTIFLADGT
FT                   RLPGAVSADELNNALASVK"
FT   gene            449681..451471
FT                   /locus_tag="bglu_1g04320"
FT   CDS_pept        449681..451471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04320"
FT                   /product="PDZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27630"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAA8"
FT                   /protein_id="ACR27630.1"
FT                   /translation="MTPIRYSIVPKDPAAHLFEVTLTVAEPAADGQRFMLPVWIPGSYM
FT                   VREFARSIVTLRAFNEAGRKVRIAKTDKHSWQAAPVAGPLTLRYEVYAWDLSVRAAHLD
FT                   DTGGFFNGTSVFLAVEGQEAAPCVVAIERPAGDSARRWRVATALREARGTKRYGFGDYL
FT                   ADDYDELIDHPVTLGEFALASFAAHGVPHDVVIAGRVTRLDIERLAADLKRICEAQIAL
FT                   FEPRTKKAPMARYVFMTQAVTDGYGGLEHRASTALVCNRGDLPVKGRPETTDGYRTYLA
FT                   LCSHEYFHTWNVKRIKPAAFVPYDLRQESYTSLLWLFEGFTSYYDDLMLVRSGLMSRDE
FT                   YFAALGRTVGGVLRGTGRLKQSVAESSFDSWIKYYRQDENASNAIVSYYTKGSLVALAF
FT                   DLAIRGATRNRKSLDDVMRLLWTRYGRDFYHGQPRGVGEDEVAALITEATGVALGRLFD
FT                   DAVSGTRDLPLAELLEPFGVMLSPEAGPNPKPSLGARVRGGADTTLAVVYEGGAAHRAG
FT                   LSAGDVLIAIDGLRVTGANLDALLARYQPGERVQVHAFRRDELRETTLRLDAPDVVRYR
FT                   LTADTRTAARRGWQQGWLGG"
FT   gene            451617..452213
FT                   /locus_tag="bglu_1g04330"
FT   CDS_pept        451617..452213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04330"
FT                   /product="(Acyl-carrier-protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27631"
FT                   /db_xref="GOA:C5AAA9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAA9"
FT                   /protein_id="ACR27631.1"
FT                   /translation="MTTILQINSAARSQGARSTQLADELTAKLERDNPGSKVVVRDLLS
FT                   NAQPHLDDAVLGAFFTPAEQRSAEQNAIVARSDELVEELKAADVIVIAAPLYNFGISSH
FT                   LKAYFDWIARAGVTFRYTATGPEGLITGKKVYVVSARGGKYFGTPNDTQTPYLKSFLGF
FT                   IGLTDVSFIYAEGLNLGPDSEAAGLAAAREAIAAV"
FT   gene            complement(452374..453222)
FT                   /locus_tag="bglu_1g04340"
FT   CDS_pept        complement(452374..453222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04340"
FT                   /product="Uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27632"
FT                   /db_xref="GOA:C5AAB0"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAB0"
FT                   /protein_id="ACR27632.1"
FT                   /translation="MANRPSSRKAPTAQASLFDAPAAAVAPPAADKIALHAGAGPVPPL
FT                   PLAAQFDALPAAWRALLAPFTASDTYAPLCRFVDAERAAGKTIYPADVFRALRLTAPDD
FT                   VKVVILGQDPYHGDDHGTPQAHGLAFSVPPAVRPPPSLRNIFKEITANFGYATPRHGCL
FT                   DSWARQGVLLLNTVLTVERGAAASHAKHGWEPCTDTLIRELARRHRGLVFMLWGAHAQA
FT                   KRALFDASVHCVLESPHPSPLSAHRGFLGNRHFALANAYLSEHGQAPIDWRLPDEAQVL
FT                   A"
FT   gene            complement(453237..453863)
FT                   /locus_tag="bglu_1g04350"
FT   CDS_pept        complement(453237..453863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04350"
FT                   /product="Adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27633"
FT                   /db_xref="GOA:C5AAB1"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAB1"
FT                   /protein_id="ACR27633.1"
FT                   /translation="MAIETEIKLALPAGAHTAARLALDACAGTPGREITLVNVYYDTPG
FT                   LALARARSALRVRRAPQGWLQTFKTVGTAEAGLHTRHEWELPVAGDALEIDALLAACDV
FT                   PEAADALRAAAPALVPLFRTDFARTLWRIERDGTAVEAALDLGEIVAEAGGATRREPIR
FT                   EIELELIEGDAAALHALAAELGRALPGLAPEDRSKAQRGYQLRAA"
FT   gene            complement(453881..454672)
FT                   /locus_tag="bglu_1g04360"
FT   CDS_pept        complement(453881..454672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04360"
FT                   /product="Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27634"
FT                   /db_xref="GOA:C5AAB2"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAB2"
FT                   /protein_id="ACR27634.1"
FT                   /translation="MSDILNRIIAVKREEIAAGLRSTPLEALRLEAEARGADTRDFVGA
FT                   LRAQHAAGRSAVIAEVKKASPSKGVLREHFVPAEIAASYARHGAACLSVLTDEQFFQGG
FT                   ARYLREAREACALPVLRKDFIIDPYQVLEARAMGADAILLIAAALDTPQMQDLEAYAHS
FT                   LGLAVLVEVHDRDEMANALTLKTPLIGINNRNLRSFETTLDTTLGMLEMVPAERIVVTE
FT                   SGIRTRDDVERMRRAGVHTFLVGEAFMRAEQPGEELARMFF"
FT   gene            complement(454743..455771)
FT                   /locus_tag="bglu_1g04370"
FT   CDS_pept        complement(454743..455771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04370"
FT                   /product="Anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27635"
FT                   /db_xref="GOA:C5AAB3"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAB3"
FT                   /protein_id="ACR27635.1"
FT                   /translation="MITAQEALQRTIEHREIFHDEMLHLMRMIMRGDMSPVMAAAIITG
FT                   LRVKKETIGEIAAAATVMREFARHVEVSDNSNFVDIVGTGGDGSHTFNISTATMFVTAA
FT                   AGAKVAKHGNRGVSSKSGSADVLDALGVNIDLAPEQVAASIEATGMGFMYAPNHHPAMK
FT                   NIAPVRRELGVRTIFNILGPLTNPAGAPNQLMGVFHPDLVGIQVRVMQRLGAEHVLVVY
FT                   GKDGMDEVSLGAATLVGELRDGKVTEYEIHPEDFGLQMVSNRSLKVENAEESRAMLLEA
FT                   LDNKPGVAREIVTLNAGTALYAANIAPSIAAGIDTAREAIASGRARAKVDELVRFTCQF
FT                   GR"
FT   gene            complement(455783..456373)
FT                   /locus_tag="bglu_1g04380"
FT   CDS_pept        complement(455783..456373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04380"
FT                   /product="Anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27636"
FT                   /db_xref="GOA:C5AAB4"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAB4"
FT                   /protein_id="ACR27636.1"
FT                   /translation="MLLMIDNYDSFTYNLVQYFGELGEDVRTHRNDEIMLDEIARLDPA
FT                   AICLSPGPSNPQHAGITLAVLREFAGKKPILGVCLGHQAIGEAFGGRVIRAKTIMHGKV
FT                   SRIETDGRGVFADLPRQFDVTRYHSLAIERESLPDCLEISAWTEDGEIMGVRHRTLPIE
FT                   GVQFHPESILSEHGHALLENFLKQARAGSAQPA"
FT   gene            complement(456748..457998)
FT                   /locus_tag="bglu_1g04390"
FT   CDS_pept        complement(456748..457998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04390"
FT                   /product="Multi-drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27637"
FT                   /db_xref="GOA:C5AAB5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAB5"
FT                   /protein_id="ACR27637.1"
FT                   /translation="MTTSPPAPGASNAAWQRNLAVCFCGSFVNIVAMTLLLPFLPLYIE
FT                   QLGVHGHAAIVQWSGIAYGATFLSAALVAPLWGRLADRYGCKLNLVRASFGMVVAMSLI
FT                   GLSQNVWQLVALRLLVGLAGGYTSGSYVIVAAQTPKERSAWALGMLSSGIMAGNLLGPL
FT                   LGGILPQYVGIRMTFFLASGFILLNFVATATLIREDRDAIAARRQQGAGSGAALAAGTR
FT                   GLVLTMLATAMLLMFANMSIEPIITVYMQQLLGDAGNVTFYAGLAMSAAALGSITSASR
FT                   LGKIADRIGALKVVIACLAVSGLLLIPQAFVTHAWQLIALRFLMGLSLGGLLPCLTSII
FT                   RHNVQDGSVGRVLGYSTSAQYSGQVLGPVAGGFVGGHLGMRYVFLTTCVLLLASALSNA
FT                   VLGRAPARRARGRSTTA"
FT   gene            complement(458285..459778)
FT                   /locus_tag="bglu_1g04400"
FT   CDS_pept        complement(458285..459778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04400"
FT                   /product="Anthranilate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27638"
FT                   /db_xref="GOA:C5AAB6"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAB6"
FT                   /protein_id="ACR27638.1"
FT                   /translation="MTELEFQSLANAGYNRIPLIAEALADLETPLSLYLKLAQPERGGA
FT                   NSFLLESVVGGERFGRYSFIGLPARTLVRTRNGVCEIVTDGQVVETHEGDPFAFIEAFQ
FT                   ARFKVAQRPGLPRFCGGLAGYFGYDAVRYIEKKLADSTPPDDLNLPDIQLLLTEEVAVI
FT                   DNLAGKLYLIVYADPGRPEAYAKAKQRLRELKQRLHATVQPPVTSASVRTETFREFKKD
FT                   DYLAAVRQAKEYIAAGELMQVQVGQRLTKPFRDNPLSLYRALRSLNPSPYMYYYNFGEF
FT                   HVVGASPEILVRQEKRGEDQVVTIRPLAGTRPRGNTPERDAALATELLNDPKEIAEHVM
FT                   LIDLARNDVGRIATTGSVAVTDRMVIEKYSHVQHIVSSVEGTLKPGMTNYDVLRATFPA
FT                   GTLSGAPKVRAMELIDELEPVKRGLYGGAVGYLSFSGEMDLAIAIRTGLIHNGNLYVQA
FT                   AAGVVADSVPESEWQETENKARAVLRAAEQVQDGLDGDF"
FT   gene            complement(460130..460843)
FT                   /locus_tag="bglu_1g04410"
FT   CDS_pept        complement(460130..460843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04410"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27639"
FT                   /db_xref="GOA:C5AAB7"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAB7"
FT                   /protein_id="ACR27639.1"
FT                   /translation="MTTIRFAAPRLAAALIDLDGTMIDTADDFTAGLNAMLARLGAPAT
FT                   TRDEVMHYVGKGSENLIAQVLKPRFAEAEAQARFDDALAIYQTEYAKINGRHTRLYPDV
FT                   EGGLRAMREAGLALACVTNKPLRFAAELLAQYALDGYFGVVLGGDSLPRKKPDPLPMLA
FT                   ACERLGVEPALAVAIGDSENDAIAGRAAGLATLTVPYGYNHGKAIQTINSDGIVGSLLV
FT                   AAQVITAHNRIGHTL"
FT   gene            complement(460848..461534)
FT                   /locus_tag="bglu_1g04420"
FT   CDS_pept        complement(460848..461534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04420"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27640"
FT                   /db_xref="GOA:C5AAB8"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAB8"
FT                   /protein_id="ACR27640.1"
FT                   /translation="MTQFRIAPSILSADFARLGEEVRNVVAAGADWIHFDVMDNHYVPN
FT                   LTIGPLVCEAIRPHVQVPIDVHLMVRPVDRIVPDFAKAGANVISFHPEGSDHIDRTLSL
FT                   IKDHGCKAGLVFNPATPLNYLDHVMDRLDLVLIMSVNPGFGGQSFIPEALRKVREARAK
FT                   IDAYRERTGREIHLEVDGGVKVDNIAEIAAAGADTFVAGSAIFGKPDYRAVIDEMRASL
FT                   AGVAKG"
FT   gene            461714..462088
FT                   /locus_tag="bglu_1g04430"
FT   CDS_pept        461714..462088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04430"
FT                   /product="ApaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27641"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAB9"
FT                   /protein_id="ACR27641.1"
FT                   /translation="MSQYEFSVSVKTAYLPEQSDPERRQYAFAYTLTIRNTGQVAAQLI
FT                   ARHWVITDSEQQVQEVKGLGVVGHQPLLKPGEQFEYTSWAVIATPVGSMRGAYFCVAED
FT                   GERFDAPVAEFALHMPRTLH"
FT   gene            complement(462101..462265)
FT                   /pseudo
FT                   /locus_tag="bglu_1g04440"
FT                   /note="disrupted gene"
FT   gene            462174..463406
FT                   /locus_tag="bglu_1g04450"
FT   CDS_pept        462174..463406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04450"
FT                   /product="MltA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27642"
FT                   /db_xref="GOA:C5AAC0"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAC0"
FT                   /protein_id="ACR27642.1"
FT                   /translation="MKISRPSASSDSSAKISIGYSSNRSDMAVSIKNVHCRWFGPRLAG
FT                   WAAAIATAALLAACGGAPVRPPVARAPGGAPFVPGQVAAERLTPVAWQQVPGWQDDTLI
FT                   GATIALRENCTRLARVPNWRRACEAAGRLDDLDITGARSFFETYFTPYQFANTDGTLDG
FT                   LVTGYYEPLLRGSRVRRGPYQTALYRWPAGYRAGAVLPTRAQLERSGVLNGNELVWVDD
FT                   PVDAFFLQVQGSGRVVLDDGTVMRVGYGGTNNQPYRSIGKWLLDHGELTPGQATMQGIK
FT                   AWARANPTRLDALLDTNPRFVFFREMPSQEGVPQGGADGPIGALGVPLTAERSIAVDPS
FT                   AIPLGTPVFLQTTRPLTNTPMSRLVFAQDTGSAIKGGVRADYFWGLGDDAGDLAGRMKQ
FT                   VGRMWLLLPNS"
FT   gene            complement(463456..464751)
FT                   /locus_tag="bglu_1g04460"
FT   CDS_pept        complement(463456..464751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04460"
FT                   /product="phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27643"
FT                   /db_xref="GOA:C5AAC1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAC1"
FT                   /protein_id="ACR27643.1"
FT                   /translation="MNAQLALEPIETASRDELQALQLERLRWSLTHAYENSPVYRRKFD
FT                   AAGVHPHELRGLADLARFPFTTKDDLRDNYPFGMFAVPPERVSRLHASSGTTGKPTVVG
FT                   YTARDIDTWAGLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGG
FT                   GQTEKQVQLIRDFRPDIIMVTPSYMLSIADEMERQGLDPRESSLRIGIFGAEPWTNEMR
FT                   AALEARLGIDAVDIYGLSEVIGPGVASECAATKDGPTVWEDHFYPEVVDPLTGEVLPDG
FT                   ELGELVFTSLTKEALPIVRYRTRDLTRLLPGTARPMRRMEKITGRADDMMIVRGVNVFP
FT                   TQIEEQLLKQRALAPHFQIVLTKDGPLDVMTLNVEPCPQAAADAAQLDAARRALAHDIK
FT                   ALIGVSAVVEVLAPNGIERSVGKARRVIDRRR"
FT   gene            complement(464794..465273)
FT                   /locus_tag="bglu_1g04470"
FT   CDS_pept        complement(464794..465273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04470"
FT                   /product="Phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27644"
FT                   /db_xref="GOA:C5AAC2"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAC2"
FT                   /protein_id="ACR27644.1"
FT                   /translation="MNAPRAPGSAADTDNQADPDALARAAADAMYAADACTRALGIELL
FT                   EVGPGRARMRMAVRAEFLNGHHTCHGGMIFALADSAFAFACNSHNLNTVAAGCSIEFLR
FT                   PVALNEVLTAEAHEQTLSGRHGIYDIRVTNRAGETVAMFRGKSARIGGTVTATGA"
FT   gene            complement(465275..466066)
FT                   /locus_tag="bglu_1g04480"
FT   CDS_pept        complement(465275..466066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04480"
FT                   /product="Phenylacetate degradation probable enoyl-CoA
FT                   hydratase paaB"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27645"
FT                   /db_xref="GOA:C5AAC3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR011968"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAC3"
FT                   /protein_id="ACR27645.1"
FT                   /translation="MSHDTIRFELDPQTRVATITLNRPDKLNSFTRAMHAALAAALDEA
FT                   EAGQARALVLTGAGRGFCAGQDLADLDFTPGAATDLGALIDTHFNPLVRRLQGLPLPVI
FT                   AAVNGIAAGAGANLALACDLVLAAKSANFIQSFVKIGLVPDSGGTWFLPQRVGFARALG
FT                   LALTGEKLGAERAAEWGLIWRAVDDDALAASAAALAADLAKQPTRAIAAIKQTMRAGLT
FT                   QTLDQQLDLERDRQRELGQSHDYAEGVAAFIEKRAPRFEGR"
FT   gene            complement(466127..467821)
FT                   /locus_tag="bglu_1g04490"
FT   CDS_pept        complement(466127..467821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04490"
FT                   /product="phenylacetic acid degradation protein paaN"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27646"
FT                   /db_xref="GOA:C5AAC4"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAC4"
FT                   /protein_id="ACR27646.1"
FT                   /translation="MTHPLFTKHEATLQRALSAIETRGYWSPFAEMPSPKVYGESAAAD
FT                   GEAAFKAQLGQRFALDQPGTGGEVGAELSPYGFALGIRYPAATPDQLAAAAAAAQPAWR
FT                   AAGPSAWIGVSLEILARLNRASFELANAVMHTTGQAFMMAFQAGGPHAQDRALEAVAYA
FT                   WDALRKIPADAHWEKPQGKNPPLAMQKRYTIVPRGTGLVLGCCTFPTWNGYPGLFADLA
FT                   TGNTVIVKPHPGAILPLAITVRIAREVLREAGFDPNVVTLLATDPDDGALVQALAVRPD
FT                   IKLIDFTGSSEHGNWLERHARQAQVYTEKAGVNQIVIDSADDLKGAVRNIAFSLALYAG
FT                   QMCTAPQNIYVPRDGIETPDGKLSFDEIAQAIAGAVSKLGADPARAVELLGAIQNDGVI
FT                   ARIDEARGLGKVLADSVALEHPAHPRARIRTPLVVQLDAGDRGIFTREWFGPISFVIAT
FT                   DSTAQSLDLAGGIAAECGALTLSVYSTDAAVIEQAHDAAIRGGVALSINLTGGVFVNQS
FT                   AAFSDFHATGANPAANAALADAAFVANRFRVVQSRIHVAPQADTAGA"
FT   gene            467957..468733
FT                   /locus_tag="bglu_1g04500"
FT   CDS_pept        467957..468733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04500"
FT                   /product="enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27647"
FT                   /db_xref="GOA:C5AAC5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAC5"
FT                   /protein_id="ACR27647.1"
FT                   /translation="MAYENLLVETRGRVGLITLHRPKALNALNDALMDELGAALKAFDA
FT                   DEAIGAIVLTGSEKAFAAGADIGMMANYSYMDVYKGDYITRNWETIRQIRKPILAAVAG
FT                   FALGGGCELAMMCDIIIAADTAKFGQPEIRLGVMPGAGGTQRLPRAVSKAKAMDMCLTA
FT                   RFMEAEEAERAGLVSRVVPAASLLDEALAAATTIAEFSLPAVMMVKESVNRAYETTLSE
FT                   GVHFERRVFHSIFATEDQKEGMAAFVEKRKPVFKHR"
FT   gene            469333..470568
FT                   /locus_tag="bglu_1gr04"
FT   rRNA            469333..470568
FT                   /locus_tag="bglu_1gr04"
FT                   /product="16S ribosomal RNA"
FT   gene            470931..471007
FT                   /locus_tag="bglu_1gt10"
FT                   /note="tRNA-Ile2 anticodon GAT, Cove score 93.29"
FT   tRNA            470931..471007
FT                   /locus_tag="bglu_1gt10"
FT                   /product="tRNA-Ile"
FT   gene            471048..471123
FT                   /locus_tag="bglu_1gt11"
FT                   /note="tRNA-Ala3 anticodon TGC, Cove score 90.89"
FT   tRNA            471048..471123
FT                   /locus_tag="bglu_1gt11"
FT                   /product="tRNA-Ala"
FT   gene            471428..474309
FT                   /locus_tag="bglu_1gr05"
FT   rRNA            471428..474309
FT                   /locus_tag="bglu_1gr05"
FT                   /product="23S ribosomal RNA"
FT   gene            474447..474562
FT                   /locus_tag="bglu_1gr06"
FT   rRNA            474447..474562
FT                   /locus_tag="bglu_1gr06"
FT                   /product="5S ribosomal RNA"
FT   gene            474874..476547
FT                   /locus_tag="bglu_1g04510"
FT   CDS_pept        474874..476547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04510"
FT                   /product="Long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27648"
FT                   /db_xref="GOA:C5AAC6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAC6"
FT                   /protein_id="ACR27648.1"
FT                   /translation="MDKIWLKSYPPGVPAEIDPSRYPTVPDLLDESFRTYRERTAFVCM
FT                   GKSLTYGDIDTLSRKLGAWFQSRGLARGARIAIMMPNVLQYPVTIAAVLRAGYTVVNVN
FT                   PLYTPRELEHQLTDSGAEAIVILENFAATLQSVIDRTSIRHVVVAAMGDLLGFKGVIVN
FT                   YVVRRVKKLVPAWQLPSFTRFNAALAEGSRQTLTAPSLGPDAAAFLQYTGGTTGVAKGA
FT                   TLLHRNIVANVLQAEAWHQPAYTKRPGQTQFITVAALPLYHVFALTVCGFLTMRTGGTG
FT                   VLIPNPRDIAGMIKELKPFQVSTFPAVNTLYNAMLNHPDFDQLDFSKLAVANGGGMAIQ
FT                   ESVAKRWYDKTHTPIVEGYGLSETSPVVACNPVTATEYTGTIGLPLPSTEISIRDDDGN
FT                   EVPLGQPGEICIRGPQVMAGYWQRPEETAKVMMADGFFKSGDIGVMDERGYVKIVDRKK
FT                   DMILVSGFNVYPNEVEDVVASHPGVFEVAAVGVPDEHSGEAVKLFIVKKDPALTEEDIL
FT                   AYCKERLTGYKRPRIIEFRIELPKTNVGKILRRELRDGKA"
FT   gene            476864..477493
FT                   /locus_tag="bglu_1g04520"
FT   CDS_pept        476864..477493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04520"
FT                   /product="5-demethoxyubiquinone hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27649"
FT                   /db_xref="GOA:C5AAC7"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAC7"
FT                   /protein_id="ACR27649.1"
FT                   /translation="MLLDELINEFDRGLRAVVGVSRMTRPLPEPSADAPAAELSVEERR
FT                   HAAGLMRVNHVGEVCAQALYQAQKLSTSSPSLKALFEASAREEEDHLAWTMHRLKSLDS
FT                   RPSLLNPLWYSGALAIGLVAGRLGDRASLGFMAETERQVERHLDGHLAELPAADAASRA
FT                   IVEQMRDDEAKHGRTATDAGGTELPAPARWLMQAASKVMTRTAYYL"
FT   gene            477868..478296
FT                   /locus_tag="bglu_1g04530"
FT   CDS_pept        477868..478296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04530"
FT                   /product="cell division protein MraZ"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27650"
FT                   /db_xref="GOA:C5AAC8"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAC8"
FT                   /protein_id="ACR27650.1"
FT                   /translation="MFQGASALTLDAKGRMSVPSRYREALQGQAEGRVTVTKHPDGCLL
FT                   LFPRPEWEVFRAKIAALPMDAHWWRRIFLGNAMDVDLDSAGRILVSPELRMAAGLEKEV
FT                   MLLGMGSHFELWDAQTYTAKEQAAMAQGMPDALKNFTF"
FT   gene            478320..479261
FT                   /locus_tag="bglu_1g04540"
FT   CDS_pept        478320..479261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04540"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27651"
FT                   /db_xref="GOA:C5AAC9"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAC9"
FT                   /protein_id="ACR27651.1"
FT                   /translation="MGTEFQHRTVLLDEAVDALVTRPDGVYVDGTFGRGGHSRAVLARL
FT                   AEGGRLIAFDKDPLAIATAQQIADPRFSIVHDSFASLGGALAERGVARVTGVLLDLGVS
FT                   SPQIDDPERGFSFRANGPLDMRMDTTRGESAADWLARASLQELTEVIRDYGEERFAFQI
FT                   AKALVARREESDRLGPLDSTGELAQIVGHAVKTREKGKDPATRTFQAIRIHVNQELADL
FT                   QVVLGAALSSLEQGGRLVVISFHSLEDRIVKRFLQTHASAPAVDRRLPIRAVDLPSPPL
FT                   KLLGRKFPSDAEVDANPRARSAVMRIAERVAP"
FT   gene            479258..479593
FT                   /locus_tag="bglu_1g04550"
FT   CDS_pept        479258..479593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04550"
FT                   /product="Cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27652"
FT                   /db_xref="GOA:C5AAD0"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAD0"
FT                   /protein_id="ACR27652.1"
FT                   /translation="MNRLNIFLLIVVMGCALSVVNSTNQQRQIFFQLQRAQSQEHQLQQ
FT                   DYAQLQYQQSALSKTSRIEQLANDSLKMQPIATGRTQYLVLAPGAAKAVDAPLPTSAAS
FT                   GSKGSAR"
FT   gene            479590..481428
FT                   /locus_tag="bglu_1g04560"
FT   CDS_pept        479590..481428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04560"
FT                   /product="Penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27653"
FT                   /db_xref="GOA:C5AAD1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAD1"
FT                   /protein_id="ACR27653.1"
FT                   /translation="MKPRQPNVKFGSSPVLSVHLPMWRSKLVVFMLFMAFFALAARAFW
FT                   IQGPGNAFYQKQGESRYQRTLELPATRGKILDRNGLVLATSLPVRAIWAIPESVPDDLG
FT                   ADKLDELGKLLGMSTTELRRKLSEDKSFVYVKRQVPIDVADKVAALDIPGIYARNEYKR
FT                   FYPEGEITAHLIGFTNVEDEGQEGVELADQKLLAGVPGSRRVIKDRVGHIVEDVAEQLP
FT                   PHDGTDVDLSIDSKIQYITYANLKAAIEKFHAKAGAAMVVDVRTGEVLSLVNYPTYNPN
FT                   DRSHLTGEQLRNRALTDVFEPGSIMKPFTVSLALDLHRVSPTTLVDTGNGHFTLDGAPI
FT                   TDDAGFGVLTVGGVIQKSSNIGATKIAMTMRPEEMWNMYTSLGLGQAPKVGFPGAAAGR
FT                   LRPWKSWRRIEQATMSYGYGLSVSLFQLAHAYTAIAHDGELMPLSIFKANEAQPPQGPQ
FT                   VFSPTTAREVREMLESVVTKNGTSPDAAVPGYRVGGKSGTAYKQVGRGYDHKKYRASFV
FT                   GMAPMPNPRIVVAVTVDEPTAGSHFGGQVSGPVFSTIVGDTLRALNVPPNMPVKQLVVS
FT                   DDAGQAQQAGAQKLAAMPAGRMTVSSTTHSRPGVVR"
FT   gene            481425..482972
FT                   /locus_tag="bglu_1g04570"
FT   CDS_pept        481425..482972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04570"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27654"
FT                   /db_xref="GOA:C5AAD2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAD2"
FT                   /protein_id="ACR27654.1"
FT                   /translation="MSALRSSHPAQARIAAALAWLREHAKPGAQLHADTRSLRAGDVFL
FT                   AYAVDGADNRPHLANALSRGAAAVLVQPEGYAGIDALDPAVALAVPGLDALAGEIASGW
FT                   YGDPSDAMFVIGVTGTNGKTSCTQWIATALTALRRPCAVIGTLGSGMPGRLVATGFTTP
FT                   DAPQLQRSLAQLRDDGAQAVAMEVSSHALHQGRVNGTAFDVAVFTNLTQDHLDYHRTFE
FT                   AYEAAKAKLFAWRGLRHAIINRDDAAGGRLLATLAGRVRTVAYGIGARADAPEADRTLI
FT                   ASEVRATATGTAFRLTSSWGDADLEVGTLGLFNVSNLLAVLATLLVADLPFDAALAEMR
FT                   RLESVNGRMQRLGGRIDHDEPLVVVDYAHTPDALEKTLEALRPIAEARGGALVCMFGCG
FT                   GDRDTTKRPLMGAIAERLADRVVVTSDNPRSEAPLAIIEQIASGMHAPDGALRIEDRAS
FT                   AILQAVRGAAREDVVLLAGKGHEATQEIMGKKRQFSDQDHARLALAARAASAQGGGE"
FT   gene            482969..484375
FT                   /locus_tag="bglu_1g04580"
FT   CDS_pept        482969..484375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04580"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27655"
FT                   /db_xref="GOA:C5AAD3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAD3"
FT                   /protein_id="ACR27655.1"
FT                   /translation="MTMLTLHDAAALIPGATVIGDGSVAFARVSTDSRTVGEGDLFVAL
FT                   KGERFDAHDFLAEVAARGASAALVSRAGVLPGLPQLKAADTRVALGALAHGWRQRFDLP
FT                   LVAVTGSNGKTTVKEMIASVFAAAVGQDARLSTAGNFNNDIGLPLTLLRLAPAHRLAVI
FT                   ELGMNHPGETGTLARIAAPTIALVNNAQREHQEFMATVEAVALEHASVIHALGPDGVAV
FT                   FPADDRYAGIWRVAATGNRIVDFALNDDGRATAAAVTGTTQGGVLAIDTPAGRIEVRLR
FT                   ALGAHNARNALAATAAALAAGVEPDAIRAGLEAFEPVKGRLQVKRASLASLAGAMLIDD
FT                   TYNANPDSMRAAIDVLAQCAAPRVLVIGEMGEVGDAGPAFHREIGAYARERGIDALYAT
FT                   GEATREACAAYGAAARHFDEVGALVAALDAAGYGAAATVLVKGSRYTRMERVVDALTNQ
FT                   PAPGIAPGAH"
FT   gene            484390..485559
FT                   /locus_tag="bglu_1g04590"
FT   CDS_pept        484390..485559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04590"
FT                   /product="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27656"
FT                   /db_xref="GOA:C5AAD4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAD4"
FT                   /protein_id="ACR27656.1"
FT                   /translation="MLLALAQWLQGDASFLRLFTYLTFRAVMATITALGIGLVCGPWVI
FT                   RKLTEMKVGQAVRKDGPQTHLVKSGTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLV
FT                   TFGFGVVGWVDDYRKVVYKDPRGMSSREKYFWQSVIGLFAAVYLAFSVSEASNVRVFDL
FT                   FMAWVRSGLSMGLPARADLMLPFLKSISYPLGVWGFIALTYFVIVGASNAVNLTDGLDG
FT                   LVIMPVVLVGASLGVFAYVMGSSVYSKYLLFPHIPGAGELLIFCSAMGGAGLAFLWYNT
FT                   HPAQVFMGDVGALALGGALGTVAVIVRQEIVLFIMGGIFVAETLSVMLQVSWFKYTKRR
FT                   YGEGRRIFKMAPLHHHFELSGWKETQVVVRFWIITLMLCLFGLTTLKLR"
FT   gene            485585..487096
FT                   /locus_tag="bglu_1g04600"
FT   CDS_pept        485585..487096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04600"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27657"
FT                   /db_xref="GOA:C5AAD5"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAD5"
FT                   /protein_id="ACR27657.1"
FT                   /translation="MFGDRPRPMVLVLGLGESGLAIARWCARHACALRVADTREAPPNL
FT                   ALLREAVADAEFVGGAFTPALLDGGIEIVALSPGLSPLEPALATLLAAARERGIAVWGE
FT                   LEFFARALAGLAANGYAPKVLAITGTNGKTTTTSLTGLLCERAGRSVAVAGNISPAMLD
FT                   RLSAAIDAAALPQVWVLELSSFQLETAQSFAPDAAAVLNITQDHLDWHGGFAAYAAAKG
FT                   RIFGPRTVRVLNRDDAETMKFMPPAAAADAPRAITFGLNEPSREGDYGLVRDSGINWLV
FT                   EAVDRDAAEEPVSSRRRKAGAPAAPTLTAKRLMPADALRIRGLHNAANALAAFALARAI
FT                   ELPSAALLHGLREYRGEAHRVELIASLDGVDYVDDSKGTNVGATVAALDGLAQRAVLIA
FT                   GGDGKGQDFSPLAAPVARWCRAVMLIGRDAPRIRAALADSGVPLVEHATLEAAVRAASE
FT                   LAEPGDAVLLSPACASFDMFSDYAHRAAVFRSALEDIALDRGTSL"
FT   gene            487093..488370
FT                   /locus_tag="bglu_1g04610"
FT   CDS_pept        487093..488370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04610"
FT                   /product="Cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27658"
FT                   /db_xref="GOA:C5AAD6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAD6"
FT                   /protein_id="ACR27658.1"
FT                   /translation="MSWSDRFVSRFIGQREGGGAVARPPARTTPAANGFAHGLGGVRPT
FT                   RSRMLDFDYSLMWVAIALLGLGVVMVYSASIAMPDSPKYAAYHDYAFLLRHVVSLTVAF
FT                   VAAIVAFRVPIATWDKYAPHLFLIALVGLVIVLIPHVGKGVNGARRWIPLGVTNMQPSE
FT                   IMKLAVTIYAANYTVRKQEYMHSFAKGFLPMAAAVGLVGMLLLLEPDMGAFMVVAAIAM
FT                   GVLFLGGVNGKLFGGLVATAVGTFSMLVWLSPWRRERIFAYLDPWDERYAQGKAYQLTH
FT                   SLIAFGRGEWFGVGLGGSVEKLNYLPEAHTDFILAVIGEELGFVGVLVVILLFYWIVRR
FT                   AFEIGRQALALDRTFAGLMAKGVGIWFGAQAFINMGVNLGLLPTKGLTLPLVSYGGSGI
FT                   LLNCISLAVLLRVDYENRVLMRGGKV"
FT   gene            488367..489470
FT                   /locus_tag="bglu_1g04620"
FT   CDS_pept        488367..489470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04620"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27659"
FT                   /db_xref="GOA:C5AAD7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAD7"
FT                   /protein_id="ACR27659.1"
FT                   /translation="MTARQRTLMVMAGGTGGHVFPGLAVAHRMQAHGWRVVWLGNPAGM
FT                   EATLVPKHGITMEPVRFGGLRGKGLMTKLGLPFNLLRACLQSLGALRRVRPDVVLGMGG
FT                   YITFPAGVMTVLTGRPLVLHEQNSIGGLANKVLAKLAKRVLVAFPGALPNAEWTGNPIR
FT                   DELARSEPPAVRYAARSGALRLLVVGGSLGAAALNDVVPRALALLAPHERPQVVHQAGA
FT                   KHVEALRANYEAAGLAAGRDVTLLPFIDDMAAAYANADLVICRSGAMTVSEIAAVGVAA
FT                   LFVPFPHAVDDHQTTNAAFLAEQGAAVLVQQRELSAQWLADWLRGQTRDSLAQMAERSR
FT                   SLAKPDATDVVARVCAQVAGANLESKS"
FT   gene            489467..490867
FT                   /locus_tag="bglu_1g04630"
FT   CDS_pept        489467..490867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04630"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27660"
FT                   /db_xref="GOA:C5AAD8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAD8"
FT                   /protein_id="ACR27660.1"
FT                   /translation="MKHIVKHVHFVGIGGAGMSGIAEVLVNLGYEVSGSDLSRNAVTER
FT                   LTALGARVAIGHDAANIEGANAVVTSTAVRSDNPEVLAARRLGVPIVPRAVMLAELMRL
FT                   KQGIAIAGTHGKTTTTSLVASVLAAGGLDPTFVIGGRLISAGANARLGSGDFIVAEADE
FT                   SDASFLNLYPVIEVITNIDEDHMDTYGHDFARLKQAFIEFTQKLPFYGSVVVCVDDPNV
FT                   RQILPFISKPVVRYGLAPDAEVRAEQVAARDGRMHFTAIREGRAPLAVVLNLPGLHNVQ
FT                   NALAAIAIATDLGVADAAIQQALADFNGVGRRFQRYGEIATADGAGSYTLVDDYGHHPV
FT                   EMAATIAAARGAFPGRRLVLAFQPHRYTRTRDCFEEFVNVLSTVDELVLTEVYAAGEAP
FT                   IPTASGEALARALRASGRVDPAFVATVDEVPAALAQRVRAGDVVITMGAGSIGGVPGRI
FT                   AQQQQRKE"
FT   gene            490869..491810
FT                   /locus_tag="bglu_1g04640"
FT   CDS_pept        490869..491810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04640"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27661"
FT                   /db_xref="GOA:C5AAD9"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAD9"
FT                   /protein_id="ACR27661.1"
FT                   /translation="MSGIDPKRFGKVAVLFGGVSAEREVSLNSGRLVLQGLREAGIDAH
FT                   LFDPSERPLSALKDEGFVRAFNALHGGYGENGQLQGALDFYGIRYTGPGVLGSALGLDK
FT                   FRTKLVWQQTGIPTPPFETVMRGDDHAARAAEIVAKLGLPLFVKPASEGSSVAVIKVKD
FT                   AAALPAALDEAGRHDRIVIVEKSIEGGGEYTACIAGDLDLPVIRIVPAGEFYDYHAKYL
FT                   ADDTQYLIPCGIEAAKETEFKRLARRAFEVLGCSGWGRADFMLDAAGNPYFLEVNTAPG
FT                   MTDHSLPPKAARAVGISYSELVVKVLSLTLDD"
FT   gene            491831..492583
FT                   /locus_tag="bglu_1g04650"
FT   CDS_pept        491831..492583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04650"
FT                   /product="Cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27662"
FT                   /db_xref="GOA:C5AAE0"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAE0"
FT                   /protein_id="ACR27662.1"
FT                   /translation="MWNNVRQLNLAASALYALLLLGCTAAGCYWLIQRPAFALRTILID
FT                   GDTDHINAPTVRASVVGRLKGNFFTVDLDTARVAFEQMPWVRHASVRRVWPNALAVSLE
FT                   EYKPLGTWGSDQLVSTDGELFTANQGELDEELPAFDGPDGSAKEVVQRYRDFGKWLAPL
FT                   NSPLEEVTLSSRYAWTVKLANGLEIEFGRERNADTLPDRAQRLVAAWPAVTQRWGADIE
FT                   YADLRYPNGFAIRAAGMRFLSDTDHGKK"
FT   gene            492609..493841
FT                   /locus_tag="bglu_1g04660"
FT   CDS_pept        492609..493841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04660"
FT                   /product="Cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27663"
FT                   /db_xref="GOA:C5AAE1"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAE1"
FT                   /protein_id="ACR27663.1"
FT                   /translation="MSKDYKDLLVALDIGTSKVVAVVAELKGEGRYEVIGLGQSESKGL
FT                   KKGVVVNIEATVQSIQRALEEAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKEKEVT
FT                   QTDVARVIETAKAINIPTDQQVLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGA
FT                   VSAAQNIVKCVRRCGLEVNDLILQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAE
FT                   GAIRHTAVIPIAGDQITSDIAMALRTPTPDAEDIKVSHGIAKQALADPDEMVEVPGLGE
FT                   RGPRTLSRQALAAVIEPRVEELFSLVQQVVRESGYEELLSSGVVLTGGAAMMPGMVELG
FT                   EDIFLKPVRIGAPEYAGGLADVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQSGSAGQIF
FT                   TRMKDWFLSNF"
FT   gene            493945..495138
FT                   /locus_tag="bglu_1g04670"
FT   CDS_pept        493945..495138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04670"
FT                   /product="Cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27664"
FT                   /db_xref="GOA:C5AAE2"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAE2"
FT                   /protein_id="ACR27664.1"
FT                   /translation="MEFEMLETETNGTIIKVIGVGGAGGNAVAHMINRGVQGVDFVVMN
FT                   TDAQALSRSRAPNVIQLGSTGLGAGAKPDMGRAAAEEARERIADSLRGAHMVFITAGMG
FT                   GGTGTGAAPVVAQIAKEMGILTVGVVSKPFEFEGGKRMRVAEAGAQQLEDHVDSLIVVL
FT                   NDKLFDVMGDDAEMDKCFQCADDVLNNAVAGIAEIINVDGLVNVDFEDVKTVMGEQGKA
FT                   MMGTATVAGVDRARLAAEQAVASPLLEGVDLSGARGVLVNITSSRSLRLSETREVMNTI
FT                   KSYAAEDATVIFGAVYDDAMGDALRVTVVATGLGRAAKKQQTTPMTLLRTGTDNQPVGV
FT                   VAHSYAPAHVSTADYGALDTPAVWRNSRETAASHVQALQEKGVDTYDIPAFLRKQAD"
FT   gene            495313..495819
FT                   /locus_tag="bglu_1g04680"
FT   CDS_pept        495313..495819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04680"
FT                   /product="AhpC/TSA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27665"
FT                   /db_xref="GOA:C5AAE3"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAE3"
FT                   /protein_id="ACR27665.1"
FT                   /translation="MIQAGDTLPDAQVFEFVDEAREGCTLGPNALGVREQTAGKRVVIF
FT                   GLPGAFTPTCSARHVPGYVELAEPLRAAGVDEVWCVSVNDAFVMGAWGRDLHTAGKVRM
FT                   IADGSAALTQALGLTQDLSARGMGIRSQRYAMVVDDGVVKTLAVEAPGKFEVSDAASIL
FT                   AALTR"
FT   gene            496041..496988
FT                   /locus_tag="bglu_1g04690"
FT   CDS_pept        496041..496988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04690"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27666"
FT                   /db_xref="GOA:C5AAE4"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAE4"
FT                   /protein_id="ACR27666.1"
FT                   /translation="MITSIKNQDIMLKQRTIKSIVKTVGIGLHSGRKVELTLRPAAPGT
FT                   GIVFTRVDLPAPVEIPADAMAIGDTRLASVLQKDGARVSTVEHLMSACAGLGIDNLYVD
FT                   VTAEEIPIMDGSASSFVFLIQSAGIEEQNAPKRFIKVTRPVEVRDGDKFARLDPYFGFK
FT                   LKFTIDFRHPAVDKTGQELEVDFANTSYVREIARARTFGFAHEVEMMRELGLARGGSMD
FT                   NAIVLDEYRILNNDGLRYDDEFVKHKMLDAIGDLYVVGHPLLASYTAYKSGHGLNNALL
FT                   RELLSHEDAYEMVTFDDLKAAPRGFGFDAQTAFA"
FT   gene            complement(497080..497589)
FT                   /locus_tag="bglu_1g04700"
FT   CDS_pept        complement(497080..497589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04700"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27667"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAE5"
FT                   /protein_id="ACR27667.1"
FT                   /translation="MNRPPRSAKPSAHASAHASGYSRPQVAAEVLKRTDAFAALRAGVE
FT                   QVASLQRDLRALLPDYLASHVEPGSIKDGGLTLFAAHNALAARLRQVAPRLVADLQARG
FT                   WHVATLKVRVRPQDAPEPLRIKQARMTPAGAEALRELAQALAPSPLQNALARMADRHTK
FT                   KTKPAP"
FT   gene            497972..500761
FT                   /locus_tag="bglu_1g04710"
FT   CDS_pept        497972..500761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04710"
FT                   /product="Preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27668"
FT                   /db_xref="GOA:C5AAE6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAE6"
FT                   /protein_id="ACR27668.1"
FT                   /translation="MTTGFLQKIFGSRNQRLVKQYQKTVAAINALEPQIEQLTDDQLRG
FT                   KTGEFRQRVAAGESLDTLLPEAFAVCREASRRVLKMRHFDTQLIGGMVLHYGKIAEMRT
FT                   GEGKTLVATLAAYLNALSGRGVHVVTVNDYLAQRDAEWMGRLYNFLGLSVGINLSGMEH
FT                   EQKHEAYAADITYGTNNEFGFDYLRDNMVYETEARVQRALNFSIVDEVDSILIDEARTP
FT                   LIISGQAEDHTELYVRMNALPPLLERQIGEEKADGTGVEKPGDYTLDEKARQVFLTESG
FT                   HEKAERLLAEWGLIGEGESLYAPQNITLMHHVYAALRAHTLFHRDQHYVVQNGEVVIVD
FT                   EFTGRLMAGRRWSDGLHQAVEAKEHVKIQSENQTLASITFQNYFRMYAKLSGMTGTADT
FT                   EAYEFNEIYGLETVVIPTNRPPKRIDKQDQIYKSAKERYDAVIRDIRDCYERGQPVLVG
FT                   TTSIENSELLSHLLKQAGLPHEVLNAKQHAREAAIVAEAGRPKRITIATNMAGRGTDIV
FT                   LGGNVEKQASFIEADDAIPAEEKVARIQQLHDEWETLHQQVKAAGGLHIIGTERHESRR
FT                   IDNQLRGRAGRQGDPGSSRFYLSLDDPLLRIFAGDRVRAIMDRLKMPEGEAIEAGIVTR
FT                   SIESAQRKVEARNFDIRKQLLEYDDVSNDQRKVIYQQRNELLEAHDIAETIGAMRHGVI
FT                   TEIVHQYVPPGSIEEQWDLPELEEALRSDWGLDLAIQEMVNESQSISVDEILEAVTTAA
FT                   DEHYEAKVALVGREAFSSFERSIMLQTLDRLWREHLAALDHLRQGIHLRGYAQKNPKQE
FT                   YKREAFELFAAMLEAIKQEVTRIVMNVQIQSPEQLEEAAEQIEESGGQLVEHVEFRHAD
FT                   FSETGAAVATVAAAEMVDGAMAARAGGEPAGEVPRVGRNDPCPCGSGKKYKHCHGKLS"
FT   gene            500964..502205
FT                   /locus_tag="bglu_1g04720"
FT   CDS_pept        500964..502205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04720"
FT                   /product="Arginine biosynthesis bifunctional protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04720"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27669"
FT                   /db_xref="GOA:C5AAE7"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAE7"
FT                   /protein_id="ACR27669.1"
FT                   /translation="MAVNFPSIDPAQLHPVAGVTLGWAEANIRKPNRKDVLVISVEEGA
FT                   AVAGVFTENRFCAAPVIVCREHLAGVRAGAPAIRALVVNTGNANAGTGEPGLAATRETC
FT                   AELARLTGLAPSQILPFSTGVILEPLPVERLKAGLPAALANRAAANWYDAAQAIMTTDT
FT                   LPKAASRQVTIDGHTVTLTGISKGAGMIKPNMATMLGFLAFDAAVAQPVLDQLVKEVAN
FT                   RSFNCITIDGDTSTNDSFILIASGKSSLPAVTSTDSPAYAALREAVTEVAQTLSQLIVR
FT                   DGEGATKFMTVQVEGGRDVAECRQIAYAIGHSPLVKTAFYASDPNLGRILAAIGYAGVA
FT                   DLEVGKIDLYLDDVLVAKAGGRNPDYQEADGQRVMKQSEITIRVLLGRGEANATIWTCD
FT                   LSHDYVSINADYRS"
FT   gene            502270..503139
FT                   /locus_tag="bglu_1g04730"
FT   CDS_pept        502270..503139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04730"
FT                   /product="AAA ATPase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27670"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAE8"
FT                   /protein_id="ACR27670.1"
FT                   /translation="MDKLEQFLDRAEALIGRFEALLPPAPADIDWHAANAFRWRKRQGR
FT                   GYLQAVPTVSPIALADLQNIDRQKALIEQNTRQFVQKRPANNVLLTGARGTGKSSLIKA
FT                   CLNAYAAEGLRLIEVDKDDLHDLGDIVELISARPERFIVFCDDLSFEEGESGYKALKVA
FT                   LDGSISAQSDNVLIYATSNRRHLLPEYMSDNESYKHLPDGEIHPGEVVEEKISLSERFG
FT                   LWVSFYPFKQDDYLTIVAHWLRHFGCDEAQIEAARGDALVWALERGSRSGRVAWQFARD
FT                   RAGRGEPA"
FT   gene            503136..503576
FT                   /locus_tag="bglu_1g04740"
FT   CDS_pept        503136..503576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04740"
FT                   /product="Pyrophosphatase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27671"
FT                   /db_xref="GOA:C5AAE9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAE9"
FT                   /protein_id="ACR27671.1"
FT                   /translation="MSAAADTAAGGAAPRKVTEVAVGVLVRPDGRYLLAQRPAGKPYEG
FT                   YWEFPGGKLEAGESVEAALARELHEELGISVTACRRWHTLEHDYPHAYVRLFFCKVTDW
FT                   DGEPHSREGQALAWQALPVDVAPLLPAALPVLELLAREAQAR"
FT   gene            complement(503635..503844)
FT                   /locus_tag="bglu_1g04750"
FT   CDS_pept        complement(503635..503844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04750"
FT                   /product="zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04750"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27672"
FT                   /db_xref="GOA:C5AAF0"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAF0"
FT                   /protein_id="ACR27672.1"
FT                   /translation="MTLVVKCPACAKDVPWTPESPFRPFCSARCKQMDLGAWAAERYRI
FT                   GGTDDEPSDDAANGQPDGRSGRDD"
FT   gene            complement(503852..504607)
FT                   /locus_tag="bglu_1g04760"
FT   CDS_pept        complement(503852..504607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04760"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04760"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27673"
FT                   /db_xref="GOA:C5AAF1"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAF1"
FT                   /protein_id="ACR27673.1"
FT                   /translation="MILYEYPFNERIRTLLRLEDLFERLTFFLAQEDPREHHVALTTLF
FT                   EIAEVAGRADLKSDLMKELERQRQTLAPFRGNPGIEQNALEAVLGEIEQTLGHLGQMQG
FT                   KTGQHLTDNEWLGSIRSRAVIPGGTCKFDLPSYYAWQQWPAEQRRQDITKWAMPLLPLR
FT                   DATTIVLRLARESGQASKVMAMQGSYQQMLSGRSYQLMQVRVPPELHVIPEASANKYML
FT                   WVRFTAQDGDVRPRAVDIDVPFQLTLCNL"
FT   gene            complement(504755..505363)
FT                   /locus_tag="bglu_1g04770"
FT   CDS_pept        complement(504755..505363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04770"
FT                   /product="Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04770"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27674"
FT                   /db_xref="GOA:C5AAF2"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAF2"
FT                   /protein_id="ACR27674.1"
FT                   /translation="MLSIGLTGGIGSGKTTIANRFGERGASLVDTDLIAHRVTAPGGAA
FT                   MPAIAAQFGAAFVAADGSLDRARMRELVFADDDARRRLEAITHPLIRAETEREASLARG
FT                   AYVIFVVPLLVESGNWRARVDRVLVVDCEVETQIARVMRRNGYTREQVEAIVARQATRA
FT                   ARLAAADDVIVNEQMPDAALEARIDTLHARYLALAASKS"
FT   gene            complement(505368..506258)
FT                   /locus_tag="bglu_1g04780"
FT   CDS_pept        complement(505368..506258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04780"
FT                   /product="Type IV pilus prepilin peptidase PilD"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04780"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27675"
FT                   /db_xref="GOA:C5AAF3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAF3"
FT                   /protein_id="ACR27675.1"
FT                   /translation="MISPLALSDPSLAFAALPPAVRYVFAAAIGLVVGSFLNVVGHRLP
FT                   VMMQRAWQAELAEATGGDPPPDDGLPARYDLSVPRSACPHCGHVLRAWENVPVLSYLAL
FT                   RGRCSRCRAPIGIRYPLVELVSGALAVASLAVFGPVPAALAAFGLCAMLVAMSLIDIKT
FT                   GYLPDSMTLPLLWAGLVVNLWGSFVDLREAVIGAIAGYLFLWCVFWLFKWLRGIEGIGY
FT                   GDLKLLAALGAWLGWIALPQILLVAALSGAVVGLAATWRGRMRFEEPLPFGPFLALGGI
FT                   ATLLCGTPFYPAIGG"
FT   gene            complement(506312..507520)
FT                   /locus_tag="bglu_1g04790"
FT   CDS_pept        complement(506312..507520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04790"
FT                   /product="Type IV pilus biogenesis protein PilC"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04790"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27676"
FT                   /db_xref="GOA:C5AAF4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAF4"
FT                   /protein_id="ACR27676.1"
FT                   /translation="MSTPPAADRRFRWAGLAQDGTRRRGTLIACDASAARRALRRRGIT
FT                   VLALDGGGAARAPAARARDVTRFTHQLGGLLRAGLPLAPALELLADAGGHRDLPRIAAG
FT                   LARAIGAGRQLSEAMRQYPRQFDPMFRQLVAVGEASGTLAPLLARVAADRERGAAQRAR
FT                   VRTALAYPLAVLAFSLAISAALLVWVVPTFAQIFDGFGARLPAPTRFVLTLSATVARAG
FT                   PPAAIAAAAAGFTLAALLHRSAALRLTAARATLRLPLVGPLLRTLAAARWSRTLGTLLR
FT                   AGTPLADAFDSLAQATGNPVFDRATDAIAARLLRGERLAQAMRAAGCFPDEVVQPVAVA
FT                   EESGTLDAMLADIATLCERQVDEQIALLTSLCEPLVVIVLGALVGGLVVAMYLPIVQLG
FT                   NVV"
FT   gene            complement(507517..508677)
FT                   /locus_tag="bglu_1g04800"
FT   CDS_pept        complement(507517..508677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04800"
FT                   /product="Type IV fimbrial biogenesis protein,PilB"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04800"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27677"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAF5"
FT                   /protein_id="ACR27677.1"
FT                   /translation="MVALVNEILNEAARRDASDIHIEAAERAWRVRLRIDGALHPFAAP
FT                   PVHLRDGVVTRLKVLARMDIAERRVPQDGRLRIALGHGVTGDYRVSSLPTLHGEKLVLR
FT                   RLDTLPADLSLPALGFAARQAEALEAAIAAPHGLVLVTGPTGSGKTVTLYCCLQRLNLA
FT                   SRNLCTIEDPAELQLDGLNQVNVHDKAGLTFAVALRAFLRQDPDVLMIGEIRDAETADV
FT                   ALKAAQTGHLVLSTLHTNDAPGAIARLLDIGVAPYHVASALRVVTAQRLVRRLCAACRQ
FT                   PSSAPAARLAAGGLDPVALGAGWRPFAAVGCEACHGIGYRGRIGVHQVMAVSDTLRERI
FT                   VARAGSLALARQARDDGMRTLRDAALERVYDGTTSLDEALATTDAA"
FT   gene            complement(508899..510194)
FT                   /locus_tag="bglu_1g04810"
FT   CDS_pept        complement(508899..510194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04810"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04810"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27678"
FT                   /db_xref="GOA:C5AAF6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAF6"
FT                   /protein_id="ACR27678.1"
FT                   /translation="MDHIPLWAQICAVFVLLLCSSFFSISETAMMALNRHRLKLLASKN
FT                   ALGAKTTQRLLARTDQLLSVILIGNNLFNTIIPVLTTSIALRTFGHDNLVLSIATGIVA
FT                   FLIIVFAEITPKIVGATYPERIALPASLLIAPLMRAMKPVVWLVNQLANGTLGLLRINT
FT                   KSGRDQRLSPEELRSIVLESGSFMPTKHRSILLNLFDLENITVDDVMIPRRQIESLNFD
FT                   APLDEILHQLETCYHNRLIVYQGDIDRVLGVLHVRKTLTALRNQEFDRDTLRGLLAEPY
FT                   YVPSGTAVFQQLQYFQESRQRTALIVNEYGELEGLVTPEDIIEELIGEFTTSTPRSGGS
FT                   RGGWNANGECIVAGSMPLRELNRWLSLNLPTTGPKTLNGLILEVLEEIPDGDVCMKIGD
FT                   VMLEVMRSDDQAVRTVKLFKPRAPRGVLGLLR"
FT   gene            complement(510350..510426)
FT                   /locus_tag="bglu_1gt12"
FT                   /note="tRNA-Pro1 anticodon CGG, Cove score 81.43"
FT   tRNA            complement(510350..510426)
FT                   /locus_tag="bglu_1gt12"
FT                   /product="tRNA-Pro"
FT   gene            complement(510457..511455)
FT                   /locus_tag="bglu_1g04820"
FT   CDS_pept        complement(510457..511455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04820"
FT                   /product="Octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04820"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27679"
FT                   /db_xref="GOA:C5AAF7"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAF7"
FT                   /protein_id="ACR27679.2"
FT                   /translation="MIMSSTASPSLSAAQLLAPIADDMEQINRVIRQSLSSDVLLINQI
FT                   AEYIIGAGGKRLRPALLLLVAGALGDGSSHRHTLAAVVEFIHTATLLHDDVVDESELRR
FT                   GRKTANALFGNAASVLVGDYLYSRSFEMMVGVGKMRVMEILSEATTIISEGEVLQLLNM
FT                   HDADVDESRYMQVIRYKTAKLFEASARLGAVLAGADASTEAAAAEYGRRIGTAFQIMDD
FT                   WLDYAGTAESMGKNAGDDLREGKPTLPLIHLLEHGTPEQQTLAREAIEQGGTDRFDTIF
FT                   DAITRSGALDHTLECARQEAQAAADAIFSFPSSIFKNSLLELCSYSTTRKS"
FT   gene            511771..512082
FT                   /locus_tag="bglu_1g04830"
FT   CDS_pept        511771..512082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04830"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04830"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27680"
FT                   /db_xref="GOA:C5AAF8"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAF8"
FT                   /protein_id="ACR27680.1"
FT                   /translation="MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGEGE
FT                   SIQFGTPLVSGASVKATVVSHGRHAKVTIFKMRRRKHYQKHGGHRQNYTELRIDAINA"
FT   gene            512107..512370
FT                   /locus_tag="bglu_1g04840"
FT   CDS_pept        512107..512370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04840"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04840"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27681"
FT                   /db_xref="GOA:C5AAF9"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAF9"
FT                   /protein_id="ACR27681.1"
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKVYGGQAINAGGIIVRQRGTRM
FT                   HPGDNVGIGKDHTLFALVDGYVKFATKGADKKHTVIVVPAAA"
FT   gene            512553..513674
FT                   /locus_tag="bglu_1g04850"
FT   CDS_pept        512553..513674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04850"
FT                   /product="GTPase ObgE"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04850"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27682"
FT                   /db_xref="GOA:C5AAG0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAG0"
FT                   /protein_id="ACR27682.1"
FT                   /translation="MKFIDEARIEVIAGDGGDGSASMRREKFVPFGGPDGGDGGRGGSV
FT                   YAVADRNINTLIDYRYAKKHLARNGENGRGSDCYGKGGDDITLRMPVGTVITDLDTGEL
FT                   IADLTEHEQKVLVAQGGAGGLGNLHFKSSTNRAPRQKTEGKPGERRMLRLELKVLADVG
FT                   LLGMPNAGKSTFISSVSNAKPKIADYPFTTLAPNLGVVRVGPSKSFVIADIPGLIEGAA
FT                   EGAGLGHQFLRHLQRTGVLLHLVDLAPFDEGVDPVAEATAIVGELRKYDEALYQKPRWL
FT                   VLNKLDMVPEDERAARVADFVSRFGWDGPVFEISALTGQGCENLVYAVYDYLVEHSDAH
FT                   RASEAEDLAADVRFRDAPAPGGGEAPPEPEAGD"
FT   gene            513841..514959
FT                   /locus_tag="bglu_1g04860"
FT   CDS_pept        513841..514959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04860"
FT                   /product="gamma-glutamyl kinase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04860"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27683"
FT                   /db_xref="GOA:C5AAG1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAG1"
FT                   /protein_id="ACR27683.1"
FT                   /translation="MRSIIADAKRLVVKVGSSLVTNDGRGLDHAAIGRWAAQIAALRNA
FT                   GKEVVLVSSGAIAEGMQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFAEHGIRTAQ
FT                   ILLTHADLADRERYLNARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANL
FT                   IEGDALVILTDQTGLFTADPRKDPAATLVREADAGAAELEAMAGGAGSSLGRGGMLTKI
FT                   LAAKRAAHSGANTVIASGREAEVLVRLAQGEAIGTQLIARTARMAARKQWMADHLQVRG
FT                   HVVIDAGAVEKLTAGGKSLLPIGIVAVHGVFARGEVIACVDGAGREIARGLTNYSSAET
FT                   KLIQRRPSGEIETVLGYMLEPELIHRDNLVLI"
FT   gene            complement(515053..515652)
FT                   /locus_tag="bglu_1g04870"
FT   CDS_pept        complement(515053..515652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04870"
FT                   /product="Lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04870"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27684"
FT                   /db_xref="InterPro:IPR014861"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAG2"
FT                   /protein_id="ACR27684.1"
FT                   /translation="MPRPFFEVCNLKSLAFAAASFAAVAALAGCAHSKSPSQPSNKDDS
FT                   AFVYLLDRQPTWRENPVDTLPPLPQPSNLLPFEVSQNSPLKFFVDDKSISVGSDGIVRY
FT                   TSVITSPAGARNVIYEGIRCDTYEWRQYAALNADHDGWDRTVATDWRRIENGNLNAYRA
FT                   ALYQDYFCSNKMPAAKAGTIIDNLRAHRTILNQQVR"
FT   gene            complement(515703..516335)
FT                   /locus_tag="bglu_1g04880"
FT   CDS_pept        complement(515703..516335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04880"
FT                   /product="dinucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04880"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27685"
FT                   /db_xref="GOA:C5AAG3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAG3"
FT                   /protein_id="ACR27685.1"
FT                   /translation="MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGET
FT                   PMQAMFRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRM
FT                   VGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRPD
FT                   NKARVARPTRYPRVIGVQPVDPSQICSEVEPGASPYDEAPGSFLLRD"
FT   gene            516555..518291
FT                   /locus_tag="bglu_1g04890"
FT   CDS_pept        516555..518291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04890"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04890"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27686"
FT                   /db_xref="GOA:C5AAG4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAG4"
FT                   /protein_id="ACR27686.1"
FT                   /translation="MKASRFFIGTLKEAPADAEIVSHKLMVRAGMIRRIAGGIYNYLPI
FT                   GLRSIRKVEAIVREEMNRAGAIELLMPAVQPAELWQESGRWEQYGPELLRFKDRKDNDF
FT                   VIGPTHEEVVTDIARNQIKSYRQMPVNFYQIQTKFRDEIRPRFGVMRGREFIMKDAYSF
FT                   DKDQAGLKESYRKMYDAYVRVFTRIGLEFRAVAADNGSIGGSGSHEFHVIADTGEDAIA
FT                   YCPTSDFAANVEAAEALPLLASRAAPAEAMAKVATPGKAKCEAVAELLNIPLERTIKSI
FT                   VLATENEGAEPTIWLLMLRGDHDLNEIKAAKQPGLAGYRMASEAEIVEWFGTPPGYLGP
FT                   VGTKKPVKVIADRTVANMSDFVVGANEVDYHIAGVNWGRDLPEPVVADLRNVKKGDPSP
FT                   DGKGVIDICRGIEVGHVFQLGTKYSKALGATFLDEGGKPQPMEMGCYGIGVTRILGAAI
FT                   EQNFDDRGIIWPEAIAPFEVVLCPMGYDRSELVRETADQLYAALSAAGIDVILDDRGER
FT                   PGVMFADWELIGVPHRLVIGERGLKDGKIEYQGRRDTEATLLPADGAAATVIETVRAAL
FT                   AR"
FT   gene            518365..518967
FT                   /locus_tag="bglu_1g04900"
FT   CDS_pept        518365..518967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04900"
FT                   /product="MarC family integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04900"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27687"
FT                   /db_xref="GOA:C5AAG5"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAG5"
FT                   /protein_id="ACR27687.1"
FT                   /translation="MEYNFMSATVLLLLITDPLGNIPLFIAALRDVPGERRVRVILREV
FT                   AIAFVILLVFMVVGDRFLRMMSLTDLSLRIGGGIVLFLIALRMIFPHPDGAFGSDPRAG
FT                   GEPFIVPLAIPALAGPSALATVMLLTSQAPGKTVEWIGALTVTMLVCATVLVLAGRIQS
FT                   WLGERTVMAFERLMGLVLVAISVEMILAGIRAFSHQL"
FT   gene            complement(519081..519632)
FT                   /locus_tag="bglu_1g04910"
FT   CDS_pept        complement(519081..519632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04910"
FT                   /product="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04910"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27688"
FT                   /db_xref="GOA:C5AAG6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAG6"
FT                   /protein_id="ACR27688.1"
FT                   /translation="MNREEALHIFQHSEQIVSADEVSASIGRMAAAIRDEIGEAFPLVL
FT                   SVMGGAAVFTGMLLPHLDFPLEFDYIHLTRYRNTTQGSPEMHWRVAPRESVKDRIVIVL
FT                   DDILDEGETMAAIRDRILEMGAKRFLSAVLCEKTLTKPKPLRPDFCGFSVPDRYVFGCG
FT                   MDAKGYWRNLPTIRALTAEA"
FT   gene            complement(519769..521136)
FT                   /locus_tag="bglu_1g04920"
FT   CDS_pept        complement(519769..521136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04920"
FT                   /product="Signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04920"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27689"
FT                   /db_xref="GOA:C5AAG7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAG7"
FT                   /protein_id="ACR27689.1"
FT                   /translation="MLDNLTQRMARVVKTLRGEARLTEANTQEMLREVRLALLEADVAL
FT                   PVVREFIAKVKEKALGEEVISSLSPGQALVGVVQKELTAVIGGDYEGKAVELNLAVTPP
FT                   AIILMAGLQGAGKTTTVGKLAKLLREKQKKKVLTVSCDVYRPAAIAQLKTVSEQVGADF
FT                   FPSTPEQKPVEIARAALDWARRHYHDVLIVDTAGRLGIDEAMMKEIAELHAAINPAETL
FT                   FVVDAMLGQDAVNTAKAFNDALPLTGVVLTKLDGDSRGGAALSVRSITGKPIKFVGVAE
FT                   KLDGLEVFHPDRMANRILGMGDILALVEEAQRGVDVQAAQKLADKVKKGGDFDLNDFRA
FT                   QISQMKNMGGLSSLMDKLPAQFQQAAAGADMGHAEKQIRRMEGIINSMTPAERAKPDLI
FT                   KATRKRRIAAGAGVPVQEVNRMLNQYDQMRTMMKKLKGGNMQKMMRGLKGMMPGLR"
FT   gene            521224..522123
FT                   /locus_tag="bglu_1g04930"
FT   CDS_pept        521224..522123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04930"
FT                   /product="Cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04930"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27690"
FT                   /db_xref="GOA:C5AAG8"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAG8"
FT                   /protein_id="ACR27690.1"
FT                   /translation="MDIVLYALTALLYGGLAVAGWRAHRSGLVQPLAASVPPVPGEPGA
FT                   PATAVGGADRALLFAALLAHGVLLHATIFPHDAMVFGFAFALSAMFWLGAGIYWIESFF
FT                   FPLDGLRLLVLPLACLASLLPLVFGGVRVLPYAAAPLFKMHFLIANIAYGLFVIAALHA
FT                   VLMLMTERRLQALRQGGRIGSAGVLTSWLETLPPLLTLEKLLFRLIGAGFVLLTLTLAS
FT                   GILFSEQVDARALRFDHKTVFAILSWCMFGGILVARRLSGWRGRGAARWVLASFGALLL
FT                   AYVGSRFVLEVLLHRPVV"
FT   gene            522137..522424
FT                   /locus_tag="bglu_1g04940"
FT   CDS_pept        522137..522424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04940"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04940"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27691"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAG9"
FT                   /protein_id="ACR27691.1"
FT                   /translation="MRNLLLLILLFIAGSWVSRKLRQAQERANRGGGGAPGQGGPRPSA
FT                   ARTPSLPEPMVRCALCGVHTPKGDAVEAGGDYFCSREHAARHAAAARDAQ"
FT   gene            522421..523002
FT                   /locus_tag="bglu_1g04950"
FT   CDS_pept        522421..523002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04950"
FT                   /product="N-acetyl-anhydromuranmyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04950"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27692"
FT                   /db_xref="GOA:C5AAH0"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAH0"
FT                   /protein_id="ACR27692.1"
FT                   /translation="MSEVLEVGADGWLPGARHAPSPNHEARPAGVVPTLVVVHNISLPP
FT                   GEFGGEAIVALFQNRLDCDAHPYYDLNLRGLRVSAHFLIARDGELIQFVSCEARAWHAG
FT                   ISTFLGRERCNDFSIGIELEGTDDLPFEPAQYVTLAALVRALAARYPIEAVAGHADIAP
FT                   GRKTDPGPHFDWQRLAADAGLPPRYFPYRR"
FT   gene            523461..526460
FT                   /locus_tag="bglu_1g04960"
FT   CDS_pept        523461..526460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04960"
FT                   /product="Ribonucleotide-diphosphate reductase subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04960"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27693"
FT                   /db_xref="GOA:C5AAH1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAH1"
FT                   /protein_id="ACR27693.1"
FT                   /translation="MQTTDTGTSQFESAQSRPLGTASQGAPALAPQATFADYKVIRRNG
FT                   SVVAFEPSKIAIAVTKAFLAVNGGQGAASARVRELVEQLTQSVVRALVRSRPNGGTFHI
FT                   EDIQDQVELALMRGGEHNVARAYVLYREKRHLERAHSDAPADAPAGAAGINVTDAGVTR
FT                   PLDMGALRGLIASACEGLGSAVNPDPIVAETVKNLYDGVPMSQVYDSAILAARTMIEKD
FT                   PAYSQVTARILLHTIRREILGEEVSQGEMQARYAEYFPQFLKRGVEAELLDDKLLQFDL
FT                   VRLGEALDAGRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMGLALNEIDREA
FT                   RAIEFYHVLSSFDFMSSTPTLFNSGTRRSQLSSCYLTTVADDLDGIYEALKENALLSKF
FT                   AGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETW
FT                   HLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGADWTLFSPSTCPDLHDKF
FT                   GAEFEAAYLGYEEKVARGELKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPCNVRSPQ
FT                   QHVGVVHSSNLCTEITLNTSDSEIAVCNLGSVNLVAHLVKQADGSYALDHDKLKRTVSV
FT                   AMRMLDNVIDINYYAVAKARNSNLKHRPVGLGIMGFQDCLHLLRTPFSSDAAVEFADRS
FT                   MEAVCYYAYWASTELSEERGRYSSYRGSLWDRGILPQDTLKLLEEARGGYVEVDMSSSL
FT                   DWTSLRERISLHGMRNSNCIAIAPTATISNIIGVSPCIEPTFQNLFVKSNLSGEFTVVN
FT                   EYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPSDLRAIYATAFEVDPKWLVEAASR
FT                   RQKWIDQAQSLNIFMAGASGKKLDEIYKLAWVRGLKTTYYLRTMAATHVEKSTVAHGAL
FT                   NAVPSGDGGAGGGAAGGAHGAAGGFGAAGGAGSGVLNAAPAAEAEIAVDGPVCMMRPGD
FT                   PGFEECEACQ"
FT   gene            526817..528040
FT                   /locus_tag="bglu_1g04970"
FT   CDS_pept        526817..528040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04970"
FT                   /product="Ribonucleoside-diphosphate reductase subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04970"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27694"
FT                   /db_xref="GOA:C5AAH2"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAH2"
FT                   /protein_id="ACR27694.1"
FT                   /translation="MLNWDDEKTAVTPASGAQHNAMRAPAGMAVGVQAATPAAHQAPSA
FT                   RDIFEGDLAVAPHASAAAAVAGAQERVNIADKRIINGKTDVNQLVPFKYKWAWEKYLAG
FT                   CANHWMPQEINMSRDIALWKDPNGLTEDERRIVRRNLGFFVTADSLAANNIVLGTYRHI
FT                   TAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVSSIRDKDEFLIPFIH
FT                   TLTDPAFVTGTQDADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQY
FT                   ILRDESMHCNFGIDLINQIKLENPHLWTPEFRAEIRELFKRAVELEYRYAEDTMPRGVL
FT                   GLNAAMFKSYLRFIANRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQ
FT                   TGGALSWE"
FT   gene            528116..528421
FT                   /locus_tag="bglu_1g04980"
FT   CDS_pept        528116..528421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g04980"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g04980"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27695"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAV2"
FT                   /protein_id="ACR27695.1"
FT                   /translation="MQRMACADTAHRHDRHFANPSVGWANFPPEKTAGHVAAAFIKRFG
FT                   ATAQSAPAANLIWRAVSKGTARLTVFISVSAIAKRTPMNSPLRSARPEPASARNGF"
FT   gene            complement(528447..529178)
FT                   /pseudo
FT                   /locus_tag="bglu_1g04990"
FT                   /note="disrupted gene"
FT   gene            528472..529110
FT                   /locus_tag="bglu_1g05000"
FT   CDS_pept        528472..529110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05000"
FT                   /product="Histone H1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05000"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27696"
FT                   /db_xref="GOA:C5AAV3"
FT                   /db_xref="InterPro:IPR009970"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAV3"
FT                   /protein_id="ACR27696.1"
FT                   /translation="MALAKKKPAAKKAAAKKAAPVAKKAAAPAKKAAVKKVAAKKVVAK
FT                   KAAVKKVAAKKAAPAKKAAVKKVAAKKVVAKKVAVKKVAAKKAAPAKKAAVKKVAAKKV
FT                   VAKKAPAAKKVAAKKVAVKKVAAKKAAPAKKAAVKAAAPAKKAAAKTPAPAKKAPAAKK
FT                   AAPAKKAAAAKKAAPATTTASTASVAPASGAKSALNPAAAWPFPTSSRP"
FT   gene            complement(529355..529831)
FT                   /locus_tag="bglu_1g05010"
FT   CDS_pept        complement(529355..529831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05010"
FT                   /product="Outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27697"
FT                   /db_xref="GOA:C5AAV4"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAV4"
FT                   /protein_id="ACR27697.1"
FT                   /translation="MLTRKTLTLTAMLAASVSLTGCFTPPGSADVYSASQTQREQTVRF
FT                   GTVESVRAVRIESDTGAGSTLGTLGGGALGAVAGSAIGGGRGSILTAIAGGIAGAVAGN
FT                   AIGQGVSTANGVEITVRLDNGDLRSITQAATPEVFRAGDRVRLLSSGGVTRVTH"
FT   gene            complement(529854..530792)
FT                   /locus_tag="bglu_1g05020"
FT   CDS_pept        complement(529854..530792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05020"
FT                   /product="Putative sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27698"
FT                   /db_xref="GOA:C5AAV5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAV5"
FT                   /protein_id="ACR27698.1"
FT                   /translation="MATLICGSIAYDNIMTFEGRFREHILPDQVHLINLSFLVPTMRRE
FT                   FGGCAGNIAYALHALGGDARVMGTLGAIDGQLYLDRFDSLGLARDYVRVVPDTHSAQAM
FT                   ITTDLDNNQITAFHPGAMMQSHLNHAGEARDIRLAIIGPDGFQGMVQHVEELAKAGVPF
FT                   VFDPGQGLPLFDRETLRRSIELATYLAVNDYEAKLVSDKTGWSEDELASRVQALIITRG
FT                   EHGATIRHRDGIEQIPVVKAEQIVDPTGCGDAFRGGLLYGIEKGLDWATTGRLASLMGS
FT                   IKIAHSGPQSYLLGRTEILSRFQSAFGYSIE"
FT   gene            complement(530890..531393)
FT                   /locus_tag="bglu_1g05030"
FT   CDS_pept        complement(530890..531393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05030"
FT                   /product="Redoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27699"
FT                   /db_xref="GOA:C5AAV6"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAV6"
FT                   /protein_id="ACR27699.1"
FT                   /translation="MSKVTLGGNPIDLAGEFPAVGSQAPDFKLVGQDLGELTLASFAGK
FT                   RKVLNIVPSLDTPTCATSTRKFNEAAGKLADTVVVVVSADLPFAAKRFCTTEGLENVST
FT                   ASTFRGGRDFAQAYGVDVTSGPLNGLTARAVVVIDANDKVIYTELVDEIKNEPNYDAAL
FT                   AALK"
FT   gene            complement(531488..532882)
FT                   /locus_tag="bglu_1g05040"
FT   CDS_pept        complement(531488..532882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05040"
FT                   /product="Zinc finger/thioredoxin domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27700"
FT                   /db_xref="GOA:C5AAV7"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="InterPro:IPR021834"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAV7"
FT                   /protein_id="ACR27700.1"
FT                   /translation="MPLATRCPHCETVFRISPEHLKLHGGLARCGHCQQVFDAVNALVD
FT                   PDSELAPPAAEPASTAGAAPPPPRVFPATAPHAATTPPMGASFEPGAWDMRAPWLDGGI
FT                   DPTLRHHGGNTGPAPLLPVAAAAAREVPANEAGLARGEPVVPPASGSAPVATPAADPAS
FT                   ERVPGPLPAPASEPVAESAAAPAREPAPAPADATPAAPADHGPGSGLAAPAHGASDADL
FT                   AGLVAALPRAMAEPSFGAAPPAGGHDDGARAPRGGAESGAPGMPPRETEPFAVEPEQDD
FT                   RIHFAMTRESPAGRRGSNGRQMLGGFLAGLLIVVLAGQLAWWLREPLLTNWPAAQPLFA
FT                   RACAALGCTVEPPRAIDGLRLGASDLRQLDGPRVLELKVPLSNHAALALAYPSIELTLL
FT                   DASNHVAARRVLAPADYVPPGTRIEAGLAAGTTETMFVRIDTAPGAADGAPGIAASNFR
FT                   VQIFYP"
FT   gene            complement(532928..533830)
FT                   /locus_tag="bglu_1g05050"
FT   CDS_pept        complement(532928..533830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05050"
FT                   /product="Ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27701"
FT                   /db_xref="GOA:C5AAV8"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAV8"
FT                   /protein_id="ACR27701.1"
FT                   /translation="MSYRELVAELAREHAEALSDALIELGALSVSVEDADADTPDEQPL
FT                   FGEPGLTPERTAWQHSRVIALLADTHDPAVLLAAAANEAGLGAVPSFTLREVEEQDWVR
FT                   VTQSQFDPIPIGQRIWVVPSWHDAPEPDALVLELDPGLAFGTGSHPTTRLCMEWLEQTV
FT                   EAGQSVLDYGCGSGILAILAKKCGAGRVIGIDIDPQAVESARHNSERNRAEVDYGLPDD
FT                   CPPGEFDIVVANILSNPLKLMASMLASKVRPGGRIALSGVLARQADEVAGVYARYIDMS
FT                   VWREHEGWVCLAGTRRESH"
FT   gene            complement(533833..535200)
FT                   /locus_tag="bglu_1g05060"
FT   CDS_pept        complement(533833..535200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05060"
FT                   /product="acetyl-CoA carboxylase biotin carboxylase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27702"
FT                   /db_xref="GOA:C5AAV9"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAV9"
FT                   /protein_id="ACR27702.1"
FT                   /translation="MFEKILIANRGEIALRIQRACRELGVKTVVVYSEADKEAKYVKLA
FT                   DEAVCIGPAPSNLSYLNMPALISAAEVTDAQAIHPGYGFLSENADFAERVEQSGFTFIG
FT                   PRPDTIRLMGDKVTAKQTMIRTGVPCVPGSEGALPDDPKEIVKIARAIGYPVIIKASGG
FT                   GGGRGMRVVHTEAALVNAVNMTREEAGRAFGNPQVYMEKYLENPRHIEIQVLADAHKNA
FT                   LWLGERDCSMQRRHQKVIEEAPAPGIARRLIDRIGDRCADACKKMGYLGAGTFEFLYEN
FT                   NEFYFIEMNTRVQVEHPVTELITGIDIVQEQIKIAAGEKLAIRQRDIQFRGHAIECRIN
FT                   AEDPFKFTPSPGRITSWHTPGGPGVRVDSHAYNGYFVPPNYDSMIGKLIAYGATREQAI
FT                   QRMRIALSEMVVEGIQTNIPLHRELMLDSKFVEGGTSIHYLEGRLAAKQQVAPEEA"
FT   gene            complement(535256..535723)
FT                   /locus_tag="bglu_1g05070"
FT   CDS_pept        complement(535256..535723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05070"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27703"
FT                   /db_xref="GOA:C5AAW0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAW0"
FT                   /protein_id="ACR27703.1"
FT                   /translation="MDLRKLKTLIDLVSESGISELEVTEGEGKVRIVKNAPPVYMQPAA
FT                   GYAPQVSAAAPAANPAGEGAAPAAAAPAAAAPQGHVVTSPMVGTFYRAPSPGADPFIQV
FT                   GDTVKEGQTLCIIEAMKLLNEIESDKSGVVKEILVENGQAVEYGQPLFVVG"
FT   gene            complement(535793..536245)
FT                   /locus_tag="bglu_1g05080"
FT   CDS_pept        complement(535793..536245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05080"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27704"
FT                   /db_xref="GOA:C5AAW1"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAW1"
FT                   /protein_id="ACR27704.1"
FT                   /translation="MIRLLVLHGPNLNLLGTREPEVYGRVTLAEIDRALAARAGEAGAE
FT                   LATFQSNHEGALVDRIHAARDQGTDFIVLNPAAYTHTSVAIRDALAGVGIPFVEVHLSN
FT                   VHRREPFRHHSYFSDQAEGVICGFGWKGYLHALDYALDKLRDAPRG"
FT   gene            complement(536439..536981)
FT                   /locus_tag="bglu_1g05090"
FT   CDS_pept        complement(536439..536981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05090"
FT                   /product="Redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27705"
FT                   /db_xref="GOA:C5AAW2"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAW2"
FT                   /protein_id="ACR27705.1"
FT                   /translation="MNSKRLVSAAVAAVAIAGGLAAGHWVRGDAFENTAEAAPVGDPVS
FT                   ALWAAPVTDPDGKPQSLASFKGQKVVVNFWASWCGPCVKEMPELVALSHEYRQKGIRFV
FT                   GVGVDSGQNVKAFLQKVKVDYPVVVSGYAGADLARNFGNTAGALPFTVVIDANGKVRMT
FT                   KLGEIQPDALKKTLDTL"
FT   gene            complement(536971..537633)
FT                   /locus_tag="bglu_1g05100"
FT   CDS_pept        complement(536971..537633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05100"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27706"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAW3"
FT                   /protein_id="ACR27706.1"
FT                   /translation="MPRKPLLDPRRVREEIALSAARLIAEDGLDYASAKRKAARQLLGD
FT                   SRISGEWLPDNDMLEAELHEYLALFQSETQPAELRYLRQIALDWMERLAPFSPYLAGAV
FT                   LNGTANAHSDIHLQTFSDSQKEIAIYLLNHNIQYDVSETRHFAGRGDVETLSFLWRTRQ
FT                   DTEAVGIHVALYDSEDLRGAVRADARGRLARANAAALRALLDAPATSSTSIRSEDEQ"
FT   gene            537912..539324
FT                   /locus_tag="bglu_1g05110"
FT   CDS_pept        537912..539324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05110"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27707"
FT                   /db_xref="GOA:C5AAW4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAW4"
FT                   /protein_id="ACR27707.1"
FT                   /translation="MHIHILGICGTFMGGLAVLAREAGHTVTGCDAGVYPPMSTQLEAQ
FT                   GIQLIEGYGAEQIDLAPDLFVIGNVVSRGNPLMEAILDRGLPYVSGPQWLGEHVLAGKW
FT                   VLAVAGTHGKTTTSSMLAWLLEESGLNPGFLIGGVPLNFGVSARLTESSFFVIEADEYD
FT                   TAFFDKRSKFVHYRPRTAVLNNLEFDHADIFPDLAAIETQFHHLVRTVPGVGRIVANGR
FT                   EAALDRVLARGCWSEVERFGVEGGWQALPAEDGVPVDERFAVYWQGARMGEVAWSVQGE
FT                   HNRQNALAAIAAARSVGVPPAQAARAFATFRNVKRRMEIRGSVDGVTVYDDFAHHPTAI
FT                   ETTIAGLRTRIGREHTRILAVLEPRSNTMKLGTMKAQLPASLADADLVFGYGAASGRDA
FT                   LGWSLAEALAPLGARAQAFDDLHALVKAVAAAARPGDQILVMSNGGFGGVHQKLLDALS
FT                   ARGAAHGAEDRA"
FT   gene            539321..539899
FT                   /locus_tag="bglu_1g05120"
FT   CDS_pept        539321..539899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05120"
FT                   /product="esterase YqiA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27708"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAW5"
FT                   /protein_id="ACR27708.1"
FT                   /translation="MILYLHGFRSSPRSYKSRLLAERLAALGREAEWRCPMLAVSPLEA
FT                   VALAESEVAGAAPHEVTVIGSSLGGYYATWLAEKHGWRAVLLNPATVPQRDLAQYLGEQ
FT                   PLWHGGGSVVVEPRHLAELDALRVPAVTRPERYYLIAATGDEVLDYREMLAHYPGARTR
FT                   VIEGSDHGISEFADYVDDVLAFCDAVPAR"
FT   gene            540016..542148
FT                   /locus_tag="bglu_1g05130"
FT   CDS_pept        540016..542148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05130"
FT                   /product="Ribonuclease II"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27709"
FT                   /db_xref="GOA:C5AAW6"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAW6"
FT                   /protein_id="ACR27709.1"
FT                   /translation="MNVFFEESGSFKAGSVLSRQGDAFQVELPGGRRAKVRAKDVLIEF
FT                   DKPAAGELMQQADAAAQQIDLDFLWECAPQEEFAYGTLADEYFGSGYGPVERAALVLRM
FT                   HGSPVYFRRKGRGQYQRAPEEQLKMALASLERKRQQALVQAGYEEELKARRLPAAFEGK
FT                   ALALLTRPDKNSIEYKALDAAALALGVSPARLMLDCGGVASARALHEARFLAEHFPHGT
FT                   GFPPVTVGPLPEDLPRAGVDAFSIDDVTTTEIDDAFSVEHLPENRVRIGIHIAAPALGI
FT                   TRGDEIDAIARARLSTVYMPGDKITMLPDDVVEVFTLKEGGYRPALSLYIIVDRATQDI
FT                   VANETRAEYVFVKSNLRHNTLEEVVTEETLAAGTGDYPHKDDIAVLWPLAQALFEKRQV
FT                   ARAGYGLKREVQRNTDYNFYVEGEHISITPRRRGSPLDLIVSELAILANSTWGAFLHDH
FT                   TVPGIYRSQRALGAPTGPKRTRMQTSAAPHEGLGVAQYAWSTSPLRRYVDLVNQWQLLA
FT                   CVQHGVTAKLAAPFKPKDADLYAVVQGFDDTYTAYADHQRRMEYFWCLRWLRQENRRQV
FT                   VAAVVKGDLVRLEEVPLLLHVPGLGVHARGTRVLLDVMSIDELTIEASVRLLNVLDAPS
FT                   ASDTEAADEEGEGDETLLDAPDDSAESEAEALAESGAAEGEAGALAESGAAEGEAGAPA
FT                   AGTDAGAAGSGEGDTK"
FT   gene            542180..543049
FT                   /locus_tag="bglu_1g05140"
FT   CDS_pept        542180..543049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05140"
FT                   /product="Shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27710"
FT                   /db_xref="GOA:C5AAW7"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAW7"
FT                   /protein_id="ACR27710.1"
FT                   /translation="MSESVQHPAPRDRYVVIGNPIAHSKSPAIHARFAAQTGEAVDYAH
FT                   RLAPLDGFAASVREFIAEGGRGANVTVPFKLEAHALADTLSPRAAAAGAVNTLRFDADG
FT                   AIHGDNTDGAGLVRDIEHNLGVSLAGARILLLGAGGAARGVVLPMLDRGPLSITISNRT
FT                   ASRAEQLAGQFMQAAHDAGCALAGGGAAVVERRAYDVIVNATAGSLDAALPECDPAAFG
FT                   TGTLAYDMMYGTQPTVFMQHAAALGARTADGLGMLVEQAAESFWLWRGVRPDGAPVLAA
FT                   LRDALAAA"
FT   gene            543080..543838
FT                   /locus_tag="bglu_1g05150"
FT   CDS_pept        543080..543838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05150"
FT                   /product="Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27711"
FT                   /db_xref="GOA:C5AAW8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAW8"
FT                   /protein_id="ACR27711.1"
FT                   /translation="MVIPFGTGRTRAGRPRARRHGLARWAAYAAAVLAGAWLATQLYYF
FT                   AQIALWNVIDPGSTAFMRADAWRLKADTPPVAIQHQWVPYEQISRNLKRAVIASEDADF
FT                   ANNHGYEVDAILQAWEKNRARGRIVAGGSTISQQLARNLFLSREKSYLRKGQELIITWM
FT                   LETLLDKERIFEIYLNSVEFGRGVYGAEAAARYYFKVPASRLTAWQAARLAVMLPNPKY
FT                   FDLHRNSPYLAQRTRVIARRMGAAELPASQ"
FT   gene            544256..545161
FT                   /locus_tag="bglu_1g05160"
FT   CDS_pept        544256..545161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05160"
FT                   /product="Transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27712"
FT                   /db_xref="GOA:C5AAW9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAW9"
FT                   /protein_id="ACR27712.1"
FT                   /translation="MTKTSISAAPSNGAPAAGASAERLADSISVTGSPLDIAAQQAGTQ
FT                   TLLRGLAILEAVALGARDMRAIGAALGTTRSTTHRLVSSLVQARYLRQIQGGYLLGPKL
FT                   IELGTIALEQMPLTAVARPHLEALAEATLDTIHLGMRDGDDVLYIDKIPGTRGLEMRSR
FT                   IGHRMPLASTGIGKAMMLDLEPDTWAALFEASRRSLAGVSFKPDRRPDASTFLQRMAHY
FT                   AAGGYTFDLEENEASIRCVAAPVRDASGAIVAAVSVASTIPYMPLDRMDELIPIVQREA
FT                   RAISAELGWSAPQTTRRIKR"
FT   gene            545158..546165
FT                   /locus_tag="bglu_1g05170"
FT   CDS_pept        545158..546165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05170"
FT                   /product="Putative galactonokinase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27713"
FT                   /db_xref="GOA:C5AAX0"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAX0"
FT                   /protein_id="ACR27713.1"
FT                   /translation="MTMSRTAPSPAAPALIAIDWGTTSMRAFLFAADGSVLESNAHPAG
FT                   VMNLPRAGGTAAFDAAFESACGAWLDRAPALPVLAAGMVGSAQGWREAPYVNTPVDADA
FT                   LVDGLIRVESSRGVAVAIVPGVLEPGTLPDVMRGEETQIVGALAGDAGLASGAAGALIG
FT                   LPGTHAKWAWVRDGRIERFRTYMTGELFATLRDHTILGRTMQAGEADPDAFRRGVGVAR
FT                   ESRDAGLLATIFSTRTLGLTGQLAPQAQGDYLSGLLIGHELNALVAMLAGVGTTLAAQP
FT                   PRLIGDGRLCERYLTALREFGCEGAQVVERATERGLWRIASQAGLVGAAARAVS"
FT   gene            546201..546881
FT                   /locus_tag="bglu_1g05180"
FT   CDS_pept        546201..546881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05180"
FT                   /product="4-hydroxy-2-oxoglutarate
FT                   aldolase/2-dehydro-3-deoxyphosphogluconate"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27714"
FT                   /db_xref="GOA:C5AAX1"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAX1"
FT                   /protein_id="ACR27714.1"
FT                   /translation="MSSELTLPAPYTPHDGLARAFAACPLVAIMRGLTPAEAVEHGQAL
FT                   VEAGFRLIEVPLNSPDPFASIAALRAALPAEVLVGAGTVLRPEYVDEVARAGGELIVMP
FT                   HADADVIRRAKALGLACAPGVATPSEAFAALRAGADVLKMFPAEQLGPIALKAWRAVID
FT                   ARVPLVPVGGVTPDNMGPYLSAGANGFGLGSALYKPGQSAAATARHAQAYVKGLAIARG
FT                   ASAT"
FT   gene            546878..547657
FT                   /locus_tag="bglu_1g05190"
FT   CDS_pept        546878..547657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05190"
FT                   /product="Short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27715"
FT                   /db_xref="GOA:C5AAX2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAX2"
FT                   /protein_id="ACR27715.1"
FT                   /translation="MNRLAGKTALVTGAGRGIGAAIALAFAREGAAVAIAELDEAAGGE
FT                   AAASIVRAVPGARVLVQRTDVTESASVAAAVAAAEREFGALDVLVNNAGVNVFCDPLTM
FT                   RDEDWRRCFAVDLDGVWNGCRAALPGMVERRRGSIVNIASTHASQIIPGCFPYPVAKHG
FT                   VLGLTRALGIEYASRNVRVNAIAPGYVETQLTHDWWDAQPDPRAAREATLALSPMKRIG
FT                   QPEEVAMTAVFLASDEAPFINATCITIDGGRTALYHD"
FT   gene            547786..548781
FT                   /locus_tag="bglu_1g05200"
FT   CDS_pept        547786..548781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05200"
FT                   /product="ABC sugar transporter, periplasmic ligand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27716"
FT                   /db_xref="GOA:C5AAX3"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR026266"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAX3"
FT                   /protein_id="ACR27716.1"
FT                   /translation="MKRRTFVTLAAAAAILAGAPVVHAADPVKIGFLVKQPEEPWFQDE
FT                   WKFAEMAAKAKGFTLVKIGAPSGEKVMSAIDNLSAQQAQGFIICTPDVKLGPGIVAKAK
FT                   SHNLKMMTVDDRLVDGSGKPIASVPHMGISAYNIGKQVGDGLAAEIKKRGWNMAEVGAI
FT                   DITYEQLPTAHDRTTGATDALVAAGFPKANVIAAPQAKTDTENAFNAANIALTKNPQFK
FT                   HWVAYGLNDEAVLGAVRAAEGRGFKADNMIGIGIGGSDSALNEFKKPQPTGFYGTVIIS
FT                   PKRHGEETADLMYAWITQNKMPPMLTLTTGMLATRTNVNMVRTEMGLASN"
FT   gene            548871..550382
FT                   /locus_tag="bglu_1g05210"
FT   CDS_pept        548871..550382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05210"
FT                   /product="Arabinose import ATP-binding protein araG"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27717"
FT                   /db_xref="GOA:C5AAX4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017917"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAX4"
FT                   /protein_id="ACR27717.1"
FT                   /translation="MTAVLRFDNIGKVFPGVRALDGISFDVHAGQVHGLMGENGAGKST
FT                   LLKILGGEYQPDSGSVLVDGEPVRFTSAAASIGAGIAVIHQELQYVPDLTVAENLMLGR
FT                   LPNAFGWVRKGDARRHVRERLQAMGVDLDPQAKLRRLSIAQRQMVEICKALMRNARVIA
FT                   LDEPTSSLSHRETEVLFKLVEELRAQGRALIYISHRMDEIYRLCDACTIFRDGRRIASH
FT                   PKLAEVPREQLVSQMVGREINDIYHYRPRALGEVRLEVDGLAADKLRAPVSFKVRAGEI
FT                   VGFFGLVGAGRSELMRVIYGADRRRGGTVTLDGRRIEVRRTGDAIRHGIVLCPEDRKEE
FT                   GIVAMATVAENINISCRRHSLRAGLFLNGRQEAETAERFIKLLKIKTPSRRQKIRFLSG
FT                   GNQQKAILSRWLAEPDLKVVILDEPTRGIDVGAKNEIYQVIYELAERGCAIVMVSSELP
FT                   EVLGVSDRIVVMREGRIAGEIARAEANEQVVLSLALPQGPAEQAA"
FT   gene            550454..551470
FT                   /locus_tag="bglu_1g05220"
FT   CDS_pept        550454..551470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05220"
FT                   /product="L-arabinose transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27718"
FT                   /db_xref="GOA:C5AAX5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAX5"
FT                   /protein_id="ACR27718.1"
FT                   /translation="MQAKESITQAAAKRTAEALIPQTSDRQKWWQQITDYSLIVIFAVM
FT                   FITMSVTVDHFFSIDNMLGLALSISQIGMVACTMMFCLASRDFDLSIGSTVAFSGVLCA
FT                   MVLNATDNTFVAIVAAIAAGAAIGFVNGAVIAYLRINALITTLATMEIVRGLGFIVSHG
FT                   QAVGVSSETFIALGGLTLFGVSLPIWVTLLCFIVFGVLLNQTVYGRNTLAIGGNPEASR
FT                   LAGINVERTRVWIFLIQGAVTALAGVILASRITSGQPNAAEGFELNVISACVLGGVSLL
FT                   GGRATISGVVIGVLIMGTVENVMNLLNIDAFYQYLVRGAILLAAVLLDQLKNRGARD"
FT   gene            551491..552279
FT                   /locus_tag="bglu_1g05230"
FT   CDS_pept        551491..552279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05230"
FT                   /product="Putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27719"
FT                   /db_xref="GOA:C5AAX6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAX6"
FT                   /protein_id="ACR27719.1"
FT                   /translation="MNQAMAADAARGARYPSLTDRAVLITGGATGIGAAFVAHFAAQGA
FT                   RVGFVDLDAEAGAALVETLADARHAPVFAAADITDIDALRRAIEALRANTGPITVLVNN
FT                   AANDRRHRIEDVTPESFDAAIAVNLRHQFFAAQAVADDMKAAGSGAIINLGSIGWMLKN
FT                   GGYPVYATSKAAVQGLTRALARDLGPFGIRVNTLVPGWVMTDKQRRLWLDDAGRAAIKA
FT                   GQCLEAELLPDDLARAALFLASDDSRMMTAQDVVVDGGWA"
FT   gene            552344..553399
FT                   /locus_tag="bglu_1g05240"
FT   CDS_pept        552344..553399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05240"
FT                   /product="Aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27720"
FT                   /db_xref="GOA:C5AAX7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAX7"
FT                   /protein_id="ACR27720.1"
FT                   /translation="MTTSTPGNAASASAARSRRARLAAAAQPVSAGPQTSSVAQGVHAA
FT                   ADAAVTLASAELRLDVVPHLGGGIARFDWRGDGAATPIFRGCDHVDAGTDPNALGCYPL
FT                   LPYSNRIGGGRFECEGRRVEVPRNRQAEPLPIHGDGWLARWHLDEVSPTALQLSLDRRG
FT                   GAPYAYRATQSYALDGATLTIALAIENCGAERLPFGLGLHPFIVREAGTELAAAANGLW
FT                   LSGADWLPRRHVMVPPAWQFGIAYPLPATLVNHAFTGWGGRASVAWPSRGLTLGIESDA
FT                   GCYVLYTPPGESFFCFEPVDHPINAVNLPGGAEQHGMTLLGPGARLARRFRFTVERAQV
FT                   RRLAGSRGGSG"
FT   gene            553436..554263
FT                   /locus_tag="bglu_1g05250"
FT   CDS_pept        553436..554263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05250"
FT                   /product="Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27721"
FT                   /db_xref="GOA:C5AAX8"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAX8"
FT                   /protein_id="ACR27721.1"
FT                   /translation="MSAPLTFIDTLRAAWQRTNSLLCVGLDPEPTRFPAQFTNRPEAIF
FT                   DFCREIVDATAPYASAFKPQIAYFAAHRAEDQLERLIAHIHLQHPGLPVVLDAKRGDIG
FT                   STAEQYAREAFERYRADAVTVNPYMGYDSIEPYLGYEDKGVVVLCRTSNPGGSDLQFLE
FT                   TGGRPLYQVVAELAATRWNEKTGQLALVVGATFPKEIEIVRGIVGAMPLLIPGIGAQGG
FT                   DVQATVAAGRSADGGGMMINSSRAILYASSGDDFAEAAARVAQATRDTINAHR"
FT   gene            complement(554387..554887)
FT                   /locus_tag="bglu_1g05260"
FT   CDS_pept        complement(554387..554887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05260"
FT                   /product="CinA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27722"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAX9"
FT                   /protein_id="ACR27722.1"
FT                   /translation="MPTDSVVHQLAIRAGNKLRDEHLALATAESCTGGMIAAAITDISG
FT                   SSAWFERGFVTYSNQAKTEMIGVPHELIEKHGAVSEPVARAMVEGALRNSRAQVALSVT
FT                   GIAGPGGGSEHKPVGTVSFGWSNRLHTEVETLVFKGDREQIRTQAAAHALRGLLKLLDE
FT                   RER"
FT   gene            complement(554898..555530)
FT                   /locus_tag="bglu_1g05270"
FT   CDS_pept        complement(554898..555530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05270"
FT                   /product="Phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27723"
FT                   /db_xref="GOA:C5AAY0"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAY0"
FT                   /protein_id="ACR27723.1"
FT                   /translation="MATSDDPAPRADAPRPGTALATVHGQGRASPRAGRPEAAAGDVQP
FT                   PPRRASAPFMRSHPLHLLSLGFGTGLAPLAPGLVGSLFGWLSFAAFAPRLSPAATLALI
FT                   ALGLVLGVIATGRTARALGGGRPRAIVWDHVVAIWLVMLLVTPATFSQQLAAFVLFRLF
FT                   DGGKLPPVRHIDRRLKAGFGIMLDDLVAAFLTLLVIATWRALFSPLR"
FT   gene            complement(555517..556506)
FT                   /locus_tag="bglu_1g05280"
FT   CDS_pept        complement(555517..556506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05280"
FT                   /product="Thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27724"
FT                   /db_xref="GOA:C5AAY1"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAY1"
FT                   /protein_id="ACR27724.1"
FT                   /translation="MSEFSLIDRYFARRARRPNARAALGIGDDCALLAPHPDTMLAIST
FT                   DMLVEGRHFFPDVAPRALGHKTLAVNLSDLAAMGAQPRAFTLAFALPRADADWLDAFAD
FT                   GLFTIADRYGCELVGGDTTSGPLNLCVTVFGDVGPDRALRRDAARPGDEVWVSGTLGDA
FT                   RAGLGVARGEWTAGTAEHATFRRALEWPEPRVALGLALAGIAHAALDVSDGLAGDLRHI
FT                   LERSRVSADIEVDAVPRSAALATLAPELQRLCTLAGGDDYELCFTAPAAAHAAVLAAGT
FT                   TAGVAVTRIGTIRALAAPEEAPGIRWLDGAGTPLALTLRGFDHFHGDQ"
FT   gene            556687..558987
FT                   /locus_tag="bglu_1g05290"
FT   CDS_pept        556687..558987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05290"
FT                   /product="malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27725"
FT                   /db_xref="GOA:C5AAY2"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR032683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAY2"
FT                   /protein_id="ACR27725.1"
FT                   /translation="MSTKSSPKADLRAAALDYHEFPTPGKIAVQPTKQMINQRDLALAY
FT                   SPGVAFACEEIVENPLNAARFTSRSNLVGVVTNGTAVLGLGNIGPLASKPVMEGKAALF
FT                   KKFAGIDVFDIELNESDPHKLVEVIAALEPTFGGINLEDIKAPDCFIVERECRKRMKIP
FT                   VFHDDQHGTAIVVAAAVTNGLKVVGKDIKQVKLVASGAGAAALACLDLLVDIGLPLENI
FT                   FVTDLAGVVYRGRAELMDPDKERFARETDARTLAEVIEGADIFLGLSAAGVLKQEMVKG
FT                   MAERPLILALANPTPEILPEVAHEVRPDAILATGRTDYPNQVNNVLCFPFIFRGALDVG
FT                   ATTITREMEIAAVNAIAELAQQEQSDIVATAYAIEDLSFGPEYLIPKPFDPRLIVKIAP
FT                   AVAKAAMEGGVATRPIEDMDAYVQHLQQFVYHSGNTMKPVFQAARSAPLEKKRVVFAEG
FT                   EEERVLRAVQILVDEHVAKPILIGRPHVIENRIKRFGLRIAPGVDFTIVNTEHDERYRD
FT                   FWQTYYQLMVRKGMGPQLAKLEMRRRTTLIGAMLVKKGEADGMICGTISTTHRHLHFID
FT                   QVIGKREGCSVYAAMNGLVLPGRQIFIVDTHVNVDPTPEQLAEITMMAAEEVRRFGIEP
FT                   KVALLSHSNFGTSNAPTAQKMRDTLALLKERAPGLEVDGEMHGDVALDPLLRKEILPDS
FT                   TLEGEANLLVLPNIDAANIAYNLLKTAAGNNIAIGPILLGAARPVHVLTESATVRRIVN
FT                   MAALLVADVNATR"
FT   gene            559525..559947
FT                   /locus_tag="bglu_1g05300"
FT   CDS_pept        559525..559947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05300"
FT                   /product="guanyl-specific ribonuclease Sa"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27726"
FT                   /db_xref="GOA:C5AAY3"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAY3"
FT                   /protein_id="ACR27726.1"
FT                   /translation="MARKWLRNGALASVFALVALGSAGLPAGSAISLAYAREAVSSMAP
FT                   VGTIPTSRLPSEAVTTLGLIAAGGPYPYPKDGAVFGNFERILPKMRRGYYHEYTVPTPR
FT                   ARNRGAKRIVCGGPLRRVDNCYYTDDHYASFKRIVE"
FT   gene            559955..560530
FT                   /locus_tag="bglu_1g05310"
FT   CDS_pept        559955..560530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05310"
FT                   /product="Barstar family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27727"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAY4"
FT                   /protein_id="ACR27727.1"
FT                   /translation="MIGMGDTTYAHEMSAAADLFAAGDGNLFQRVMRLRALAQAGDAAQ
FT                   PPAICPGDSSTEEPMSLFATVRPNIVQSIRAFRVHDLAEEAARLGQHFLFAYCGAAQSK
FT                   QEVLETIATSFLFPKHFGKNYDALYDSLTDLIHKAGEQPGFVIVLEALPIAQKFDKEGR
FT                   ETLLDVFREAAEFWAERKIAFRVFYSFA"
FT   gene            complement(560680..561441)
FT                   /locus_tag="bglu_1g05320"
FT   CDS_pept        complement(560680..561441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05320"
FT                   /product="16S ribosomal RNA methyltransferase RsmE"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27728"
FT                   /db_xref="GOA:C5AAY5"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAY5"
FT                   /protein_id="ACR27728.1"
FT                   /translation="MSGSTSAIPRFFVDRPLQADSEVMLPAEVARHVQVLRLEPGDPLT
FT                   LFDGTGGQYRAELVELGKRNAVARTVGFDARELETPYRVTLAQGIAGGDKMDWLIEKAV
FT                   ELGVTALAPLSTARGVVRLSGERADKRVAHWQGVVRAACEQCGRNRVPAVAPIAELSAW
FT                   LDALPPAADAELRLMLSPRASIAFAALPATAPAGTVTLLIGPEGGLSPAEEDAARKHGF
FT                   QAIVLGARVLRTETAGMAMLAALAARWGGWE"
FT   gene            complement(561438..561854)
FT                   /locus_tag="bglu_1g05330"
FT   CDS_pept        complement(561438..561854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05330"
FT                   /product="Glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27729"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAY6"
FT                   /protein_id="ACR27729.1"
FT                   /translation="MTGPRPADVPWLTPYLTVRSAAASIAFYGSAFGFEKRELIDEDGA
FT                   LMHVEMSYHGQLILMFAPEGAFGSTARTPRSAGLTAPQSFYLYVDDVDAVYRRALEAGA
FT                   KSLSEPRDQFWGDRFAQVEDLDGYRWALARRIEQ"
FT   gene            complement(561900..562757)
FT                   /locus_tag="bglu_1g05340"
FT   CDS_pept        complement(561900..562757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05340"
FT                   /product="Spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27730"
FT                   /db_xref="GOA:C5AAY7"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAY7"
FT                   /protein_id="ACR27730.1"
FT                   /translation="MNTTLCFQPCPDAIYGFPNASRLAAFASPYQRIEVWDTPLLGRLF
FT                   TLDGRPMTSVGDEAVYHECMTHPAALAHPRPRRALVLGGGDGGAARQLLKHPSIERIVI
FT                   AELDAAVVEMARRHLEAVHRGAFDDPRVELVIGDAADYVDHTPLRFDLVVFDLTPPDSP
FT                   AAGLYTRAFLARLKRRLTPCAALSMHLGAPAFHAPRIAGLVAELRASFAVVAPLAAPVP
FT                   LYGGEWLMAVASDTLDAGALFAHDIEQRLAARGIADLRFYDAGLHPALFTLRRALRDTL
FT                   GMRH"
FT   gene            563173..565194
FT                   /locus_tag="bglu_1g05350"
FT   CDS_pept        563173..565194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05350"
FT                   /product="Transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27731"
FT                   /db_xref="GOA:C5AAY8"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAY8"
FT                   /protein_id="ACR27731.1"
FT                   /translation="MTTSSTASTSLMANAIRALAMDAVQQANSGHPGMPMGMAEIGVAL
FT                   WSRHLKHNPANPHWADRDRFVLSNGHGSMLLYSLLHLTGYDLPIEELKNFRQLHSKTPG
FT                   HPEYGITAGVETTTGPLGQGLANAVGMALAEALLAAEFNKDGATIVDHHTYVFLGDGCL
FT                   MEGISHEACSFAGTLKLNKLIALYDDNGISIDGDVVNWFHDDTPKRFEAYGWNVIPGVD
FT                   GHDVDAVDAAIAKAKLSDKPTLICCKTVIGKGAATKAGGHDVHGAALGAEEIAKTRAAL
FT                   GWNWEPFVIPQEVYAAWDGKAAGAKRESDWNAVFEAYRAKFPAEADEFVRRMAGKLPAD
FT                   WAQKAAAIVAGANERGETVATRKASQQTIEGLAAALPELIGGSADLTGSNLTNWKASKP
FT                   VRAGEKGIQWGNHINYGVREFGMSAAINGIVLHGGYKPFGGTFLTFSDYSRNALRVAAL
FT                   MKAPSLFVFTHDSIGLGEDGPTHQSIEHVSSLRLIPHLDVWRPADTVETAVAWTEAVAA
FT                   QRPSCLIFSRQNLAFNARSDAQLANVAKGGYVLRDWDEEVVARKIILIATGSEVELAMK
FT                   AVEPLAQQGIAARVVSMPATTVFDRQDAEYRERVLPAGVRRVAIEAGVTDFWRKYVGLE
FT                   GGVIGIDSFGESAPAGVLFKYFGFTIENVVETAKRVLA"
FT   gene            565288..566298
FT                   /locus_tag="bglu_1g05360"
FT   CDS_pept        565288..566298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05360"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27732"
FT                   /db_xref="GOA:C5AAY9"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAY9"
FT                   /protein_id="ACR27732.1"
FT                   /translation="MTIRVAINGYGRIGRNTLRAFYENGKKHDIEIVAINDLGDAKTNA
FT                   HLTQYDTAHGKFPGEVSVDGDYLIVNGDRIRVLANRNPAELPWGELGVDVVFECTGFFT
FT                   TKEKASAHLKGGAKKVIISAPGGKDVDATIVYGVNHQVLKAEHTVISNASCTTNCLAPL
FT                   VKPLHDKIGLETGLMTTVHAYTNDQVLTDVYHEDLRRARSATHSQIPTKTGAAAAVGLV
FT                   LPELNGKLDGYAIRVPTINVSIVDLSFIAKRDTTVEEVNAIMKEASEGSLKGILAYNDQ
FT                   PLVSIDFNHNPASSSFDSTLTKVSGRLVKVSSWYDNEWGFSNRMLDTAVAFANAK"
FT   gene            complement(566476..567168)
FT                   /locus_tag="bglu_1g05370"
FT   CDS_pept        complement(566476..567168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05370"
FT                   /product="GntR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27733"
FT                   /db_xref="GOA:C5AAZ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAZ0"
FT                   /protein_id="ACR27733.1"
FT                   /translation="MKNLPHTVTDAAIATIQARIETGVYPVGSLLPAQRQLSEELDISR
FT                   ASLREALSTLEALGMLTIRPGKGVYVERAQAGADHPWRFAERSSPPDTYQMRYALEGFT
FT                   ARMAALAVSDVDLAWFEENLAALHVALVDNALDDASQLDFEFHMRIVGLAGNAAIESIL
FT                   RNSADIMKESQRMPFYRRELMLSTFHEHRVILDALIARDPAAAGRAIETHIRGAAQRAG
FT                   VFFPTPPG"
FT   gene            567384..568706
FT                   /locus_tag="bglu_1g05380"
FT   CDS_pept        567384..568706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05380"
FT                   /product="C4-dicarboxylate transporter DctA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27734"
FT                   /db_xref="GOA:C5AAZ1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAZ1"
FT                   /protein_id="ACR27734.1"
FT                   /translation="MAKFLNSLFGRVMIALVIGIALGAAFPHAAQSLRPLGDGFLKLIK
FT                   MVIGPIVFCVVVSGIANAGDLRKVGRVGLRAVIYFELMTTFALAIGLVLAELTRPGAGM
FT                   NVDVGALDPASLADYAKHAQSLKDTAGYLLKIIPDTAFDAFAKGDILQILVFAVPFGVA
FT                   LSMLGERARALSGLIDEFAQVCFRVMGFIVRLAPLGVLGAIAYTTGKYGVASLEQMGLL
FT                   VAVFYLACLLFVVVVLGAVMRLAGFSVFKLIRYLREELMIVLGTASSDAVLPQVMRKLE
FT                   WMGVKDSTVGLVIPTGYSFNLDGFSIYLTLAVLFIAQATNTPLSAHDLIVVLLVSLVTS
FT                   KGAHGIPGSAIVILAATLSAIPALPVLGLVLILPVDWFVGIARAVTNLLGNCVATVVVA
FT                   VWEHDIDAARARRVLNRELRYVPSGDAPAGELAPEEPAPAL"
FT   gene            568804..569814
FT                   /locus_tag="bglu_1g05390"
FT   CDS_pept        568804..569814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05390"
FT                   /product="Allantoicase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27735"
FT                   /db_xref="GOA:C5AAZ2"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAZ2"
FT                   /protein_id="ACR27735.1"
FT                   /translation="MAAPILDPDAPAFTRRYPNLADPRLGARALAASDEFFAPKERMLD
FT                   PEPAVFIPGKYDDHGKWMDGWETRRKRTAGHDWCIVKLARPAVVHGVDLDTSHFTGNFP
FT                   PAASIDACRAEGELPPDDADWQPLVAAATLQGNRHHYVEVREARVVTHLRVNLYPDGGL
FT                   ARLRVYGQPQRDWSRVPAGELVDLAATENGAYLVAANNEHFGAASRLLMPGRGLNMGDG
FT                   WETRRRREPGNDWAIVALARPGIIRRIEVDTAHFKGNYPDRCSLQAARVTGGTDGSLVT
FT                   QAMFWPELLGEQALSMDSVHVFEPGGAASGIVTHVRFNIFPDGGVSRLRLWGEPA"
FT   gene            569831..570364
FT                   /locus_tag="bglu_1g05400"
FT   CDS_pept        569831..570364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05400"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27736"
FT                   /db_xref="GOA:C5AAZ3"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAZ3"
FT                   /protein_id="ACR27736.1"
FT                   /translation="MNDSRSAVPLRLEPLTRAAFAPFGDVIELAGARHFPINGGTTERF
FT                   HDLATIDVGTAGGRPLVSLFRGQPRDWPIEIAMMERHPLGSQAFVPLATQGRYAIVVAP
FT                   AGEFDARRLRAFLAQGWQGVNYAKGVWHHPLLALDRVSDFVVIDRGGNGEPNCDEIALD
FT                   LPRLLLAPASPAAA"
FT   gene            complement(570581..571009)
FT                   /locus_tag="bglu_1g05410"
FT   CDS_pept        complement(570581..571009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05410"
FT                   /product="Ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27737"
FT                   /db_xref="GOA:C5AAZ4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAZ4"
FT                   /protein_id="ACR27737.1"
FT                   /translation="MTNPTELKNIGLKATLPRLKILEIFQQSEVRHLTAEDVYRNLLHE
FT                   QLDIGLATVYRVLTQFEQAGLLTRSNFESGKAVFELNEGSHHDHLVCLDCGRVEEFFDA
FT                   EIENRQQAIAKTRGFKLQEHSLAMYGSCTTEDCPHRKH"
FT   gene            571163..572065
FT                   /locus_tag="bglu_1g05420"
FT   CDS_pept        571163..572065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05420"
FT                   /product="Outer membrane lipoprotein, SmpA/OmlA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27738"
FT                   /db_xref="GOA:C5AAZ5"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAZ5"
FT                   /protein_id="ACR27738.1"
FT                   /translation="MRSAITAAVAVAVVTLAGCSSYDSVTQRIAQSITPYRITVVQGNF
FT                   VSQEKAAQLQVGMTRDQVRTLLGTPLLTDMFHADRWDYLFYFKRGSTSVVQQRDLVLHF
FT                   QNDRLASWSGAENLPTELDLLADIDGDRRGKRAAKAAAKAAAEQAAAASAASAAAAAAP
FT                   APAAAAPAPSLPPDMAASPAAGASSASSAAAPAAGGQSAANTEAARAANRATAQVPGQG
FT                   AQHRFKPSAQSAPSAPTPGGMPPGASPAIQPQFQFQRPPQPSAPSDAAPPVGPRGTDVL
FT                   PNQPLTAPPADISAPPNSN"
FT   gene            572156..572953
FT                   /locus_tag="bglu_1g05430"
FT   CDS_pept        572156..572953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05430"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27739"
FT                   /db_xref="GOA:C5AAZ6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAZ6"
FT                   /protein_id="ACR27739.1"
FT                   /translation="MKIAIAGASGRMGRMLIEAVLNDPDATLAGALGRPGSAHLGQDAG
FT                   AFLGKPTGVIVTDDVERVFADADYLIDFTRPDTTLGYLDAAQRHGVKLVIGTTGFSEPQ
FT                   KARLRAAAARIGMVFSANMSVGVNVTLKLLEFAAKQFAQGYDIEIIEAHHRHKVDAPSG
FT                   TALMMGETVAASLGRQLADCAVYDRHGETGPRDPSTIGFTAIRGGDIVGDHTVLFAGIG
FT                   ERIEITHKSSSRVSYAQGSMRAVRFLADKPSGLFDMQDVLGLR"
FT   gene            572984..573673
FT                   /locus_tag="bglu_1g05440"
FT   CDS_pept        572984..573673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05440"
FT                   /product="transporter, MotA/TolQ/ExbB proton channel
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27740"
FT                   /db_xref="GOA:C5AAZ7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAZ7"
FT                   /protein_id="ACR27740.1"
FT                   /translation="MATDTGVIHYLASGDAVTHAVAYLLLAMSVASWCCLLLKAWTLVR
FT                   ARRASAGAIAAFWRAGSFDAGLAALRAADRERVFVPLAAAADAAAREAAAGAALLGARV
FT                   APGERVLRAVREAMRGSQRRLEFGLVLLASIASTAPFVGLLGTVWGIYHALGSIAASGQ
FT                   AQIGSVAGPVGEALIMTAFGLVVAIPAVLAYNMLGRLVRQLVEDLDGFARDLHAFAGGA
FT                   PERDARA"
FT   gene            573683..574150
FT                   /locus_tag="bglu_1g05450"
FT   CDS_pept        573683..574150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05450"
FT                   /product="Putative transport-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27741"
FT                   /db_xref="GOA:C5AAZ8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAZ8"
FT                   /protein_id="ACR27741.1"
FT                   /translation="MAFGGLDPREPAAPMAEINMTPLIDVMLVLLVIFIITAPLLTHAI
FT                   RLDLPKAAAAPARERPDTITLSIDADGRLFWGAAPIGEAALAGRFRAAVARGGTPELHV
FT                   RAAAAARYDTIARVMSAAQAAGLTRIGFVTEPDPGGAPPGPARAAPLAPGR"
FT   gene            574401..576995
FT                   /locus_tag="bglu_1g05460"
FT   CDS_pept        574401..576995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05460"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27742"
FT                   /db_xref="GOA:C5AAZ9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:C5AAZ9"
FT                   /protein_id="ACR27742.1"
FT                   /translation="MQERYVPADVEAAAQRDWRDADAYLTKEDSQKPKFYCVSMLPYPS
FT                   GKLHMGHVRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAMANGVPPAKWTYDN
FT                   IAYMKRQMQAMGLAIDWSREIATCNPDYYKWNQWLFLKMLEKGIAYKKTGTVNWDPVDQ
FT                   TVLANEQVIDGRGWRSGAVVEKREIPMYYLRITQYADELLDDLEGLGWPERVKVMQQNW
FT                   IGKSFGVNFGFPYELDGEQKLLRVFTTRADTIMGVTFCAVAAEHPLATRLAEGRPELLA
FT                   FIDECKQGGVAEADMATMEKKGMATGFSVKHPLTGEPVPVWIGNYVLMSYGEGAVMGVP
FT                   AHDERDFAFAAKYGLPIKQVIAAEGETYSTDAWQEWYGDKTKGVCVNSGKYDGLGHEAA
FT                   VDAVAADLAAGGFGDKQVTWRLRDWGVSRQRYWGTPIPIIHCPSCGDVPVPEADLPVVL
FT                   PEDLVPDGSGNPLAKSEAFVNCTCPKCGAAAKRETDTMDTFVDSSWYFSRYTAPDAATM
FT                   VAARTDHWMPMDQYIGGIEHAILHLLYSRFWTKVMRDLGLVKFGEPAKNLLTQGMVLNE
FT                   TFYREDATGKKTWFNPADVTVTHDDKGRPVGAVHNADGQPVVLGGIEKMSKSKNNGVDP
FT                   QVLIDQHGADTARLFTMFAAPPEQQLEWSGAGVEGASRFLRRVWAFGAAHREALAVRAG
FT                   FDAAQLDEGARALRREIHGVLRQADFDYQRLQYNTVVSAAMKMLNAIEAAKAAPAGVLR
FT                   ETYGILLRVLYPVVPHITFALWQALGYADEFGTLLDAPWPKVDEAALEQAEIELVLQIN
FT                   GKVRGAIKVAKDAGRDVIEAAALADESFAKFGEGKPAKKVIVVPGRLVNVVV"
FT   gene            577024..577575
FT                   /locus_tag="bglu_1g05470"
FT   CDS_pept        577024..577575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05470"
FT                   /product="lipoprotein, RlpB family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27743"
FT                   /db_xref="GOA:C5AB00"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB00"
FT                   /protein_id="ACR27743.1"
FT                   /translation="MIRRSFVMVMGSALLLSACGFQLRGTQNYAFKHLLIVGAPPFVEA
FT                   RLKRLVEGGSDTRIVTTLDQADAVLRVGESRGTSTLTLDQFGTVEEYQLNYSLNYTLTS
FT                   RDGALLIAPSVISLNRAMTYNAQFVQAKAQESDILYADMQNDAVDQLTRRLSIVRTLTP
FT                   GPSDVAPGVAPRAPLPPPPL"
FT   gene            577626..578765
FT                   /locus_tag="bglu_1g05480"
FT   CDS_pept        577626..578765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05480"
FT                   /product="DNA polymerase III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27744"
FT                   /db_xref="GOA:C5AB01"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB01"
FT                   /protein_id="ACR27744.1"
FT                   /translation="MQLRLDALEAHLAKTLAGLYTVYGDEPLLVQEACDRIRAAARAGG
FT                   FTERSVFTVERSFDWSSLLGASQAMSLFGERQLIELRIPSGKPGKEGADALKTLAGAGN
FT                   PDVLMLVTLPRLDAATQKSAWFTALGNGGVALKIDPVDRAQLPNWIGQRLAAQGQRVAA
FT                   GEDGRRALQFIAERVEGNLLAAHQEIQKLGLLYPSGTLALDQVQDAVLNVARYDVFKLN
FT                   EAMLAGDAGRLARMIDGLKGEGEALVLVLWAVVEELRTLLRIKRGVAAGKPLAVLVREN
FT                   RVWGPRERLIGPALSRVSEAVLEAALALAARLDRQVKGLSGMAPGLPRVDEPPPDPWDG
FT                   LFQLAMTVAGAQGSPAAGSGTRGAAGARAAAFAAPRRPA"
FT   gene            578888..580159
FT                   /locus_tag="bglu_1g05490"
FT   CDS_pept        578888..580159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05490"
FT                   /product="Gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27745"
FT                   /db_xref="GOA:C5AB02"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB02"
FT                   /protein_id="ACR27745.1"
FT                   /translation="MDIDQYMTDVGRRARQASRAIARADTAAKNAALAAIATAIEREAG
FT                   ALKAANARDVERARAKGQDAAFVDRLTLSDKALKTMLDGLRQVAALADPIGEISNLKFR
FT                   PSGIQVGQMRVPLGVIGIIYESRPNVTIDAAALCLKSGNATILRGGSEALESNTALARL
FT                   IGEGLAAAGLPADAVQVVETADRAAVGRLITMTEYVDVIVPRGGKSLIARLIEEARVPM
FT                   IKHLDGICHVYVDDRADLAKALSVCDNAKTHRYGTCNTMETLLVARGIAPAVLPQLGRL
FT                   YRDKSVELRVDAAAKAVLAAAGVGPLVDATEEDWRTEYLAPVLAIKLVDGLDAAIEHIN
FT                   AYGSAHTDAIVTEDHDRAMRFLREVDSASVMVNASTRFADGFEYGLGAEIGISNDKLHA
FT                   RGPVGLEGLTSLKYVVLGHGEGRQ"
FT   gene            580233..580655
FT                   /locus_tag="bglu_1g05500"
FT   CDS_pept        580233..580655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05500"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27746"
FT                   /db_xref="GOA:C5AB03"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB03"
FT                   /protein_id="ACR27746.1"
FT                   /translation="MTYLWVKTFHIVLIAAWFAGLFYLPRIYVNLAMESDPGAVRRLLA
FT                   MARKLFRFMSFIAVPALACGLWLWLVAGVGRGQGWIHAKLTIVLLLIVYHVYCGHLLRV
FT                   FERGENRRSDRWYRFFNELPVLGMLGAVALAVIKPF"
FT   gene            complement(580762..581658)
FT                   /locus_tag="bglu_1g05510"
FT   CDS_pept        complement(580762..581658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05510"
FT                   /product="Transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27747"
FT                   /db_xref="GOA:C5AB04"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB04"
FT                   /protein_id="ACR27747.1"
FT                   /translation="MLPRIEALRAQLRPSERKLADYMLAAPREILDLSMTELAARAGVS
FT                   QPTIARFCHALGCSGFREFKIRLAQSVAPGVPSVYRDVEPDEPAPGIIGKVFDRTIGAL
FT                   IEVRNSLSAGSVAEAIALLARASRIEFYGAGGSGIAAQDVQHKFFRLGMPSVAYSDPHT
FT                   FSMSAALLGAQDVVVAISNTGRTRDIVEAAKSALACGAKVVSITHSHSPLAQLASVNLA
FT                   SNIAEETDVFSPMTSRMSHLAIGDILAVGVALQRGPALVDRLGRAKAAITRRRIEPDGK
FT                   PAERRGARDGKETETQA"
FT   gene            581948..583813
FT                   /locus_tag="bglu_1g05520"
FT   CDS_pept        581948..583813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05520"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27748"
FT                   /db_xref="GOA:C5AB05"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB05"
FT                   /protein_id="ACR27748.1"
FT                   /translation="MASPHPTLVNVTERVIARSRPTRTAYLDRIAAAQGRFPARGALSC
FT                   ANLAHGFAGLEGNDKFVIKAIREPNIGIVSSYNEMLSAHAPYVSYPDIIKAAARENGGV
FT                   AQFAGGVPAMCDGVTQGNPGMELSLFSRETIAMSTAIALTHNMFDAALCLGICDKIVPG
FT                   LLIGALQFGHLPTIFVPAGPMTSGLSNDDKAKIRQQFATGQVGRDALLEAESAAYHGQG
FT                   TCTFYGTANSNQMLMEVMGLHLPGSAFVHPHTPLRDALTAAAARRVLDLTVERGSYTPI
FT                   GHVVDEKAVINGIVALLATGGSTNHTMHLVAIARAAGILIDWDDFDALSAIVPLLAKIY
FT                   PNGKADVNHFHAAGGVAFLVRNLLEGGLLHEDVTTVAGRGLSHYTHEPKLIDGRLEWVP
FT                   GVAESQDPKVLRPLAEPFAPDGGLRLMQGRLGRGVIKISAVAPEHRKVVAPAIVFDSQE
FT                   AVQAAFDAGELKRDFVAVVRFQGARANGMPELHRLTPLLGVLQDQGFHVALVTDGRMSG
FT                   ASGKVPAVIHVSPEALLDGPLAKVRSGDTIVIDAQAGVLDVEIDAGEWAARELARPTHQ
FT                   ADNEVGFGRELFGVFRAAAMPAEAGASVFGALVGETAQAGASVTH"
FT   gene            583905..584531
FT                   /locus_tag="bglu_1g05530"
FT   CDS_pept        583905..584531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05530"
FT                   /product="4-hydroxy-2-oxoglutarate
FT                   aldolase/2-deydro-3-deoxyphosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27749"
FT                   /db_xref="GOA:C5AB06"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB06"
FT                   /protein_id="ACR27749.1"
FT                   /translation="MKTIHDIVKLGPVIPVLAFETVEQGEHVSRALHAGGVKVLEITLR
FT                   TEAGLKAIERASQLADDIVVGVGTITKPEHCALAKQAGAQFGVSPGLTRDMHRAASDAG
FT                   LPLLPGVMTPTDIITALELGYEVVKFFPAQQAGGIPMLQAFHGPFPTLKFCPTGGISAQ
FT                   TAPDFLKQPNVVCVGGSWLTPKAALAAQDWAEVTRLAQAASQLAR"
FT   gene            585069..586433
FT                   /locus_tag="bglu_1g05540"
FT   CDS_pept        585069..586433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05540"
FT                   /product="H+ gluconate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27750"
FT                   /db_xref="GOA:C5AB07"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB07"
FT                   /protein_id="ACR27750.1"
FT                   /translation="MGAVQGSMLLVCALIAIVLLIVLIARYKIYPFLVLIIVSLGLGLV
FT                   VGMPMDKIVKSFETGNGNTLGHIAIVVGLGTMLGKMMAESGGAERIATTMIGWFGEKNI
FT                   HWAMLCVAMIIGLPVFFEVGFVLLIPIAFNVAKRTGKSLLLVGLPMVAGLSVVHGLIPP
FT                   HPAALLAVQAFGADIGKTIAYGLVVGIPTAIIAGPLFALVIHKYVKLPEHNPLASQFVD
FT                   SGDRARRDRELPGFGITLFTVLLPVVLMLVGSWADLLFAPKTLPNNLLRFAGTSDVALL
FT                   IAVLVSFWTFGAKQGFNREQIQKFCGECLAPIAGITLIVGAGGGFGGVLRDSGISQQIV
FT                   ATATQAHLSPLLLGWFAAALIRLATGSATVAMTTACGIVAPIAAAAGGTVKPELLVLAT
FT                   GSGSLIFSHVNDGGFWLIKEYFGMTVGQTFKTWTALETLISLLGLGFTMVLATVL"
FT   gene            586451..586954
FT                   /locus_tag="bglu_1g05550"
FT   CDS_pept        586451..586954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05550"
FT                   /product="Carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27751"
FT                   /db_xref="GOA:C5AB08"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB08"
FT                   /protein_id="ACR27751.1"
FT                   /translation="MILIAMGVSGAGKTRIGELLAERLGCTFTDGDAFHSAANKEKMHH
FT                   GIALTDDDRWPWLKAIRAAIEAKQRAGETAVFTCSSLKRSYRDVLRGGDADVRFVYLAG
FT                   TMEVLSERLKTRTGHFFDPSLLQSQLDTLEVPGADEAVQVSIEQTPEQMVDEVLKKLGL
FT                   APQA"
FT   gene            complement(587098..588537)
FT                   /locus_tag="bglu_1g05560"
FT   CDS_pept        complement(587098..588537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05560"
FT                   /product="Adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27752"
FT                   /db_xref="GOA:C5AB09"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB09"
FT                   /protein_id="ACR27752.1"
FT                   /translation="MVKLRVDPLHARTGRPIMSDTRPDTLFALTALSPLDGRYASKTEA
FT                   LREWLSEAAFMRHRVTVEAHWLIALSRAGFAEVPRFSAASEQFLLQLVERFTAHDAARI
FT                   KDIERVTNHDVKAVEYWLKESVKGQPELEAASEFIHFACTSEDINNTSHGMMLAGARDK
FT                   VIVPALRSVQQRLVALAHALADQPMLSRTHGQPASPTTLGKEIANVAARLARAIERIEK
FT                   VELLGKMNGAVGNFNAHLSAYPEFDWEAFSKDVVENRLKLAFNPYTIQIEPHDYMAELF
FT                   DAVARANTILLDLDRDVWGYIALGYFKQKTKAGEIGSSTMPHKVNPIDFENSEGNLGLA
FT                   NATLRHLSEKLPVSRWQRDLTDSTVLRNIGVAFGYSLLAYESLTRGLDKLEVNPARLNE
FT                   DLDNCWEVLAEPVQTVMRRYGIENPYEQLKELTRGKGITREALQQFVGGLAIPQDAKDL
FT                   LLAMTPASYIGKAVELAKRIA"
FT   gene            588668..589624
FT                   /locus_tag="bglu_1g05570"
FT   CDS_pept        588668..589624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05570"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27753"
FT                   /db_xref="GOA:C5AB10"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB10"
FT                   /protein_id="ACR27753.1"
FT                   /translation="MELKWLEDFVSLAETRSFSRSAESRHVSQPAFSRRIQALEAWLGT
FT                   ELIDRSVYPTRLTQAGQVFLEQALTILSQAHEARTVLRGHAAAPVPTIEFAVPHTLSLT
FT                   YFPFWLQRIEAKLGPVHTRLRALNVHDAVLSLVEGGCDLVMGYHHPSHPVALDPSRYDM
FT                   LTLGMEPISPFSAPLRAGRPRYTLPGGADAAVPYLSYTPNAYLGRMTEVIIANAREPLH
FT                   LDRVYETDMAEGLKAMALAGHGVAFLPHSAVEDAVARGELIRLDRPARAGGAQPFTLTM
FT                   EIRLYRDKLAVQGDEARQALMRALWDAVVEELAQRAR"
FT   gene            589797..591104
FT                   /locus_tag="bglu_1g05580"
FT   CDS_pept        589797..591104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05580"
FT                   /product="Putative glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27754"
FT                   /db_xref="GOA:C5AB11"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB11"
FT                   /protein_id="ACR27754.1"
FT                   /translation="MSSQSQSSPVIAQSIPSYLNAEALGPWGNYLQQVDRVAPYLGSLS
FT                   RWLETLKRPKRILVVDVPIELDNGTVAHFEGYRVQHNVSRGPGKGGVRYHQDVTLSEVM
FT                   ALSAWMSVKNAAVNVPYGGAKGGIRVDPRKLSRGELERMTRRYTSEIGIIIGPNTDIPA
FT                   PDVNTNEQVMAWMMDTYSMNQGQTATGVVTGKPITLGGSLGRREATGRGVFVVGCEAAQ
FT                   KIGLEIRGARIAVQGFGNVGGIAGKLFQEAGATVIAVQDHTGTIYQPAGLDTVKLLDHV
FT                   ARTGGVAGFEGAESMANDEFWTVETDILIPAALENQITEKNAGKIRTKIVVEGANGPTT
FT                   TAADDILAANGVLVIPDVIANAGGVTVSYFEWVQDFSSFFWTEDEINQRLERIMREAFA
FT                   GVWSVAQEHNVTVRTAAFIVACKRILMAREMRGLYP"
FT   gene            591349..592242
FT                   /locus_tag="bglu_1g05590"
FT   CDS_pept        591349..592242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05590"
FT                   /product="Glutamate/aspartate ABC transporter, periplasmic
FT                   glutamate/aspartate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27755"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB12"
FT                   /protein_id="ACR27755.1"
FT                   /translation="MKFKQALLLTAALATFAGGAIAQEAGTLKKIKDTGVIALGHRESS
FT                   IPFSYYDQNQQVIGYARDFQMRIVDAVKKKLNLPNLQTKNIPVTSQNRIPLVQNGTVDI
FT                   ECGSTTNNLDRQKQAAFSTTYFVIGTRLMTSKDSGIKDFADLKGKTVVTTAGTTSERLL
FT                   RAMNNDKQMGMNIISAKDHGESFQTLETGRAVAFMMDDALLAGERAKAKKPDNWVIVGT
FT                   PQSEEAYGCMMRKDDPAFKKVVDDAITETEKSGEAAKLYAKWFENPIPPKGLNLNFPLS
FT                   DSMKKLYANPNDKALD"
FT   gene            592329..593069
FT                   /locus_tag="bglu_1g05600"
FT   CDS_pept        592329..593069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05600"
FT                   /product="polar amino acid ABC transporter inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27756"
FT                   /db_xref="GOA:C5AB13"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB13"
FT                   /protein_id="ACR27756.1"
FT                   /translation="MSYHWNWGIFLSPVSTGEPTTYLGWLLSGFWVTIKVSLVAWVIAL
FT                   VVGSLFGVLRTVPNRWLSALGTLYVSIFRNIPLIVQFFVWYLVVPELLPPALGTWIKQL
FT                   PPGTQFFTASVVCLGLFTGARVCEQVRSGIAALPKGQRAAGLAMGFTEWQTYRFVLLPV
FT                   AYRIIVPPLTSEFLNIFKNSAVASTIGLLDLSAQARQLVDYTAQTYESFIAVTLAYVII
FT                   NLVVMALMRWIESRTRLPGYIGGK"
FT   gene            593069..593746
FT                   /locus_tag="bglu_1g05610"
FT   CDS_pept        593069..593746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05610"
FT                   /product="Glutamate/aspartate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27757"
FT                   /db_xref="GOA:C5AB14"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB14"
FT                   /protein_id="ACR27757.1"
FT                   /translation="MHDFDWSGIPGALPALWTGAIVTLEITALAIVVGIVWGTLLALMR
FT                   LSGVAALQWFARLYVTVFRSIPLVMVLLWFFLIVPQLLQGVLGLSPTIDIRLASAMIAF
FT                   SLFEAAYYSEIIRAGIQAVPRGQVNAAFALGMGYGQAMRLVILPQAFRAMVPLLLTQAI
FT                   VLFQDTSLVYVISLADFFRTATNIGDRDGTSVEMILFAGACYFVVCVLASALVKGLQKK
FT                   VTR"
FT   gene            593743..594468
FT                   /locus_tag="bglu_1g05620"
FT   CDS_pept        593743..594468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05620"
FT                   /product="ABC transporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27758"
FT                   /db_xref="GOA:C5AB15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB15"
FT                   /protein_id="ACR27758.1"
FT                   /translation="MISIKNVSKWYGQFQVLTDCTTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPFQKGEILVNGESVGDRRTNLSKLRSKVGMVFQHFELFPHLSITQNLTLAQIK
FT                   VLGRSKDEANDKGLKLLDRVGLKAHAHKFPGQLSGGQQQRVAIARALSMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELAQEGMTMMCVTHEMGFAKKVAHRVIFMDKGAIVEDDRKDE
FT                   FFANPKSDRAKDFLAKILH"
FT   gene            complement(594566..595510)
FT                   /locus_tag="bglu_1g05630"
FT   CDS_pept        complement(594566..595510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05630"
FT                   /product="Glutamine amidotransferase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27759"
FT                   /db_xref="GOA:C5AB16"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB16"
FT                   /protein_id="ACR27759.1"
FT                   /translation="MCQLFGMNCAEPTDVTFSFTGFAARGGLTDHHADGWGIAFFEEKA
FT                   CRLFLDHQSSATSPIAEMVKRYPIKSKNTIAHIRKATQGAILLENSHPFMRELWGRHWI
FT                   FAHNGDLPGFAPSLDDGVYQPVGTTDSERAFCLLMQGLRDTFPGAQPPLPELFERLAEL
FT                   TEQITAHGVFNFLLSNGQALFAHCSTRLHYLVRRWPFSTAHLIDEDLSIDFAKYTTPED
FT                   RVAVIATQPLTDDEVWTAFEPGELLMFQCGDVAAKTRVAVPEVVLEKLRNPALDPSASA
FT                   GCGRASVANAAGTDATLEAAAAAVAHGDDPVDF"
FT   gene            595720..596790
FT                   /locus_tag="bglu_1g05640"
FT   CDS_pept        595720..596790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05640"
FT                   /product="Dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27760"
FT                   /db_xref="GOA:C5AB17"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB17"
FT                   /protein_id="ACR27760.1"
FT                   /translation="MTAPNASAAPVTSLTLARPDDWHLHVRDGAMLAAVLPHTARQFGR
FT                   AIIMPNLKPPVTTTAQAEAYRARILAALPAGMAFEPLMTLYLTDNTPADEIRRARESGF
FT                   VHGVKLYPAGATTNSDAGVTDLGKCSGALEAMQETGMPLLVHGEVTNAEIDLFDREKVF
FT                   IDRVMTPLRRDFPALKVVFEHITTKDAADYVRDADAAPGMLGATITAHHLLYNRNAIFT
FT                   GGIRPHYYCLPVLKRETHRVALVAAATSGNARFFLGTDSAPHAQGAKEAACGCAGCYTA
FT                   LHALELYAEAFDQAGALDKLEGFASFFGADFYGLPRATETVTLRRETWQLPATVEAGDT
FT                   AVVPLRGGEPIGWRLV"
FT   gene            596787..597620
FT                   /locus_tag="bglu_1g05650"
FT   CDS_pept        596787..597620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05650"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27761"
FT                   /db_xref="InterPro:IPR021390"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB18"
FT                   /protein_id="ACR27761.1"
FT                   /translation="MSGAARGPSGAGFAAIDWQLPWLAPFAARGPRWQAAALAGEAAWL
FT                   AAVAADAAVAGIGTGRGLPLRFIEQAALPAGVAYETQIATTGGVPTRHNLHDFFNALVW
FT                   FAYPRLKAAINARQSAAIDALGVGGTRGGLRDALTLLDENGALFVTADPALGDALRRFG
FT                   WRALFVEARAAWGRACELRLVGHALLEKLVAPYKACCAHAWIVEAPPAWFGWDEGARRG
FT                   WLDAHVAAGFDARLPPHGGFAPVPVLGVPGWCAANAEPGFYDDPRVFRAGRRAHG"
FT   gene            complement(597762..597947)
FT                   /pseudo
FT                   /locus_tag="bglu_1g05660"
FT                   /note="disrupted gene"
FT   gene            complement(597854..598039)
FT                   /pseudo
FT                   /locus_tag="bglu_1g05670"
FT                   /note="disrupted gene"
FT   gene            complement(598196..598618)
FT                   /locus_tag="bglu_1g05680"
FT   CDS_pept        complement(598196..598618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05680"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27762"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB19"
FT                   /protein_id="ACR27762.1"
FT                   /translation="MECKVSWMGQDGMAFVAQTGSGHLVTMDGAPGGGGNNLAPRPMEM
FT                   VLLGTGGCTAYDVVLILQKSRQEVTGCSVSLKAERASEDPKVFTNIHFHFTVTGRNLNP
FT                   ATVERAINLSHDKYCSASIMIAKTAELTHSFDIVAG"
FT   gene            599295..599723
FT                   /locus_tag="bglu_1g05690"
FT   CDS_pept        599295..599723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05690"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27763"
FT                   /db_xref="GOA:C5AB20"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB20"
FT                   /protein_id="ACR27763.1"
FT                   /translation="MKTFSAKAHEVTREWYVIDATDKVLGRVASEVARRLRGKHKPEFT
FT                   PHVDTGDFIIVINASKLKVTGNKVLDKKYYRHSGYPGGIYETTFGKMQERFPGRALEKA
FT                   VKGMLPKGPLGYAMIKKLKVYAEATHPHSAQQPKALEI"
FT   gene            599737..600129
FT                   /locus_tag="bglu_1g05700"
FT   CDS_pept        599737..600129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05700"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27764"
FT                   /db_xref="GOA:C5AB21"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB21"
FT                   /protein_id="ACR27764.1"
FT                   /translation="MIGNWNYGTGRRKSAVARVFIKAGKGDIIVNGKPIADYFARETSL
FT                   MIVRQPLELTNHAQTFDIKVNVTGGGETGQAGAVRHGITRALIDYDATLKPQLSSAGFV
FT                   TRDAREVERKKVGLRKARRAKQFSKR"
FT   gene            600331..600705
FT                   /locus_tag="bglu_1g05710"
FT   CDS_pept        600331..600705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05710"
FT                   /product="iron-sulfur cluster insertion protein ErpA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27765"
FT                   /db_xref="GOA:C5AB22"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB22"
FT                   /protein_id="ACR27765.1"
FT                   /translation="MNAVTESAATTPTEMPAPFVFTDAAADKVKQLIEEEGNPELKLRV
FT                   FVQGGGCSGFQYGFTFDEEVNEDDTVMNKSGVQLLIDSMSYQYLVGAEIDYKDDLNGAQ
FT                   FVIKNPNATTTCGCGSSFSV"
FT   gene            complement(600807..601967)
FT                   /locus_tag="bglu_1g05720"
FT   CDS_pept        complement(600807..601967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05720"
FT                   /product="anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05720"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27766"
FT                   /db_xref="GOA:C5AB23"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB23"
FT                   /protein_id="ACR27766.1"
FT                   /translation="MAPPRKQADHSADGVYLGLMSGTSMDGCDGVAVRFAAHAPPVVLA
FT                   EGFADFDHTLRDALFALQQPGADEIDREAQAANALAARYAACCHALLRSAQLAPDQVRA
FT                   IGVHGQTVRHRPERGYTRQINSPALLAELTGIDVIADFRARDIAAGGQGAPLAPAFHAT
FT                   VFGAPDETRVVCNLGGISNITILPAEGAQGGAGVRGFDCGPANALLDAWAQRQLGKPFD
FT                   EDGRFAASGRLDTALLAALLAEPYFDLPPPKSTGRDLFNPDWLDARLRMFPQVAPPDVQ
FT                   ATLAALTAATVAREIARHAPDCRAVYVCGGGARNPVLLRALADALAEAGVGAAVDTTAA
FT                   LGVPPQQVEAIAFAWLACRFTARAAGNLAGVTGAAGPRVLGALYPR"
FT   gene            602112..603353
FT                   /locus_tag="bglu_1g05730"
FT   CDS_pept        602112..603353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05730"
FT                   /product="Tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27767"
FT                   /db_xref="GOA:C5AB24"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB24"
FT                   /protein_id="ACR27767.1"
FT                   /translation="MSHDPQTKPALPITDAVREALAITKRGVDELLIEDEFAQKLARSE
FT                   ATGTPLRIKLGLDPTAPDIHIGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNA
FT                   TRPPLTREQIEANAKTYFEQAALVLDRDKTEIRYNSEWSMPLGADGMIKLASRYTVARI
FT                   LEREDFTKRFQGGVPISIHEFLYPLMQGYDSVALNADLELGGTDQKFNLLVGRELQKQY
FT                   GQEPQCILTMPLLEGLDGVEKMSKSKGNYVGISEKPAEMFGKLMSISDVLMWRYFELLS
FT                   FRPMREIEKFKAEIEAGRNPRDFKVLLAQEIVARFHSQADAEQALEDFNHRARGGVPDD
FT                   IPSVSLGGAPLAIGQLLKQAGLVPSTSEALRNIEQGGVKIDGTTVSDKGLKVEAGEYVV
FT                   QVGKRRFARVTVGA"
FT   gene            603350..603808
FT                   /locus_tag="bglu_1g05740"
FT   CDS_pept        603350..603808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05740"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27768"
FT                   /db_xref="GOA:C5AB25"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB25"
FT                   /protein_id="ACR27768.1"
FT                   /translation="MIALIQRVRRADVRVGERVTGQIGAGLLALVCAERDDTEAQADKL
FT                   LAKVLGYRVFSDAAGKMNLPVTNLDGAGTAGGLLLVSQFTLAADTRSGMRPSFTPAAPP
FT                   EAGARLFAYFVEAARARHPIVETGEFGAEMQVSLVNDGPVTFWLQARA"
FT   gene            603898..604560
FT                   /locus_tag="bglu_1g05750"
FT   CDS_pept        603898..604560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05750"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05750"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27769"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB26"
FT                   /protein_id="ACR27769.1"
FT                   /translation="MTTTQILFIRHGETPWNRIKRIQGHIDIALAETGVQQAARLAERL
FT                   AREAADGARLDAIYSSDLQRARQTAQPSADALGLPVRLDAGLRERAYGAFQGHDSAEIA
FT                   ARYPDAYAQWQTRDPGFEPAGGESHRAFHHRVLHALAPIVAAHPGGRIAVVTHGGVLDC
FT                   IYRRAASLPLEAPRQYALLNASINVVEADGNALRVVRWADVAHLDGDSDDDGYRKVL"
FT   gene            complement(604624..605718)
FT                   /locus_tag="bglu_1g05760"
FT   CDS_pept        complement(604624..605718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05760"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05760"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27770"
FT                   /db_xref="InterPro:IPR014956"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB27"
FT                   /protein_id="ACR27770.1"
FT                   /translation="MPAASLSRFALAAPLCSLLALAACGGATSAAAPAAASAAVRQPAA
FT                   TAVQPLPGKWAAAAAGQMLDVALGDLHPTQAALGYDQIYYKLGRYERDPLRKFDDFCAD
FT                   EGLGGLRKNGASPRSTLTNAASYACTTTDPRQRDTSVLNPVVVGPNGDTLYLTDGHHGL
FT                   STYYEVPGGGPTLHVHVLVKDNLSGYSGSAFWAQMQRRGYTRLKDANGAAITPAQLPTG
FT                   LGLELGMQDDVYRSLVYFTRGIGYRKPTSPTDFLEFYWADWLRARFPLSGYTLAKLGAT
FT                   APDPATADTGYLNAIWNASRRMVGAADPVIDGKTGADLGRLARLNAGRQYTTGAFGELS
FT                   APLTAAKPGKLAYALAYKARHGLP"
FT   gene            complement(605906..606982)
FT                   /locus_tag="bglu_1g05770"
FT   CDS_pept        complement(605906..606982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05770"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05770"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27771"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB28"
FT                   /protein_id="ACR27771.1"
FT                   /translation="MPRPPSHAAAQPQASGLAQRLRARLAGGVTLLTTGGGGPSIDYAA
FT                   PPGDPGLFGPEAVCWRVHADFTSMMTGGIAALLLQALHPLALAGVWDHSTFRTDILGRL
FT                   RRTATFVAGTTFGSRADALALIERVKTIHAAVTGTAPDGRPYRASDPALLTWVHVAEVS
FT                   SFLAAYLRYVNPALSGPEQDRYYAETALIATLLGARDVPASRAAVAAYLARMRGELAAS
FT                   ERTREVIRVLRDAPVPRASMKPAAALLFHAGIDLLPDWAQRQLDLASLAPVRRVVARPG
FT                   IRLIAPVFRWALVNGASKRARRRAAAAPDAVMTPTASTPAAPQRPPPANSGDAPGARDP
FT                   ARAQHSAADAAGEPPGPR"
FT   gene            complement(607002..608069)
FT                   /locus_tag="bglu_1g05780"
FT   CDS_pept        complement(607002..608069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05780"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05780"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27772"
FT                   /db_xref="GOA:C5AB29"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB29"
FT                   /protein_id="ACR27772.1"
FT                   /translation="MIETDKLAGERIIAATPASSHEEAFERALRPRQLDEYVGQEKVRG
FT                   QLEIFIEAAKRRAEALDHVLLFGPPGLGKTTLAHIVAREMGVNLRQTSGPVLERPGDLA
FT                   ALLTNLEANDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSVKLDLQPFTL
FT                   VGATTRAGMLTNPLRDRFGIVARLEFYDASQLSRIVQRSASLLNARIDPHGALEIARRA
FT                   RGTPRIANRLLRRVRDYAEVKADGEITERVADAALAMLDVDPVGFDLMDRKLLEAILHK
FT                   FDGGPVGVDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRVATLLTYRHFGLPVPD
FT                   SHTPGLPGIDDDTRR"
FT   gene            complement(608170..608751)
FT                   /locus_tag="bglu_1g05790"
FT   CDS_pept        complement(608170..608751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05790"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05790"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27773"
FT                   /db_xref="GOA:C5AB30"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB30"
FT                   /protein_id="ACR27773.1"
FT                   /translation="MIGRIAGTLLEKNPPHLLVDCNGVGYELDVPMSTFYNLPPTGERV
FT                   VLLTQLIVREDAHLLYGFLTPQERSAFRELLKITGIGARMALAVLSGMSVQELSQVVTI
FT                   QDAARLQRLPGIGKKTAERLLLELKGKLGADLGELAGQASQSDHAADILNALLALGYSE
FT                   KEALAAIKNVPAGTGVSEGIKLSLKALSKT"
FT   gene            complement(608835..609377)
FT                   /locus_tag="bglu_1g05800"
FT   CDS_pept        complement(608835..609377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05800"
FT                   /product="Crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05800"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27774"
FT                   /db_xref="GOA:C5AB31"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB31"
FT                   /protein_id="ACR27774.1"
FT                   /translation="MRIIGIDPGLRVTGFGVIDVHGSKLAYVTSGVIRTPSADLAVRLG
FT                   TIFDGVSTLVREYRPDQAAIEKVFVNVNPQSTLLLGQARGAAICGLVSGSLPVAEYTPT
FT                   QLKQAIVGYGRATKEQMQQMVVRLLGLSGLPGTDAADALGTAICHAHGGAKLETLGGLA
FT                   PALVRKGFRVRRGRLVG"
FT   gene            complement(609790..611355)
FT                   /locus_tag="bglu_1g05810"
FT   CDS_pept        complement(609790..611355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05810"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolas"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05810"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27775"
FT                   /db_xref="GOA:C5AB32"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB32"
FT                   /protein_id="ACR27775.1"
FT                   /translation="MIKQALLSVSDKTGIVEFATALSQQGVKLLSTGGTAKLLAEAGLP
FT                   VTEVADYTGFPEMLDGRVKTLHPKVHGGILARRDLPEHMQALDAHGIPTIDLLVVNLYP
FT                   FVATIAKDDCTLADAIENIDIGGPTMLRSAAKNHRDVTVIVDPADYAVVLDEMKANGNT
FT                   VGYATNFRLATKVFAHTAQYDGAITNYLTSLTDELQHATRSAYPATLNLAFDKVQDLRY
FT                   GENPHQSAAFYRDLAAPAGALANYRQLQGKELSYNNIADSDAAWECVKTFDAPACVIIK
FT                   HANPCGVAVGANPAEAYAKAFQTDPTSAFGGIIAFNRELDEAGAQAVAKQFVEVLIAPS
FT                   FSAAARQVFAAKQNVRLLEIALGDGFNAFDLKRVGGGLLVQSLDSRNVQPDELRVVTKR
FT                   QPTPKELDDLLFAWRVAKFVKSNAIVFCGNGMTLGVGAGQMSRVDSARIAGIKAQNAGL
FT                   TLAGSAVASDAFFPFRDGLDVVVAAGATAVIHPGGSMRDEEVIAAADEHGIAMVLTGIR
FT                   HFRH"
FT   gene            complement(611401..611634)
FT                   /locus_tag="bglu_1g05820"
FT   CDS_pept        complement(611401..611634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05820"
FT                   /product="DNA-binding protein Fis"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05820"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27776"
FT                   /db_xref="GOA:C5AB33"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB33"
FT                   /protein_id="ACR27776.1"
FT                   /translation="MSKHNIEQCVRESLDGYFRDLDGSNPHDVYDMVMSCVEKPMLEVV
FT                   LEQAGGNQSLAAEYLGINRNTLRKKLQQHGLL"
FT   gene            complement(611639..612682)
FT                   /locus_tag="bglu_1g05830"
FT   CDS_pept        complement(611639..612682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05830"
FT                   /product="Putative TIM-barrel protein, nifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05830"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27777"
FT                   /db_xref="GOA:C5AB34"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB34"
FT                   /protein_id="ACR27777.1"
FT                   /translation="MPVIGPHILRNNLFVAPMAGVTDRPFRQLCKRLGAGYAVSEMVAS
FT                   NAQLWKSEKTMRRANHAGEVEPIAVQIAGADPAMMAEAARYNVANGAQIIDINMGCPAK
FT                   KVCNVAAGSALLQNEPLVVRIVSAVVAAVGTGPDAVPVTLKIRTGWDREHRNALTIARL
FT                   AEDAGIAMLTVHGRTRADLYRGDAEYETIAAVKAAVKIPVVANGDITSPAKAKAVLDFT
FT                   GADALMIGRAAQGRPWLFREIDHFLQTGTTLPAPSVDEIQQLLNEHLEDHYAFYGEFTG
FT                   VRTARKHIGWYTRGLSGANAFRHRMNTLDTTREQLAAVNEYFDAQRALSDHLVYVGDED
FT                   GTSDPIQ"
FT   gene            complement(612861..614066)
FT                   /locus_tag="bglu_1g05840"
FT   CDS_pept        complement(612861..614066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05840"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05840"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27778"
FT                   /db_xref="GOA:C5AB35"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB35"
FT                   /protein_id="ACR27778.1"
FT                   /translation="MTTSAPLAPAAAPFDADLAIIGAGPVGLALAGWLARRSATRALSV
FT                   VLVDAREPSASADDPRAIAVSHGSRLLLEPLGWPADATPIEHIHVSQRGHFGRTLIDRD
FT                   EHGVAALGYVARYGSLVDALARAVRGTPVRWMTSTQARAPRQDAGGVSVTLAAPDGERE
FT                   LRVRALVNAEGGLFQGGTGDALDGRHRRDYGQTAIVGTVSAAAPRPRTAWERFTPEGPL
FT                   ALLPLGGAGQADYALVWCCAPDEAARRAALPDAAFLSELGAAFGERMGRFTRVVGRASF
FT                   PLGLVAAPTLVEGRIATVGNAAQTLHPVAGQGLNLGLRDAHTLADALSEHGATPLALAA
FT                   FNLRRALDRRLTIGATDMLARLFTIDSRPLAALRGAALSALEFVPPLKTAIARQMMFGR
FT                   RG"
FT   gene            complement(614119..615546)
FT                   /locus_tag="bglu_1g05850"
FT   CDS_pept        complement(614119..615546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05850"
FT                   /product="Peptidase M24B"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05850"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27779"
FT                   /db_xref="GOA:C5AB36"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB36"
FT                   /protein_id="ACR27779.1"
FT                   /translation="MNAPTDTCLVPDVYRQRRARVLAALRATGGGVAIVPTAPQALRNR
FT                   DADYPYRHDSYFYYLTGFSEPDALLVLDANAADGAPQSILFCRAKHPEREIWEGFHYGP
FT                   DGARDAFGFDAAFASDALDTEMPRLLADAGALHYRFGASAEFERRLAGWLEAVRAKSRA
FT                   GVAAPASAHDLTPLLDEMRIVKDAHEQAIMRRAAVISASAHRRAMAVTRPGIREYEIEA
FT                   ELLHEFRRHGAAGPAYGSIVAAGANACVLHYPAGNAVARDGDLILIDAACELEGYASDI
FT                   TRTFPANGRFSGPQRALYDIVLAAQAAAAAATRPGAAFEAPHEAAVRVLAQGLLDTGIV
FT                   PKSRFASVDDVVAERAYARFYMHRTGHWLGMDVHDCGDYRERGAARDAQGALPWRTLRE
FT                   GMALTIEPGLYVRAADDVPARFHDIGIRIEDDAFVTAAGCELITRDVPVDADEIEALMR
FT                   DAHGTSGPSGTTPPARP"
FT   gene            615784..616398
FT                   /locus_tag="bglu_1g05860"
FT   CDS_pept        615784..616398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05860"
FT                   /product="Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05860"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27780"
FT                   /db_xref="GOA:C5AB37"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB37"
FT                   /protein_id="ACR27780.1"
FT                   /translation="MMKLIGSLSSPYVRKARVVLAEKKIDYKLELENVWGADTAIHAAN
FT                   PLGKVPCLVMEDGAAVFDSRVICEYVDTLSPVGKLIPGSGRERLEVRCWEALGDGLLDA
FT                   AVAIRIEHVQRTPEQRSEAWIARQQRKIDDALVAMSQGLGGKPWCVGTHYTLADIALGC
FT                   ALGYLEFRMPELGWRERHPNLDKHYAKLLQRPSFADTVLQD"
FT   gene            complement(616497..618116)
FT                   /locus_tag="bglu_1g05870"
FT   CDS_pept        complement(616497..618116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05870"
FT                   /product="Glutamate synthase (NADPH)"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05870"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27781"
FT                   /db_xref="GOA:C5AB38"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB38"
FT                   /protein_id="ACR27781.1"
FT                   /translation="MFARRYLAMWCATLALVLLAALAYGHLIAWPWLLIPAGFVALGLW
FT                   DLNQDRHAILRNYPLWGHFRFMFEFIRPEIRQYFVEDDTEEKPFSRAQRSVVYQRAKNV
FT                   ADNRPYGTELNVKAVAHEWISHSLAPTRLANHDFRIRVGAARAQPYDISIFNISAMSFG
FT                   SLSANAIRALNLGARKGGFAHDTGEGSLSKYHREHGGDIIWEIASGYFGCRNDDGTFNP
FT                   DKFAKQAADAQVKMIEVKLSQGAKPGHGGVLPAAKITPEIAETRGVPMGQDCISPASHS
FT                   EFSTPRGLLEFVERLRTLSGGKPTGFKLCIGHPWEFFGIAKAMLETGILPDFIVVDGAE
FT                   GGTGAAPLEFTDHVGVPLQEGLLLVHNTLVGIGLRERVKLGASGKIITAFDVARTLAIG
FT                   ADWVNSARGFMFAVGCIQAQTCHTGRCPTGVATQDEVRQRALVVPDKSERVYNFHRNTL
FT                   HALQELVQAAGLAHPADLRAHHLVQRVAPHEVRLMSELLKYVKPGALLSGEKLGLTLYD
FT                   TWWPAARSDTFAIGDAAYAAYD"
FT   gene            complement(618314..619495)
FT                   /locus_tag="bglu_1g05880"
FT   CDS_pept        complement(618314..619495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05880"
FT                   /product="tRNA-specific 2-thiouridylase MnmA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05880"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27782"
FT                   /db_xref="GOA:C5AB39"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB39"
FT                   /protein_id="ACR27782.1"
FT                   /translation="MKKQRVVVGMSGGVDSSVTAWLLKEQGYDVVGLFMKNWEDDDDGE
FT                   YCSTRQDWIDVVSVADLIGIDVEAVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEI
FT                   KFKAFLDHAMSLGAETIATGHYARVRERDGRFELLKALDQTKDQSYFLHRLNQAQLSKT
FT                   RFPLGEMPKTQVREIAARIGLPNAKKKDSTGICFIGERPFRDFLNRYLPTRPGPMRTPD
FT                   GRRVGEHIGLAFYTFGQRKGIGLGGSRDGSGEPWFVAGKDIASNTLYVAQGHDHPWLLS
FT                   HELVAGNVSWVAGEPPADGFVCGAKTRYRQADSACSFARAKAGEAGEPRFSLAFDAPQW
FT                   AVTPGQSAVLYDGEVCLGGGIIETVATSQPGSAAALAAALGSAAEPLAGSLAR"
FT   gene            complement(619492..620001)
FT                   /locus_tag="bglu_1g05890"
FT   CDS_pept        complement(619492..620001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05890"
FT                   /product="NUDIX domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05890"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27783"
FT                   /db_xref="GOA:C5AB40"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR033713"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB40"
FT                   /protein_id="ACR27783.1"
FT                   /translation="MKSELWTPHVTVAAIVERAGRFLLIEEHTSAGLRLNQPAGHLEAG
FT                   ETLAQAVIRETLEETAHPFAPEALVGVYQTHFERPGKGGATYLRFTFCGSAGEAVAGRA
FT                   LDAGIVRTLWMTADELRAVPERHRTPAVMQCIDDYLAGRRVPLAFIHTHSVAPDRATPD
FT                   HQAVSK"
FT   gene            620282..621427
FT                   /locus_tag="bglu_1g05900"
FT   CDS_pept        620282..621427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05900"
FT                   /product="Alanine dehydrogenase/PNT domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05900"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27784"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB41"
FT                   /protein_id="ACR27784.1"
FT                   /translation="MLIGVPAETRANEARVAATPETIKKYVAAGHAVTVERGAGAAASY
FT                   PDEAYAAAGATLGERAAAFGAEIVLKVQAPEPAELPLLKRGAVLVGMLEPFDAAQAQRL
FT                   AAAGVTGFALEAAPRTTRAQSLDVLSSQANIAGYRAVLVAASLYPRFLPMLMTAAGTVK
FT                   AARVLVLGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFLDVPFETDEERE
FT                   AAQGTGGYARPMPPSWLARQAALVHERAKQADIVITTALIPGRPAPTLIAAETVAAMKP
FT                   GAVLVDLAAGRGAEVDGTGRRGGNCPLTVADQVVVAHGVTIAGHTNLAAQVPADASALY
FT                   ARNLADFLKLIIGPDGALRIDPADDIVAATLLCRDGEVLRK"
FT   gene            621440..621769
FT                   /locus_tag="bglu_1g05910"
FT   CDS_pept        621440..621769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05910"
FT                   /product="NAD/NADP transhydrogenase alpha subunit-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05910"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27785"
FT                   /db_xref="GOA:C5AB42"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB42"
FT                   /protein_id="ACR27785.1"
FT                   /translation="MEIINHTVINVIIFVLAVYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTVGATGKVFGTIAVALAAVNVFGGFLVTRRMLEMFRKKEPKRGGAAG
FT                   KEGAQ"
FT   gene            621766..623220
FT                   /locus_tag="bglu_1g05920"
FT   CDS_pept        621766..623220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05920"
FT                   /product="NAD(P) transhydrogenase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05920"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27786"
FT                   /db_xref="GOA:C5AB43"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB43"
FT                   /protein_id="ACR27786.1"
FT                   /translation="MSLNLVTLLYLVASVCFIQALKGLSNPKSARRGNLFGMVGMAIAM
FT                   LTTVALIAKQAAWLGANLPLGLALVLGALVVGGAVGAYVAARVEMTKMPELVAAMHSLI
FT                   GLAAVSIAYAVVAEPEAFGLVPQDAVAANFIPYGNRIELFIGTFVGAITFSGSVIAFGK
FT                   LSGKYRFRLFQGAPVVYPGQHLINLMLALGMLGFGVLFFLTQSWLPFIIMTAIAFALGV
FT                   LIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNPMLIIAGSLVGSSGAILSYIMCHA
FT                   MNRSFFNVILGGFGGEAAAAGAGAAKEQRPVKSGSADDAAFMLGNAETVVIVPGYGLAV
FT                   ARAQHALKELTDKLVAKGIDVRYAIHPVAGRMPGHMNVLLAEAEVPYDLVYEMDDINNE
FT                   FGQTDVVLVLGANDVVNPAAKNDPASPIAGMPILEAYKARTVIVNKRSMASGYAGLDNE
FT                   LFYMDKTMMVFGDAKKVVEDMVKAVE"
FT   gene            complement(623236..623865)
FT                   /locus_tag="bglu_1g05930"
FT   CDS_pept        complement(623236..623865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05930"
FT                   /product="Helix-turn-helix, type 11 domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05930"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27787"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB44"
FT                   /protein_id="ACR27787.1"
FT                   /translation="MATAQQLAEWLSVSPRTVYRDVRDLQLSGVPIEGEAGIGYRLNRA
FT                   AHLPPLTFTSEELAALAAGARMLESWGGATLAGGARSALAKIASAMPADKRVALDRLPL
FT                   FAPSIHVDAAFREAVDALQLAIDGRRVVRLSYRDKRDAPSERRVWPLGMAYWGGQWTVA
FT                   AWCELRGAFRNFDLARMRGIVACEVYPDVAGRRLADFLRTVERGSH"
FT   gene            complement(623739..624185)
FT                   /locus_tag="bglu_1g05940"
FT   CDS_pept        complement(623739..624185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05940"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05940"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27788"
FT                   /db_xref="GOA:C5AB45"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB45"
FT                   /protein_id="ACR27788.1"
FT                   /translation="MTSTAAQTTATPAAHAPRTLAWFSIPVLDLDRATRFYESMLDTTL
FT                   RREISGGVPMAMFGAAGAKASDGGLVQDPHGSTPGTAGALVYLNAHASVSAALERARRA
FT                   GGAWPPRSSWPNGCRYRRARSIATSATCSCRACRSRARRGSATA"
FT   gene            complement(624467..625774)
FT                   /locus_tag="bglu_1g05950"
FT   CDS_pept        complement(624467..625774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05950"
FT                   /product="putative N6-adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05950"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27789"
FT                   /db_xref="GOA:C5AB46"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB46"
FT                   /protein_id="ACR27789.1"
FT                   /translation="MSSSLFDFFAPCPRGLEAALAAELAEIGARRIAGAPFEAGTQVPG
FT                   GVHFRGGWMAGMAANLHSRIASRVLLKIADRPYRSEQDVYALALEQQWERWFAATQTLR
FT                   VDVTAIKSPLKSLEFATLRVKDAICDRLREKTGARPSIDTAQPDVRVFAFLTATHCTLY
FT                   LDTSGEPLFKRGWRLDKGAAPLRENLAAGILRVAGWTPAVPLYDPMCGSGTFLAEAAQI
FT                   ALDVAPGVERRFGFEKLKQYDITAWQTLKVAAMDAKRAARGRHAALPVYGSDISGDMLD
FT                   KARANLERAGVPAISLKQVDARFMAPPTDTPGLIVANPPYGERIEVRGRGPRGDARETG
FT                   RNRGNDDAFRRTHTDAPDGEFFIALGNALKQRFAGWQAFLLSSDRSLPGQLRLRESAKT
FT                   PLFNGALECRLFRFDVVAGSVRQRPAQGAEAAGGDA"
FT   gene            complement(625902..628022)
FT                   /locus_tag="bglu_1g05960"
FT   CDS_pept        complement(625902..628022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05960"
FT                   /product="Site-specific recombinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05960"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27790"
FT                   /db_xref="GOA:C5AB47"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB47"
FT                   /protein_id="ACR27790.1"
FT                   /translation="MFRSLPILLKKWRASRSASHQLDALLANADADAPYAERSEWLIEL
FT                   AHWLRRDGTLQTPGASDGAAAEPRSPTATAHARLRYVLHVLDRNPAWKTHVARILRALL
FT                   RETDAISLLCDAGMPVHSGFFGALFERIDASLIPPAPNRRELAALFTLMFPAPGDGAWI
FT                   EALPDDLLARLQELFGHDVSEAERHQPGSFSRDLLAALHNLSCQISSTGLSQTVRSRLA
FT                   ADDAHRPIDAQPFYRLMRAMLAVEAAQAAVDEGGEPDRLLHEVNYLRVLLDECRESADD
FT                   VSAHLYRNGVSVDIVFQVERMRMRIQRAESLLNAWMARDDRRGLARLTAELIDANLSSQ
FT                   SVAHLVRSSTSLFARKLVETNADTGEHYITRGRADYLKMMRMAAGGGLVTVATVCVKFW
FT                   ITGAHLQAMVEGFLAGLNYAASFTLMHFLHFTLATKQPAMTAPTLARELDGTGSDAGMR
FT                   EFVASVIALIRTQAAAITGNMLVVLPVCLAVQLGAHALLHADVISPAKAHATLRSFSLL
FT                   GPTPVYAALTGVLLWASSLVAGWADNWFVLHRVGDAIAWHRRLRLTLGAAGAARLARFC
FT                   RSNVAGVVSNVGLGMMLGLVPAIVSAFAFGFEVRHVTLSAGSIGVALGVLGKGALDSAE
FT                   LWWAAAGVLSMAVLNVAVSFALAFTMAVRSRSLRPTRVRALLAAIGRAVRANPLSLIWP
FT                   LAARGERETRPH"
FT   gene            complement(628221..628946)
FT                   /locus_tag="bglu_1g05970"
FT   CDS_pept        complement(628221..628946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05970"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05970"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27791"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB48"
FT                   /protein_id="ACR27791.1"
FT                   /translation="MTDRTPRSVRRARAGGLKALAAAVTSAAVALATGCASPPSHFYTL
FT                   SGDPATVTAGRAMPANPAFLIQVPAVSVPEQVAKTQFVVQRDAARVDVLEERRWASPPA
FT                   DEIRRALSAALTRRLDTIDVADAAVPPGVPVYRVSVDVQRFESWPGERAALDAVWSVRS
FT                   LATQSVMTCRSTLSEPVAAGYDALVAGHRKAVGELAERIAAGVRAMAAQPAGVSTRNGA
FT                   AAPAAVRCPLEPGAAPKAG"
FT   gene            complement(628943..630583)
FT                   /locus_tag="bglu_1g05980"
FT   CDS_pept        complement(628943..630583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05980"
FT                   /product="Paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05980"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27792"
FT                   /db_xref="GOA:C5AB49"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB49"
FT                   /protein_id="ACR27792.1"
FT                   /translation="MNSPQGPQHDPNAAPPDGPELPSPVVARRSGWLPSLVWLVPLVAA
FT                   LIGVGLVVKSVFDRGPEITISFRSAEGLEPGKTQVKYKDVEIGTVKTIKLSKDLSHVLV
FT                   NVQLKKEAEDFAVKGSRFWVVRPRVGVSGVSGLNTLLSGAYIGVDAGRSSDSESDFAGL
FT                   ETPPPVTGDEKGTSYVLRGDSLGSVDIGSPVYYRRVQVGQVVGFSLDKDGKGVTFNVFV
FT                   NAPYDQYVGTNTRWWQASGVDLRLDSSGFKLNTQSLATVILGGLAFQSPPNQSAGEPVK
FT                   NGATFRLGADQADAMRDPDGQPVDVVMNFNQSLRGLSVGAPVDFRGIVLGNVTNIGIEY
FT                   DPQHKNFMMPVTMNIYPERLGKRFRELVASQGEAAQQDILRSLVEHGLRGQLRTGNLLT
FT                   SQLYVAVDFFPKAPRAKLDLSRKPVELPTVPNTLDELQLQVADIAKKLDKVPFDQIGNN
FT                   LNDALKHADQLFQQLDTQVAPQARDTLSAAKQTFTTAEATLQQDSPLQSDVRGALKELT
FT                   RTLRTLNNLADYLERHPESLLRGKAGDQK"
FT   gene            complement(630576..631217)
FT                   /locus_tag="bglu_1g05990"
FT   CDS_pept        complement(630576..631217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g05990"
FT                   /product="Paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g05990"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27793"
FT                   /db_xref="GOA:C5AB50"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB50"
FT                   /protein_id="ACR27793.1"
FT                   /translation="MKIVSAASRGMASCHACGQVQKLARRDAHPAEPCARCGAPLHLRT
FT                   PDSIMRTWALLLAAAILYIPANLLPIMRTASIVGAQEDTIMSGVVYFWVSGDWPLAVVV
FT                   FVASILVPMLKLGALTILVISVQRRSAWRPMQRTRLYRIVERIGRWSMLDIFVVTLTVA
FT                   LVHFRSLAEITAGPGALAFGSVVILTMLASMQFDPRLIWDHVVTSGKHHE"
FT   gene            complement(631214..631909)
FT                   /locus_tag="bglu_1g06000"
FT   CDS_pept        complement(631214..631909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06000"
FT                   /product="Paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06000"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27794"
FT                   /db_xref="GOA:C5AB51"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB51"
FT                   /protein_id="ACR27794.1"
FT                   /translation="MERNDLIACHECDALLHKPQLGRKESARCPRCDALLYRSSSTRIE
FT                   PLCALTLAALITFVIAQAFPILEMEVNGIRVRTTLLGALGALWDQDMRIVAIMVFCSTL
FT                   LFPLIEMAALLYVLFPLRAGYLPPGLNAVLRAIQLVRPWGMIEVFMLGILVTIVKMVSL
FT                   ARVVPEAALFAFGALTLMLAAVVMFDPRALWDVADALRAPRAGAPDADADHAAGPSGSA
FT                   AAASGAPRP"
FT   gene            632184..632761
FT                   /locus_tag="bglu_1g06010"
FT   CDS_pept        632184..632744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06010"
FT                   /product="Cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27795"
FT                   /db_xref="GOA:C5AB52"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB52"
FT                   /protein_id="ACR27795.2"
FT                   /translation="MASTLSPNRPAGYTRTAIALHWLIALLIVCGFALGWVMTDIPGFT
FT                   PTKLKYFSWHKWIGVTVFALAVIRVLWRATHVPPPLPAGTSRLATGGAHAVHALLYLLM
FT                   LAIPVTGYLYSSASNIPVVYLGLVPLPRLIDPDPALKQTLKTLHVTLNYTLLALVSLHL
FT                   LGALKHQLLDRDGVLARMLPFLK"
FT   gene            632758..633318
FT                   /locus_tag="bglu_1g06020"
FT   CDS_pept        632758..633318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06020"
FT                   /product="YceI, base-induced periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27796"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB53"
FT                   /protein_id="ACR27796.1"
FT                   /translation="MKIALHRSVLAAVAAAALAFSGSALAQMDLAKSKVSAVSKQMNVP
FT                   TEGVFKKFSADLKFDPAKAAQGSARVSIDVASFDLGDKMYNDQVAGKEWFDAKAFPQAS
FT                   FVSSSIAPAGGNKYEVAGKLTIKGKTVPVTVPVTVTDSGATRVFDGVLPIKRSTFEIGT
FT                   GEWKDTSIVADEVQIKFHLVAAK"
FT   gene            633390..633968
FT                   /locus_tag="bglu_1g06030"
FT   CDS_pept        633390..633968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06030"
FT                   /product="YceI-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27797"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB54"
FT                   /protein_id="ACR27797.1"
FT                   /translation="MNKPLMMAAGALAAALSIPAMAAPVTYQLDPSHTYPSFETDHFGG
FT                   LSVWRGKFDESSGTVTLDRAAKTGSVEVTTKIASIHTGSAKLDEHVQTPEFFDAAKYPD
FT                   ATYKGTLKFEGDKPVAVVGNLTLHGVTKPLTLKIDSFKCMQHPMLKREVCGVDAVGEFN
FT                   RDEFGIDYGKQYGFKMKTKLLISAEGVAQ"
FT   gene            complement(634186..635136)
FT                   /locus_tag="bglu_1g06040"
FT   CDS_pept        complement(634186..635136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06040"
FT                   /product="preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27798"
FT                   /db_xref="GOA:C5AB55"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB55"
FT                   /protein_id="ACR27798.1"
FT                   /translation="MEFFRIRKDIPFMRHALVFNVISLVTFLAAVFFLVHRGLHLSVEF
FT                   TGGTVLEVQYQQAAELEPVRAALGKLGYADAQVQSFGTSRNVMIRLALKSGLTSAQQSD
FT                   QVMAGLKAQNPDVQLQRVEFVGPQVGKELATDGLLALACVVIGIVIYLSFRFEWKYAVA
FT                   GIIANLHDVVIILGFFAFFQWEFSLSVLAAVLAVLGYSVNESVVIFDRIRETFRRERRM
FT                   TVQEVINHAITSTMSRTVITHTSTEMMVLSMFFFGGPTLHYFALALTVGIMFGIYSSVF
FT                   VAGSLAMWLGIRREDLIRDKKGAHDPNDPNAGAQV"
FT   gene            complement(635153..637186)
FT                   /locus_tag="bglu_1g06050"
FT   CDS_pept        complement(635153..637186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06050"
FT                   /product="preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27799"
FT                   /db_xref="GOA:C5AB56"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB56"
FT                   /protein_id="ACR27799.1"
FT                   /translation="MNRYPIWKYVVMVVALAIGLLYTLPNFYGEAPAVQVSSGKATVKI
FT                   DSSTLAQVEAALKAASITPDDITFDNSANNANIRVRLKDTDTQLRVKDLLQKALNSDPS
FT                   DPQYVVALNLQSASPRWLTALHALPMYLGLDLRGGVHFLLQVDMTGALNKKLDSDATDA
FT                   RTQLRDRGIRDGGVNRVDQSVVANFADQATAEQARSFLAGSITELQWATQPGGGGYQVV
FT                   GTFTPAVRQAVEEAALKQNLTTLHNRVNELGVSEPIIQQQGNDRIVVELPGVQDTAKAK
FT                   DIIGRTATLEARLADPVNLHPNPNDPVPPGDELFTQGNQVPVLLRKQVIFTGDRIIDAS
FT                   AGFDEHNRPSVNIRLDSNGGRAVRTVSRENIGKPMAMVLFEKGKGEVLTVATIQSELGD
FT                   RFQITGQPTPQAAADLALLLRAGSLAAPMDIIEERTIGPSLGADNIRMGVHSVIWGFVA
FT                   IAVFMVAYYLLFGVVSVIGLSVNLLLLVAALSVMQATLTLPGIAAIALALGMAIDSNVL
FT                   INERVREELRGGASPQIAIQQGYAHAWATILDSNVTTLIAGLALLAFGSGPVRAFAIVH
FT                   CIGILTSMFSAVFFSRGLVNLWYGGRKKLKSISIGQVWKPAAATPGADLALPEQGGDGG
FT                   TAKAGRPAARTANAGTAARGAKPVARRRSGPGVPPKKPGSSQ"
FT   gene            complement(637295..637621)
FT                   /locus_tag="bglu_1g06060"
FT   CDS_pept        complement(637295..637621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06060"
FT                   /product="preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27800"
FT                   /db_xref="GOA:C5AB57"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB57"
FT                   /protein_id="ACR27800.1"
FT                   /translation="MSFISNAFAQGAGGSAESSLMSFLPLVLMFAVLYFIMIRPQMKRQ
FT                   KEHRNMLAAMAKGDEVVTNGGLVGKVTKVGEAYVGVEVSEGTEITVQKSAVTTILPKGT
FT                   IKSL"
FT   gene            complement(637900..639120)
FT                   /locus_tag="bglu_1g06070"
FT   CDS_pept        complement(637900..639120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06070"
FT                   /product="Queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27801"
FT                   /db_xref="GOA:C5AB58"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB58"
FT                   /protein_id="ACR27801.1"
FT                   /translation="MTDRRPEPVPTHVPPENGLNFELLTTDGHARRGRVTLNHGVVETP
FT                   IFMPVGTYGTVKAVQPRELREMQAQIILGNTFHLWLRPGLETIGAHGGLHRFMGWDRPI
FT                   LTDSGGFQVFSLGELRKITEDGVTFASPINGDKLFLSPEVSMQIQKVLNSDIVMQFDEC
FT                   TPYATGGVPTTHREAAESMRMSLRWAKRSLDEFDRLGNPNALFGIVQGGMFEDLRDESL
FT                   AGLAALDFHGYAIGGLSVGEPKEDMMRVLRHVGPKLPAHKPHYLMGVGTPEDLVEGVAN
FT                   GVDMFDCVMPTRNARNGWLFTRFGDVKIRNATHRNSLKPLDERCGCYTCRHFTRGYLHH
FT                   LHRVGEILGAQLNTIHNLHYYLELMSEIRAAIETHTFDAFRARFAADRARGVEAEPVAP
FT                   GEAAAGG"
FT   gene            complement(639236..640288)
FT                   /locus_tag="bglu_1g06080"
FT   CDS_pept        complement(639236..640288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06080"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27802"
FT                   /db_xref="GOA:C5AB59"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB59"
FT                   /protein_id="ACR27802.1"
FT                   /translation="MFKLSDFDFDLPPELIAQTALPERSASRLLEVGGTAGPARLVDRR
FT                   FTELPDCLAAGDLLVFNDTKVLKARFFGQKASGGRIEVLIERVTGPRTALAQIRASKSP
FT                   AAGATLTLADAFEVTVGERVEPFFTLHFPDDCLTLIERHGRLPLPPYIEHDPDATDETR
FT                   YQTVFASNPGAVAAPTAGLHFDEALLATLRARGVETATLTLHVGAGTFQPVRVDNIADH
FT                   RMHSEWYELTDALVERIAATRARGGRVIAVGTTSMRALEAAARDAEAAGRPLAATRAET
FT                   DIFITPGYRFRVVDRLVTNFHLPKSTLLMLVSAFAGIEPIRAAYRHAIAERYRFFSYGD
FT                   AMLLTRREPD"
FT   gene            640466..642877
FT                   /locus_tag="bglu_1g06090"
FT   CDS_pept        640466..642877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06090"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27803"
FT                   /db_xref="GOA:C5AB60"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB60"
FT                   /protein_id="ACR27803.1"
FT                   /translation="MPVPARRSVSAAAAPDAEVGDAAREHGHGAVPHAPASPPTRSRTP
FT                   RRGRDGRLAEPAVEAADAARGDPAGRAGEGGSGTARVAGRDEAGDADHADAADAADAPP
FT                   ARGAKAAKPAKAAPAKLVKTADKLAKLGLTRSIDLVLHLPMRYEDETTLTPIRELLPGE
FT                   VAQTEGVVYDNEITYRPRRQLLVKLRDDDGAELVLRFLNFYGSQVKQMAVGQRLRVRGD
FT                   IRGGFFGLEIVHPAVRVVDENTPLAQALTPVYPSTAGVSQAYLRKAIDNALARTPLPEL
FT                   LPPEVAAAYLQPLGVPTLADAVRQLHHPAVDDDETALIDGTHPAWIRIKFDELLAQQLS
FT                   LKRAHEERRTRAAPAMPRRAPADAGSLAARLLAALPFALTGAQARVVDEISHDLTQPHP
FT                   MQRLLQGDVGSGKTVVAALAAAQAIDAGYQAALMAPTEILAEQHARKLRGWLEPLGVTV
FT                   AWLAGSLKAKDKRAAIEAAALGTAQLVIGTHAIIQDSVEFARLGLVIVDEQHRFGVAQR
FT                   LALRAKAGGPAGFQPHQLMMSATPIPRTLAMTYYADLEVSTIDELPPGRSPIVTKLVGD
FT                   ARREEVIARVRDAALGGRQVYWVCPLIEESETLQLQTAVETYETLVAALPGIQVGLVHG
FT                   RLAPAEKAAVMEAFSRNEVQLLVATTVIEVGVDVPNASLMVIEHAERFGLAQLHQLRGR
FT                   VGRGTAASACVLMYSGPLSIAGRERLKTMRETNDGFEIARRDLEIRGPGEFLGARQSGA
FT                   AMLRFADLERDGWLIEPAREAAGVLIARYPDVVTQHLARWLGAREQFLKA"
FT   gene            643024..643983
FT                   /locus_tag="bglu_1g06100"
FT   CDS_pept        643024..643983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06100"
FT                   /product="Oxidative stress regulatory protein OxyR"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27804"
FT                   /db_xref="GOA:C5AB61"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB61"
FT                   /protein_id="ACR27804.1"
FT                   /translation="MTLTELKYIVAVARERHFGRAAEACFVSQPTLSVAIKKLEDELNV
FT                   QIFERGASEVSVTPIGDQIVTQAQRVLEQTFAIKEIAKQGKDPLVGPFRLGVIYTIGPY
FT                   LLPTLVKQMIRRVPQMPLMLQENYTLKLLELLKQGEIDAAIMALPFPETGLMVRPLYDE
FT                   PFVVALPSSHPWSKRRKIDAADLKQETMLLLGNGHCFRDHVLGVCPELMHFSQTADGIQ
FT                   KTFEGSSLETIRHMVASGVGITVLPRMSVAEIGPTANNSDSDLLSYVPFDEPVPDRRVV
FT                   LVWRKSFTRMPAIDAISEAISACVLPGVAKLDMPATLN"
FT   gene            644806..645294
FT                   /locus_tag="bglu_1g06110"
FT   CDS_pept        644806..645294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06110"
FT                   /product="Ferritin, Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27805"
FT                   /db_xref="GOA:C5AB62"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB62"
FT                   /protein_id="ACR27805.1"
FT                   /translation="MAKKGNATQINIGISDKDRKKIADGLSRLLADTFSLYLKTHYFHW
FT                   NVTGPMFNTLHLMFEEQYNELWLAVDSIAERIRTLGVVAPGTYGDFAKLTSVPEASGVP
FT                   VAEDMIRQLVEGHETVVRTARALFPDADSAGDEPTADLLTQRLQTHEKTAWMLRSLLQ"
FT   gene            645484..646347
FT                   /locus_tag="bglu_1g06120"
FT   CDS_pept        645484..646347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06120"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27806"
FT                   /db_xref="GOA:C5AB63"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB63"
FT                   /protein_id="ACR27806.1"
FT                   /translation="MFARFPLYLKLIRMDKPIGSLLLLWPTLNALWIASNGRPAPLLLV
FT                   IFIVGTLLMRSAGCAINDYADRDFDSHVKRTVDRPLASGKIRAWEAVAIAAGLAIAAFL
FT                   LILPLNLLTKELSVVAVIVAGTYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPLL
FT                   AWVMLAANVFWSVAYDTAYAMVDRDDDLKIGMRTSAITFGRHDVLAIMLCYAMVFAIYL
FT                   WVGLVERFGPLYWLGWAVALGCSVYHYTLIKDRDRMKCFAAFLHNNWLGGALFAGIAAH
FT                   YAVAAR"
FT   gene            complement(646561..647376)
FT                   /locus_tag="bglu_1g06130"
FT   CDS_pept        complement(646561..647376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06130"
FT                   /product="Pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27807"
FT                   /db_xref="GOA:C5AB64"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB64"
FT                   /protein_id="ACR27807.1"
FT                   /translation="MKIAFIGGGNMASALIGGIVKRGTAAPDTLYVIDPNDGSRTKLRE
FT                   TFGVRTGETVDAALAGYDAIVLAVKPQVLAEVAKTLAPHLGGALVISIAAGVRATDLSR
FT                   WLGGYARVVRAMPNTPALVGMGVTGLAALPGVDAAGRELGSAVLGAVGETVWFDDEAKL
FT                   DAVTAISGSGPAYVFYFIEALQEAARQLGLNDEQGRALAVATFTGAAQLAAQSGEPAGV
FT                   LRERVTSKGGTTAAALAAFDAQDLKQAIVRGVLAAEARARELGNELGGA"
FT   gene            complement(647402..648112)
FT                   /locus_tag="bglu_1g06140"
FT   CDS_pept        complement(647402..648112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06140"
FT                   /product="Alanine racemase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27808"
FT                   /db_xref="GOA:C5AB65"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB65"
FT                   /protein_id="ACR27808.1"
FT                   /translation="MLDLAARLASVHRRIDDAARSAGRAPGDVALLAVSKTFPAEAVRA
FT                   AHAAGQRAFGENYVQESLDKIAALADLRASLEWHFIGPLQSNKTRAVAERFDWVHSVDR
FT                   LKIAQRLAEQRPAQLPPLNVCVQVNVSGEATKSGVAPDEVAALAQAVAALPALRLRGLM
FT                   AIPEPAGDLAAQRAPHRRLRELYDALRAGGLALDTLSMGMSADLEAAVLEGATIVRIGT
FT                   AIFGARDYSTPSAS"
FT   gene            complement(648233..649459)
FT                   /locus_tag="bglu_1g06150"
FT   CDS_pept        complement(648233..649459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06150"
FT                   /product="glycolate oxidase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27809"
FT                   /db_xref="GOA:C5AB66"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB66"
FT                   /protein_id="ACR27809.1"
FT                   /translation="MQTNLADFIRGTPDGDEAESILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQTLEGAPVTRSTQQHLDRCLTCRSCESTCPSGVQYGRLVEIGRQQVDA
FT                   RVPRPLSQRLVRRALASFVPNAALFAPAMRLGQHLRPLLPRRLRDKVPARTRPLAWPSA
FT                   RHPRKMLMLAGCVQPAMMPNVNIATARVLDALGIETVIAPEAGCCGAIRLHLNYRDEAL
FT                   ADARRNIDAWWPFIEQGAEAIVMNASGCGATVLEYAHLLRDDAAYADKARRIVELTQDV
FT                   SGLLAGFAPQLVALARHRARQTVAYHPPCTLQHGQQSRGKVERLLEALGVELRVPADSH
FT                   LCCGSAGTYSLTQPALSYKLRRQKLAKLGELDAQLIVSGNIGCITHLQSGTTTPVMHWV
FT                   QLVEQLLDD"
FT   gene            complement(649464..650552)
FT                   /locus_tag="bglu_1g06160"
FT   CDS_pept        complement(649464..650552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06160"
FT                   /product="glycolate oxidase FAD binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27810"
FT                   /db_xref="GOA:C5AB67"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB67"
FT                   /protein_id="ACR27810.1"
FT                   /translation="MEQDDIVAHWAERIRAAAADGRGLRIRGGGTKDWYGQSLDGEILD
FT                   TRAHHGIVSYDPAELVITARAGTPLAQIEAELAAHGQMLAFEPPGFGAAATFGGVIAAG
FT                   LSGPRRASAGAVRDFVLGVTLMNGRGSVLRFGGQVVKNVAGYDVSRLMAGSLGTLGLML
FT                   ELSVKVLPVPVAELTLKFDMSATDAVRKLNEWAGHPFPISASVWRFGSLVLRLSGAEAA
FT                   VKAAKATLGGEAVDAVEAERFWEGVREQNDPYFNLLAPGQALWRLSLPSITEPLHLPGS
FT                   QMMEWGGAQRWWITDADAQTVRISAKQAGGHATLYRAGSGYDRGAGVFTPLAGPLAAMH
FT                   RGLKAAFDPDRVFNRGRLYPEL"
FT   gene            complement(650652..652169)
FT                   /locus_tag="bglu_1g06170"
FT   CDS_pept        complement(650652..652169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06170"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27811"
FT                   /db_xref="GOA:C5AB68"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB68"
FT                   /protein_id="ACR27811.1"
FT                   /translation="MNAAEPAIHPAGTLPDPATRAQRQREVVQALMAVLPSHCLLHRDE
FT                   DTAAYECDGLAAWRRLPLAVALPETESQVQRIVQICRRMNVPIVPRGAGTSLSGGALPH
FT                   ESGIVVSLARFTRIVEVDSYARTATVQPGVRNLAISEAAAPYGLYYAPDPSSQIACTIG
FT                   GNVAENSGGVHCLKYGLTVHNVLRVRAVTIDGDVVEFGSLALDTPGLDLLAVMIGSEGM
FT                   FAIVTEVTVRLIPKPQAAQLVMASFDDVVKGGEAVAAIIAAGIVPAGLEMMDRPATQAV
FT                   EAFTQAGYDLDAAAILLCESDGTPDEVLEEIARVKAVLEQSGATRIQVSRSESERLRFW
FT                   SGRKNAFPAAGRISPDYYCMDGTVPRRAIGPLLARIEQMEARYGLRCINVFHAGDGNMH
FT                   PLILFDGNDPDQLHRAELFGADILESCVELGGTVTGEHGVGVEKLNSMCVQFSPEERDA
FT                   FFAVKRAFDPANLLNPDKGIPSRARCAEYGRLHVRGGLLPHPGLPRF"
FT   gene            complement(652166..653581)
FT                   /locus_tag="bglu_1g06180"
FT   CDS_pept        complement(652166..653581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06180"
FT                   /product="FAD linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27812"
FT                   /db_xref="GOA:C5AB69"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB69"
FT                   /protein_id="ACR27812.1"
FT                   /translation="MNHPAPPASLRRPFPDALRAALVAAFGERVSTSEAVRAHHGRDES
FT                   PFDPELPDAVVFAQHADEVRTVVTLCAQHGVPLIPYGAGSSLEGHLLAVRGGVSLDLSR
FT                   MNRVLSIDADDLTVTVEPGITRKTLNEALRDTGLFFPIDPGADASIGGMTATRASGTNA
FT                   VRYGTMRENVLGLTAVLADGRVVKAGSRARKSSAGYDLTRLFVGSEGTLGVITEITLRL
FT                   HPLPEAVSAAICTFPSMGDAVRSVIETIQIGVPIARVEFVDALGVRAINRHSNLTLAEA
FT                   PTLFFEFHGTEAGVREQAERVQELAAQNRGRGFEWATRPEDRTRLWSARHNAFFGMLQL
FT                   KPGCRAVTTDVCVPISRLAECVEETELDLRASTLPCPIVGHVGDGNFHVAILIDPARPE
FT                   ELEEAEQINQRIVERALRMGGTCTGEHGVGLHKMRFLAAEHGENAIETMRAIKLALDPR
FT                   NLMNPGKIFSLDA"
FT   gene            653573..654040
FT                   /pseudo
FT                   /locus_tag="bglu_1g06190"
FT                   /note="disrupted gene"
FT   gene            654025..654576
FT                   /locus_tag="bglu_1g06200"
FT   CDS_pept        654025..654576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06200"
FT                   /product="Putative ATP:cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27813"
FT                   /db_xref="GOA:C5AB70"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB70"
FT                   /protein_id="ACR27813.1"
FT                   /translation="MGNRLSKIATRTGDDGTTGLGDGSRVGKDDVRIAAIGDVDELNSQ
FT                   LGVLLAEPLPEDLRGALSAIQHDLFDLGGELCMPGHVAMTDAHLARLDDWLAHYNAQLP
FT                   PLKEFILPGGSRAAALAHVCRTVCRRAERSIVTLGAAGEVAPAPRRYVNRLSDLLFVFA
FT                   RVLNRAAGGRDVLWEHGRPE"
FT   gene            654732..655940
FT                   /locus_tag="bglu_1g06210"
FT   CDS_pept        654732..655940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06210"
FT                   /product="Globin"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27814"
FT                   /db_xref="GOA:C5AB71"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB71"
FT                   /protein_id="ACR27814.1"
FT                   /translation="MTTLTAEQMDRVKASAPMLAAEGPKIARHFYQRMFRRHPELRNLF
FT                   NQSHQKAGGGQPEALARAVWAYAANIDNLGALGGAVSRIAHKHVSLSVRPEHYPIVGDN
FT                   LLAAIVEVLGEAVDAPTLDAWRAAYAQLAQILTGVEARLYAQAPWTGYRPFRVERKQRE
FT                   SDEITSFYLTPTDGGVAPHFEPGQYVSVKRYIGALGVDQPRQYSLSDLPNGKWLRISVK
FT                   REAGRGAELPAGKMSTLLHDGVEQGAIVEVSAPMGDFTLAREADTPVVLISGGVGITPM
FT                   VSMASALAAAGSRRPLHFLHACRSGRAHAFRDWLNALVASRPNTTRQVLYETVGPNDEA
FT                   GVDHDREGRLTPAELDAAMLPDADYYVCGPVGFMTAQRETLLARGVEPARVHTEIFGSG
FT                   ALA"
FT   gene            complement(656018..657091)
FT                   /locus_tag="bglu_1g06220"
FT   CDS_pept        complement(656018..657091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06220"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27815"
FT                   /db_xref="GOA:C5AB72"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB72"
FT                   /protein_id="ACR27815.1"
FT                   /translation="MPPHNTDDVRIRELKELTPPNHLIREFPCSEAVAELIYSTRRALH
FT                   RILHGMDDRLVVVIGPCSIHDTNAAVDYAKQLVELRRRFRDDLEIVMRVYFEKPRTTVG
FT                   WKGLINDPHLDNSFKINEGLRTARELLLQINELGLPAGTEFLDMISPQYIADLVSWGAI
FT                   GARTTESQVHRELASGLSCPVGFKNGTDGNVKIAVDAIKAASQPHHFLSVTKGGHSAIV
FT                   STSGNEDCHVILRGGKAPNYDADSVNAACADIGKAGLAARLMIDASHANSSKKHENQIP
FT                   VCADIGRQLAAGDERIVGVMVESHLVGGRQDLTPGCPLTYGQSITDACIGWDDSVKVLE
FT                   GLADAVKARRVARGSGN"
FT   gene            complement(657511..658977)
FT                   /locus_tag="bglu_1g06230"
FT   CDS_pept        complement(657511..658977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06230"
FT                   /product="Peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27816"
FT                   /db_xref="GOA:C5AB73"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB73"
FT                   /protein_id="ACR27816.1"
FT                   /translation="MNIIEPGIRNLALAKDILLTPYGLDETLLTRTLADIFTHRVDYAD
FT                   LYFQATRSEAWSLEEGIVKSGSFSIDQGVGVRAVAGERTAFAYSDDLSPEAIRQAASAT
FT                   KAIAAAGGGRRRIQVASSLTGVAGRDLYLPSDPLASLDATAKVKLLERVEQMARGRDPR
FT                   ITQVMAGLAGEYDVVLVARSDGALAADIRPLVRVSVTVIAEQDGRREIGSGGGGGRFDY
FT                   GYFSDEVLSRYVDDAVHAALVNLDARPAPAGAMTVVLGSGWPGVLLHEAIGHGLEGDFN
FT                   RKGSSAFAGRIGERVAAKGVTVVDDGTLPNRRGSLNIDDEGNPTQCTTLIEDGILKGYI
FT                   QDTLNARLMKMPVTGNARRESYAALPMPRMTNTYMLNGDKDPQEIIASVKHGLYAVNFG
FT                   GGQVDITNGKFVFSASEAYMIENGKVTYPVKGATLIGSGPESLKYVSMIGNDMKLDSGV
FT                   GVCGKEGQSVPVGVGQPTLRIDSMTVGGTA"
FT   gene            complement(659070..659909)
FT                   /locus_tag="bglu_1g06240"
FT   CDS_pept        complement(659070..659909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06240"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27817"
FT                   /db_xref="GOA:C5AB74"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB74"
FT                   /protein_id="ACR27817.1"
FT                   /translation="MTDRSERLAPLTVAAVQMVSSPDLARNLDDAGRLVAEAAALGAKL
FT                   VLLPEYFCFMGRRDTDKLALAEPYQDGPIQRFLADCARRHGVWLIGGTLPLAAPEPSRV
FT                   LNTTLVFGPDGRECARYDKIHLFSFEKDGESFDEARTIRPGGTDASAVRGFEAPFGRVG
FT                   LSVCYDLRFPELYRRLGDCALIVVPSAFTYTTGRAHWETLLRARAIENQCYVLAAAQGG
FT                   RHENGRRTWGHSMLVDPWGEIVAVRDESPGVVAGTVDPARLAEVRQSLPAWRHRVLD"
FT   gene            complement(659950..664167)
FT                   /locus_tag="bglu_1g06250"
FT   CDS_pept        complement(659950..664167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06250"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27818"
FT                   /db_xref="GOA:C5AB75"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB75"
FT                   /protein_id="ACR27818.1"
FT                   /translation="MPDRQESAASSPEAGPPRHDHPVLRRVCRVVLIGGATIYFVAASS
FT                   YLGLRYVLLPQVDRLRPRIESFVSDKLHAEVRIGRLAPHWSGMQPGVDVTALTIRKDGT
FT                   TALTIPHATAAIAWGSLLSLAPTLSSLVVDAPDLLIERNRDGTLMVAGVAVPTTRRSGN
FT                   DAFSTWLLRQQAIVLRGGTLRWRDAQRNAPELTLTGIRLAVLNDGLVHRLALQAPANGT
FT                   LFAGPLDFRARFTHRPLAAIGRPANWTGEAYLSTGPVDLPTLARYLPVPLTAYAGRLDN
FT                   TIWLGFQDGRLRDAHGMLSGADVALRVRPTQPRLDIPTASFGWNLALDPGHDYTLNLTD
FT                   LHAELGQPPLDDGTPLSRLLAFRTLTARYRVPDATHGQLIQVAGDRVDLGILAEFVRGL
FT                   PLPARLRNALVRTDPRGLIANYVMEAERAPPDPAELAGDETARAAPIVRYRITGDLQGI
FT                   SVEAQEPGPGLSPRGHPRAGVPGFENLWGHVDANERAGQARIDTVRAAVTMPGVFADPR
FT                   LTFDRLSAQASWTVTHAPGEPRPRVDVKVPLLYVANPDAEITAAGGYTNPGHGRGSLDL
FT                   KAEFGRAALARLVRYLPTSMSDHLHQYLGHALQAGTVSKGATIVAKGPLETFPYEHTPH
FT                   DGVFRIVAPFTGGRFDPTPQPLHTLADGTPSVWPALDGISGVFELEQNKLGLDIASAHY
FT                   KRVQLSGVRGRIADLGNPARSPLVIEGRAHGPLADLIDYANHSALGGMSRHLGERVTAQ
FT                   GPASLALKLTVPQRAAHGHTQVEGALRFGDNTLAADGLPPLSQLRGTIRFTQQSASLHR
FT                   LSARLLGGEVHADGSYRVNGGYALDVNGRIAVDSARGLNLHGPAAALLGRVVGDAPYRL
FT                   SVRGAKDGLPEIDASSDLTGLALDFPAPFTKAAGTPMPFSFTLAPLAPEAGRTLEQADL
FT                   ALGPVAAHYVLDATQGEPLRAVRGSLGMNRLPDLPRDGVTAAVDASELDADAWLAFAKT
FT                   LRAAPAAPSSPARAPSPEPAAAARVDLASFAPKRFALHLGRLKLLKRNWENVIVGASHV
FT                   DDLWQANVASNQVSGYLSWAPPMPGETGAGVLNARLAKLIVPDSADHDLVGGAMDMPTS
FT                   RAMPSIDLVVDQVVARGHDIGRLQVNAHNFSENGVPVWQLDRLELANPAAKLTATANWR
FT                   TSKRAIALGADADDAPRRTVFDFKLAIDDAGALLDRVGLPRTIAGGRGTLQGKVGWRGG
FT                   PTAIDYPTLDGRLSLDLAHGQILKVDPGAAKLLGVLSLQGLARFLTLDFRDVIGKGLPF
FT                   DSIEGTGRINDGIVTTDDFRIVTAPARVTVTGSVDLAHETQDLLAHITPKLSASAAAIG
FT                   AAVINPLLGLGVLAANLALSQTLAHAFAFDYVITGSWAHPQIQRVADDRGKMGRMPADA
FT                   ARP"
FT   gene            664450..667296
FT                   /locus_tag="bglu_1g06260"
FT   CDS_pept        664450..667296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06260"
FT                   /product="bifunctional glutamine-synthetase
FT                   adenylyltransferase/deadenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27819"
FT                   /db_xref="GOA:C5AB76"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB76"
FT                   /protein_id="ACR27819.1"
FT                   /translation="MTDANLLLSTAYSRYLARAVAARPELAERIAEAAAAPLSREAIEA
FT                   RLDELLAAASPAAAPGEDALRRALRQLRLEVFGAVVERDLAGAADVTEVTATMTDLAEV
FT                   AIQRSLAVLSAELEALYGEPRGPAGERLALGVVGMGKLGGRELNVSSDIDLIFVYEDDG
FT                   ETAGGARAGLATQEYFTRLGRRLIGVLSDATADGYVFRVDMRLRPNGDSGPLVCSLGML
FT                   EEYFYVQGREWERYAWIKGRLVSEPDSEAAQRLATQLDAIVKPFVYRRYLDFGVIGAIR
FT                   SLHRQIRQEAQRRATMRPDKADDIKLGRGGIREIEFSAQVFQLIRGGQDAGFRIRPTLA
FT                   VLAHAAERGLIAAEVAERFAQAYRLLRTIEHRLQYRNDAQTHAMPVDPEDRAALAASLG
FT                   HADYAALVAELDRHRAFVEAQFDQIFSNRSGETGSNGAGGNASGNGAEDAAAWVWSGAL
FT                   ADDGEDDALAARLAGLGFVTPAAVLARLRAVWQSSRYAGLPESSRQRFDRVAQRALDAA
FT                   AGIDAAHRDDTIIRFFDLLETVGRRGAYLALLTEYPAALERVLSVLGATRWGGGYLIRH
FT                   PQLLDELLDDEAIASPFDWPAFKASLRARLAAADGMEQQMDLLRHAQHAEVFRILLIDL
FT                   AGKLSVEHVSDRLSELADAVLDVTLEVVWSQLAKRHRDAPRFAVIAYGKLGGKELGYAS
FT                   DLDVIFLYDDPDDRAADIYTTYTRRLITWLTTATGAGALFDLDLRLRPNGEAGLLVTDL
FT                   DAFRRYQLREGDGANTAWVWEHQALTRARFSAGDARIGAAFEAIREQVLTTPRDGELLA
FT                   REIVGMRDKVAAGHPNHGELFDLKHDRGGMVDIEFIVQYWVLLHAARDPELIRNTGNIA
FT                   LLREVARLGLMDETEAETVGAAYRRYRKRQHQLRLDGMEKARVPSETVAAERAAVLALW
FT                   QRVFGGVAPAAAAADPQG"
FT   gene            complement(667547..669196)
FT                   /locus_tag="bglu_1g06270"
FT   CDS_pept        complement(667547..669196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06270"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27820"
FT                   /db_xref="GOA:C5AB77"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB77"
FT                   /protein_id="ACR27820.1"
FT                   /translation="MLRHLSIRDFVIVARLDLEFDAGFTVFSGETGAGKSILIDALALA
FT                   LGERADASVVRAGCQRADITAEFTLHDRVAQWLDAHAFDADDSVMLRRVIDASGRSRAF
FT                   INGTSATLSQLRELGEMLVDIHGQHAHQLLMRPDAQRELLDTHAGLAAEAAAVARGWRA
FT                   WRDALQKIEAAQVHERELQLEREKLAWQLAELDKLAPQPGEWAEVNAEHGRLTHSASLI
FT                   RGVQGALLAISESDDALLRQLGGVISKVRQLASIDPTLNDVLAALDPAEIQLREAGYSL
FT                   SHYAQRLELDPERLAQVEARLDALHTAARKFRLPPDTLHDEHMARREQLAALDAAADLS
FT                   ALEDAAERAKQAYLADARALSEARAQAAGALGAAVTAAMQELSMAGGSFEVTLVALAEG
FT                   GAHGLEQVEFRVAGHPGVPPRPLAKVASGGELARISLALAVIASAASLTPTLIFDEVDT
FT                   GIGGGVAEVVGRLLHQLGRDRQVLCVTHLPQVAARGDHHFQVAKGLDAAGGTVSTVTPL
FT                   DRASRIEEVARMLGGLEITATTRKHAREMLAA"
FT   gene            complement(669216..670118)
FT                   /locus_tag="bglu_1g06280"
FT   CDS_pept        complement(669216..670118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06280"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27821"
FT                   /db_xref="GOA:C5AB78"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB78"
FT                   /protein_id="ACR27821.1"
FT                   /translation="MKTGNLFQTVALVGRSSTPGIAEPLAALAAAIAKRGLEVVFEAAT
FT                   AREYGIEGHPALTPSEIGARADLAIVLGGDGTMLGIGRQLAPYRTPLIGINHGRLGFIT
FT                   DISASDMLELVPQMLSGSFEREERTLLEARIVRNGEPIYHALAFNDVVVNRSGFSGMAE
FT                   LRVSVDGRFMYNQRSDGLIVATPTGSTAYALSSAGPILHPQLQGIVLVPIAPHSLSNRP
FT                   IVLPDDVKVGIQIIGGRDVNVNFDMQSFTALQLNDTIEVRRSRHTVPFLHPVGYSYYTT
FT                   LRKKLHWNEHPSHDDDPQS"
FT   gene            670240..671262
FT                   /locus_tag="bglu_1g06290"
FT   CDS_pept        670240..671262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06290"
FT                   /product="Heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27822"
FT                   /db_xref="GOA:C5AB79"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB79"
FT                   /protein_id="ACR27822.1"
FT                   /translation="MLDPRARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNV
FT                   MSDLEELGLVSSPHTSAGRVPTPRGYRMFVDTLLSVESPIDDEAVTRLVQTTLQAGEPQ
FT                   QKVVAAAASVLSNLSQFAGVVLTPRRSHVFKQVEFMRLSDKRILLIIVTPEGDVQNRMM
FT                   ATQRDYSSSQLTEASNYINANFAGLSFDEVRRRLREEIDALRDDMTALMHAAVTASTET
FT                   SDDEDTVLISGERNLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAQGVQIFIG
FT                   GESTLVPIDEMSVVTAPYEVNGKIVGTLGVIGPTRMAYHRVIPIVDITARLLSLTLSQQ
FT                   "
FT   gene            671398..672465
FT                   /locus_tag="bglu_1g06300"
FT   CDS_pept        671398..672465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06300"
FT                   /product="Ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27823"
FT                   /db_xref="GOA:C5AB80"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB80"
FT                   /protein_id="ACR27823.1"
FT                   /translation="MRFDLEPPSQHAAAHRVAVLLVNLGTPDAPTPGAVRRYLAQFLSD
FT                   PRVVEIPAIAWQPILRGLILPLRSRASAKKYRSVWMPEGSPLRVYTERQVEGLRPLFAA
FT                   NGYQVLIDYAMRYGTPDIGTVLGQLKRAGTERVLLVPMYPQYSSSTTATAFDAAFAALG
FT                   RMRNQLEVRTLRHYADHPAYIHALAEQVRQYWAEHGRPDFAAGDKLVLSFHGVPKRTLD
FT                   LGDPYHDQCQQTGALLMAALELTPLECRVTFQSRFGKAEWLQPYTAPTLRELGAAGVRR
FT                   ADVFCPGFTADCLETIEEIGMEVRDEFLHGGGGTFHRIPCLNASPAWIDALGQIVAENL
FT                   QGWPVRAPAPADAAA"
FT   gene            672510..672917
FT                   /locus_tag="bglu_1g06310"
FT   CDS_pept        672510..672917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06310"
FT                   /product="Putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27824"
FT                   /db_xref="GOA:C5AB81"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB81"
FT                   /protein_id="ACR27824.1"
FT                   /translation="MNHRISTEPGAKLRIDKWLWAARFFKTRSLAAEAVEKGRVRIGGV
FT                   PVKPSKDVRVGDRVEVTIDTALWQIDVLGICDLRGPAAVAQTLYAETAEGRAKRLAELE
FT                   RRRHYREPAAELHGRPTKRDRRIIDKLSNGR"
FT   gene            complement(672889..673050)
FT                   /locus_tag="bglu_1g06320"
FT   CDS_pept        complement(672889..673050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06320"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27825"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB82"
FT                   /protein_id="ACR27825.1"
FT                   /translation="MKLTFAISVVALVLAAGTTTICLSGAVTDRTTEYGGAQATFEHLF
FT                   SAHSKVCR"
FT   gene            673498..674061
FT                   /locus_tag="bglu_1g06330"
FT   CDS_pept        673498..674061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06330"
FT                   /product="heat shock protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27826"
FT                   /db_xref="GOA:C5AB83"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB83"
FT                   /protein_id="ACR27826.1"
FT                   /translation="MENTQENPAGQPADESGRDAQAAQPQAAEAAPAQPAGEAEAALAE
FT                   AQAKIAELQESFLRAKAETENVRRRGQEDVAKAHKFAIESFAEHLLPVIDSLEAAVGDK
FT                   SEDIAKVREGVELTLRQLQSALEKGRVSVIDPAGAKFDPHQHQAISMVPAEQEPNTVVT
FT                   VLQKGYMIADRVLRPALVTVSQPK"
FT   gene            674389..676350
FT                   /locus_tag="bglu_1g06340"
FT   CDS_pept        674389..676350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06340"
FT                   /product="molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27827"
FT                   /db_xref="GOA:C5AB84"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB84"
FT                   /protein_id="ACR27827.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMEGNQVKVIENSEGARTTPSIIAYMDD
FT                   NEVLVGAPAKRQSVTNPKNTLFAVKRLIGRRFEEKEVQKDIGLMPYSIIKADNGDAWVE
FT                   AHGEKLAPPQVSAEVLRKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAFGLDKAEKGDRKIAVYDLGGGTFDVSIIEIADVDGEMQFEVLST
FT                   NGDTFLGGEDFDQRIIDYVIGEFKKEQGVDLSKDVLALQRLKEAAEKAKIELSSSQQTE
FT                   INLPYITADASGPKHLNLKITRAKLEALVEELVERTIEPCRTAIKDAGVKVSDIDDVIL
FT                   VGGQTRMPKVQEKVKEFFGKEPRRDVNPDEAVAVGAAIQGQVLSGDRKDVLLLDVTPLS
FT                   LGIETLGGVMTKMIKKNTTIPTKHAQVYSTADDNQGAVTIKVFQGEREMAAGNKLLGEF
FT                   NLEGIPPAPRGVPQIEVTFDIDANGILHVGAKDKATGKENKITIKANSGLSEAEIDKMI
FT                   KDAEANAAEDQKLRERADARNQGDALVHSTKKAVADYGDKLDAGEKEKIEAALKDLEDV
FT                   LKDASAEKATIDAKVEALSAASQKLGEKMYADMQAQQAGAAGAAGAAGAAEGAAHTSGA
FT                   SAAADDVVDADFKEVKKD"
FT   gene            676572..677708
FT                   /locus_tag="bglu_1g06350"
FT   CDS_pept        676572..677708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06350"
FT                   /product="molecular chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27828"
FT                   /db_xref="GOA:C5AB85"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5AB85"
FT                   /protein_id="ACR27828.1"
FT                   /translation="MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEE
FT                   RFKEVKEAYEMLSDDQKRAAYDQYGHAGVDPNMGGAGAQGFGGFADAFGDIFGDIFGQA
FT                   AGGAARGGRGGPQVYRGADLRYSMEITLEQAAHGYETQIRVPSWVSCEICHGSGAKPGT
FT                   KPDTCPTCHGQGSVRMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVK
FT                   IPAGIDDGMRIRSAGNGEPGINGGPSGDLYVEIHIKSHSVFERDGDDLHCQMPIPFTTA
FT                   ALGGEIEVPTLAGRASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQIETPVKL
FT                   TDVQRDLLKQFEQSLAEGGGRHSPQSKSWFDRVKSFFE"
FT   gene            677725..679575
FT                   /locus_tag="bglu_1g06360"
FT   CDS_pept        677725..679575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06360"
FT                   /product="para-aminobenzoate synthase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27829"
FT                   /db_xref="GOA:C5ABL8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABL8"
FT                   /protein_id="ACR27829.1"
FT                   /translation="MTEVAAGAPFALLDDCDSTAFARSSRLYTGFSHQRVCTDPAGLDA
FT                   VCAAVAADTASGLHAVVLGDYEFGRNLQRGVAGDGALRFLLFASLARLSRDEVDAWLAA
FT                   HDGGGEPSAAGVARLRKSVTRAGFDAAIDAIHAALRAGDSYQVNYTYRLGFEAHGSPLA
FT                   LYRRLRARQPVRYGALVALPDERWVLSCSPELFVEKAGARLRARPMKGTAPRSADPAAD
FT                   SRAAAFLAGDAKNRAENLMIVDLLRNDVSRVAVTGSVRVPALFTVEPYASVWQMTSSVE
FT                   AEARPEAGFADLLRALFPCGSITGAPKHSTMALIDAIESTPRGLYTGALGWLDAAPPGA
FT                   ACGDFCLAVTIRTLVLAARRADGWRAGAMGVGAGIVLDSAAPDEYAECELKASFLTEAD
FT                   PGFQLFETMHATRAGGVRHLARHLARLAASAEAFGFACDRAALAQRIAERVASFDGDGA
FT                   IRLRAALAKDGTLELAAAPLAALAGPGVAVLLAAEHGFAPTSSSDPLLAHKTTRRAEYD
FT                   RAWRAAEAAGAFDMLFVNERGELTEGGRTSLFVRLDGRWYTPPLACGLLPGVMRAALLD
FT                   DPAWGASERVMTPEDLLRAEALMVCNALRGAVMATLRRAC"
FT   gene            complement(679604..680419)
FT                   /locus_tag="bglu_1g06370"
FT   CDS_pept        complement(679604..680419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06370"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27830"
FT                   /db_xref="GOA:C5ABL9"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABL9"
FT                   /protein_id="ACR27830.1"
FT                   /translation="MTYLQESSRAAVTVPKLQAMRDAGEKIAMLTCYDASFASLLDRAG
FT                   VDALLIGDSLGNVLQGQTTTLPVTLDEIAYHTACVARAQPRALIVADLPFGTYGTPAEA
FT                   FASSVKLMRAGAQMVKLEGGEWLADTVRFLVERAVPVCPHLGLTPQSVHALGGFKVQGK
FT                   TEAGAAQLLRDAQALEQAGAQLMVLEAVPTLVASELTAQIRTPTIGIGAGINCSGQVLV
FT                   LHDMLGIFPGKRPRFVKDFMQGQPSIFAAVEAYVRAVKDGSFPGPEHSF"
FT   gene            complement(680466..681149)
FT                   /locus_tag="bglu_1g06380"
FT   CDS_pept        complement(680466..681149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06380"
FT                   /product="Deoxynucleoside kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27831"
FT                   /db_xref="GOA:C5ABM0"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABM0"
FT                   /protein_id="ACR27831.1"
FT                   /translation="MNATPLTVTPPDPRPPHRYLAIEGPIGVGKTSLATLLAERWGMDT
FT                   LFERPQDNPFLERFYREGARYALPAQLAFALQRARQTGGIAAAQAAGAALVADFMPQKS
FT                   EIFARLTLADDEWQLYRTLAERIDAPAPAPDLVVYLQASPEVLYARIQKRGIAAELQIG
FT                   DAYLRALCDAYNEFFYHYDRTPVLTVAAEHLNPLDSPDDLALLMTRIETMRGRKESFVK
FT                   GGVGR"
FT   gene            complement(681146..681679)
FT                   /locus_tag="bglu_1g06390"
FT   CDS_pept        complement(681146..681679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06390"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27832"
FT                   /db_xref="GOA:C5ABM1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABM1"
FT                   /protein_id="ACR27832.1"
FT                   /translation="MTVAYLGLGANLGDARQALKDAVVCLAQQCTSITVIGKSSLYRTA
FT                   PVDAGGDDYYNCAVKVDTRLPARELLRLCQQIEHHFGRERPFPNAPRTLDIDILLYGDH
FT                   LIDEPDLVVPHPRLTARAFVLVPLLELDPALMIPSRGAAQAFLAAVADQRIEKVQTCQC
FT                   LLAMKSANESRRCR"
FT   gene            complement(681709..683286)
FT                   /locus_tag="bglu_1g06400"
FT   CDS_pept        complement(681709..683286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06400"
FT                   /product="putative polynucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27833"
FT                   /db_xref="GOA:C5ABM2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABM2"
FT                   /protein_id="ACR27833.1"
FT                   /translation="MIKKLIRKLLGQDDSAARDNAGAADAAPPSTGPAAASPAAVAAAK
FT                   KQAARDAAKVAASRTEPTIVPAAVHGIDPSLISRNAVRVTDTLQQAGFRAFIVGGAVRD
FT                   LLLGIAPKDFDVATDATPTEVQRLFRRARLIGRRFQIVHVQFGQELIEVSTFRALVDAP
FT                   ADAPASAPADAAPPRRMKRDELDRRTHAVDASGRVLRDNVWGEQHEDAARRDFTINAMY
FT                   YDPATQTVLDYHDGMADVRARLLRMIGDPATRYREDPVRMLRVVRFAAKLGFDIEPHTR
FT                   EPIQPLADLINNVPAARLFDEMLKLLLSGHALACLRQLRSEGLHHGLLPLLDVVLEQPQ
FT                   GEKFITLALNNTDARVRAGKSVSPGFLFATLLWHDMRQRWNQNVANGEFPVPALQRAMD
FT                   DVLEMQTEKLAIHKRYSADMREIWGLQLRLEKRSGRSAMRLLEHQRFRAGYDFLLLRCE
FT                   SGELDPAVAQWWTDFIDGDAAAREALLTNGAPRDPAAPRKRRRRGGARNRRPADGTVQQ
FT                   ADAQDAQD"
FT   gene            complement(683283..683969)
FT                   /locus_tag="bglu_1g06410"
FT   CDS_pept        complement(683283..683969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06410"
FT                   /product="Putative HAD-superfamily subfamily IB hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27834"
FT                   /db_xref="GOA:C5ABM3"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABM3"
FT                   /protein_id="ACR27834.1"
FT                   /translation="MTNLALFDLDHTLIPTDSDHEWSRFIVKLGLVDADSYTRQNDRFY
FT                   ADYQAGTLDIQAYLAAVLAPLAQHSRAQLDAWHEQYMREVIRPVMLPAARELVREHQQA
FT                   GDLCCIVTATNAFVTRPIAQAFGVETLIACEVETVDGDPASALTGRATGTPSFREGKIA
FT                   RTEAWLASLGKRLADFERSYFYSDSHNDIPLLEKVTDPVATNPDDTLRAHAREHGWRVL
FT                   DLFQPS"
FT   gene            complement(683991..684995)
FT                   /locus_tag="bglu_1g06420"
FT   CDS_pept        complement(683991..684995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06420"
FT                   /product="DnaA regulatory inactivator Hda"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27835"
FT                   /db_xref="GOA:C5ABM4"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABM4"
FT                   /protein_id="ACR27835.1"
FT                   /translation="MGECEKVGKMRFYPKPDARPNSPRRSLQVTHRVRIVPVFVAGPPV
FT                   GRRARRAAAQVARGRRGCDAGAPRLRATRRRLAPGRRTARARPHPIRTVTATRQLTLDL
FT                   GTPPPATFENFTIGPNDELVSRLRRLDLALAAGPVADRSFYVWGEAGSGRSHLLQALVH
FT                   DTSYGSARYLTPQSPLGAIAFDPRVSLYAVDDIDAMSDTQQIALFNLFNEVRAHPSSAF
FT                   VGAGPAAPLALDVREDLRTRLGWGLVFHLAPLSDADKAVVFKQAAKARGIAIADDVPAY
FT                   LLTHYRRDMPSLMALLDALDRFSLEQKRAVTLPLLRALLTALEREADASGRIK"
FT   gene            684994..686049
FT                   /locus_tag="bglu_1g06430"
FT   CDS_pept        684994..686049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06430"
FT                   /product="Phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27836"
FT                   /db_xref="GOA:C5ABM5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABM5"
FT                   /protein_id="ACR27836.1"
FT                   /translation="MTSPKSAPDAQGLSYRDAGVDIDAGDALVDKIKPFAKKTLRDGVL
FT                   GGIGGFGALFEVPKKYREPVLVSGTDGVGTKLKLAFHLNRHDTVGQDLVAMSVNDILVQ
FT                   GAEPLFFLDYFACGKLDVETAATVVKGIATGCELAGCALIGGETAEMPGMYPDGEYDLA
FT                   GFAVGAVEKSRIIDGSTIAAGDVVLGLASSGIHSNGFSLVRKIIERANPDLDAAFDGRT
FT                   LADALIAPTRIYVKPLLALMAKLPVKGMAHITGGGLVENIPRVLREGLTAELDQTAWTL
FT                   PPLFQWLQQHGGVADAEMHRVFNCGIGMAVIVAAADADAAVAELSAAGEQVWKIGKVRA
FT                   TREGEAQTVVV"
FT   gene            complement(686147..687115)
FT                   /locus_tag="bglu_1g06440"
FT   CDS_pept        complement(686147..687115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06440"
FT                   /product="tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27837"
FT                   /db_xref="GOA:C5ABM6"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABM6"
FT                   /protein_id="ACR27837.1"
FT                   /translation="MSGAPESPRVTVACLLGPTASGKTAAALALAERRPVEIVSVDSAL
FT                   VYREMDIGTAKPERAERERVAHHLIDIRDPREAYSAAEFRADTLRLLGEILARGHTPLL
FT                   AGGTMLYYKALTQGLNALPAADPQVRARLDADAARDGWPALHARLARADPETAARLAPN
FT                   DAQRIQRALEILELSGRPMSALLAAPPPACDEAARYRFVPVALEPSERAVLHARIAVRF
FT                   DAMLAAGFVDEVERLRGRGDLHLGLPSMRCVGYRQAWEYLDGATDHATMRDKGIFATRQ
FT                   LCKRQLTWLRSMPERIVVDCCADDAPRRAVAALERVLDAAP"
FT   gene            complement(687112..689223)
FT                   /locus_tag="bglu_1g06450"
FT   CDS_pept        complement(687112..689223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06450"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27838"
FT                   /db_xref="GOA:C5ABM7"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABM7"
FT                   /protein_id="ACR27838.1"
FT                   /translation="MSEFTDSTDSTGADAAASAAVPAAGPRPLRAIQPLPDQLISQIAA
FT                   GEVVERPASVVKELLENALDAGATTLRIALDEGGVKRISITDDGCGIPADELPLALMRH
FT                   ATSKIRSLVELESVATLGFRGEALASIASVSELAITSRTEQAPHATRIDADTGALSPAA
FT                   GTRGTTIEVRELYFNTPARRKFLKSEQTEFGHCLEMIRRVALARPDVAISVLHNGRAVE
FT                   HWNASEPAVRVAKILGEGFATAHLPLDEQAGPLAVYGCAGLPTASRGRADQQYFFVNGR
FT                   FVRDKLLTHAVRAAYEDVLHGDRYPSYVLFLDLPPEAVDVNVHPSKIEVRFRDSRSIHQ
FT                   YVFHAVQRALARHAGASPGTTAGGHAAHLAPAGESAAPERAPAGSAGQAGDHAARADGV
FT                   SGSGLADGAGSATSSGPAGGFGRASGGFGSAAGSSSSGGFGGGGAARSGAGNTWTRHSR
FT                   MTQGTLPVAQPLALYDASPGRKAAGGEATGTAEPAPFGATPGTLPADAGHDAQPLGFAL
FT                   GQVHGIYVLAQNAQGLVIVDMHAAHERILYEQFKTALANRAIAVQSLLLPVTMAATPVE
FT                   IGTAEEERETLDALGFDLATLSPTTLAIRAVPALLRDADLPTLARAVLADLHEFGGSRV
FT                   LTERQHELLGTLACHHAVRANRRLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLGD
FT                   LDRLFMRGQ"
FT   gene            689442..690137
FT                   /locus_tag="bglu_1g06460"
FT   CDS_pept        689442..690137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06460"
FT                   /product="Putative DedA family transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27839"
FT                   /db_xref="GOA:C5ABM8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABM8"
FT                   /protein_id="ACR27839.1"
FT                   /translation="MDTLLHFVNLVLHIDAFLGKFIQYYGAWVYLVLFLIVFCETGLVI
FT                   LPFLPGDSLLFIAGAFAASGEMSLAALIVLLLVAATLGNTVNYLLGRAIGPKVFDTHVP
FT                   VLERFLDRAALQKTHDFYERHGGKTLVLARFIPVVRTFAPFVAGVSAMRLARFQLFNVA
FT                   GALAWVLLLTLLGYFFGNIPFIRQYLNVIVLVGVGAAAVPVVIGALWKLLRGRTRPSRG
FT                   GPNTPRGRG"
FT   gene            complement(690168..690983)
FT                   /locus_tag="bglu_1g06470"
FT   CDS_pept        complement(690168..690983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06470"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27840"
FT                   /db_xref="GOA:C5ABM9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABM9"
FT                   /protein_id="ACR27840.1"
FT                   /translation="MVELATAQQFLMTRGLDFGLKVLAAIALWIVGRWLIRLSTRLLGR
FT                   LVQRSGRVDTTLAYYLSSVVSVLLTIVLILAILQVFGVQTTSFAALLAGIGLAVGTAWG
FT                   GLLAHFAAGVFLQVLRPFKVGDSISAAGVTGTVKELGLFSTTLLTSDNVVTIVGNNKIF
FT                   SDNIANYSATPHRRVDLTAKIAHGVDAAEAIAKLKAAVAAIPNVLPTPAPDVGILQFTP
FT                   EGPLLFVRPCTPPASYWQVYCDAQHAILDTFRQAGYPTPETPTIQRSAG"
FT   gene            complement(691182..692033)
FT                   /locus_tag="bglu_1g06480"
FT   CDS_pept        complement(691182..692033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06480"
FT                   /product="putative glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27841"
FT                   /db_xref="GOA:C5ABN0"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABN0"
FT                   /protein_id="ACR27841.1"
FT                   /translation="MCRWLAYTGNPIPLETVLFRAQHSLIDQSLHSRLGATTTNGDGFG
FT                   IGWYGRPDEIPFRYRCVHLAWNDRNLREVARAIHSPHFVAHIRAATDTPVQETNCHPFR
FT                   HGRWMFVHNGLIRHYHKLRHDLMLRIDPALFPSVEGSTDSELMFHLALTFGLEHTPLPA
FT                   LERMAGVIEEIAAKHGVAPPISMTVCATDGEQVVSVRYSSEHRSRTLFHSTSFRHLHEL
FT                   YPDDPRIAAVGDDAFLVLSEPLVDLPGAWQAIPESTAIVARGGRVETFAFTPRAPRNGT
FT                   HA"
FT   gene            complement(692215..693642)
FT                   /locus_tag="bglu_1g06490"
FT   CDS_pept        complement(692215..693642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06490"
FT                   /product="putative GDP-mannose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27842"
FT                   /db_xref="GOA:C5ABN1"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABN1"
FT                   /protein_id="ACR27842.1"
FT                   /translation="MSIFPVILCGGSGTRLWPMSRGGYPKQYLKLTGDDTLIQQTALRV
FT                   RHLPDATKPIILTNNEQRFLVAEQLRQVGIEPSSIVLEPVGRNTAPAIAVAAHMALKES
FT                   PDALLLVLPSDHAILNQAAFAAAAQAAAAVASEGCLVTFGIPPDRAHTGFGYIHRGKPF
FT                   DDEAQAHRVDAFVEKPDMATAEEFVKSGEYYWNSGMFMLKASTYLQELQRFEPEIARLS
FT                   QAALEGASHDNDFIRLDPVAFAASPNISIDYAVMERTEHAAVVATDNLGWNDIGSWGAL
FT                   ADLAKTDEDGNTLIGDVFCESTSNSYVRAEHRMVATIGVDNLVVVETADAVLVVHRDHV
FT                   QDVKKVVEQLNKSGRHESVTHRRVVRPWGDYEGIDQGDRFQVKRIVVKPGAQLSLQMHH
FT                   HRAEHWIVVKGTALVTNGDREIMLTENQSTYIPLGATHRLSNPGKIPLELIEVQSGAYL
FT                   GEDDIVRFEDTYGRAPK"
FT   gene            complement(693728..695779)
FT                   /locus_tag="bglu_1g06500"
FT   CDS_pept        complement(693728..695779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06500"
FT                   /product="WcbA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27843"
FT                   /db_xref="GOA:C5ABN2"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABN2"
FT                   /protein_id="ACR27843.1"
FT                   /translation="MSEYPIPSSGSRDRQFDAIYLAHGYRLLGWLTRRSRWLWPEARGG
FT                   RLLAALARLLKLDAQAAYAGPIAPRASLGLAPLSWFSVPLELGHEDPLGAAIEQAVTAS
FT                   TPHDEARTRALMRHLLDSDALHPRRKAAQLPHAEFVATARQRILLIDERLISGVSPPAR
FT                   RSRRIADFRAMVDAALASHPDAEFWLAPSSDPGRGPWLSSRCGVLPRELRVLDPEYSLR
FT                   AWLPYFSQVYTVGAAEGMGAILADRPTFVYGRPYYAGWGFTTDAQAFPQRQARPTLSAW
FT                   FDATFVRLTHYLDPEQEQPGTLEHVLDALQLQHQVSERFRELDHVVGLRFQWWKRRLAT
FT                   PYLSAGGGTLRWARAIADIGPHECAALWGARLRDGTPQGTRYYRIEDGFIHSAGLGSDM
FT                   SPPCSQVIDGSNLYFDASAPSDLTRILNTAGFDAAELARAAALRRSIVEFGITKYNLGR
FT                   QRPAWPRPADRRVILVPGQVADDASIRLGTGAVNTAEGLLAAVRERRPTDCIVYKPHPD
FT                   VLSGNRNGLVEAQRLADIVDLDSDIVSLIEAADEVHTLSSLSGFDALLRGKPVFTYGLP
FT                   FYAGWGLTDDAISPQPWRERALTLDMLTAGTLIRYPIYWNWRLALYTTPEAVVRRLAPA
FT                   ANRPLRAQGRNWRRPALKALRWTTNALVHLGWRYRQCRQAGHRRNSFV"
FT   gene            complement(695780..696937)
FT                   /locus_tag="bglu_1g06510"
FT   CDS_pept        complement(695780..696937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06510"
FT                   /product="Glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27844"
FT                   /db_xref="GOA:C5ABN3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABN3"
FT                   /protein_id="ACR27844.1"
FT                   /translation="MTQILLDVTRIVTRRYDGLIPTGVDRVGLAYVQKYGDHARAVLGE
FT                   RGHSIVLSERDSQRLFGLLLSTPGPRDRWALRGMVARTLMGAFNRSRFEHAVLLHTSHS
FT                   GMEHTRYYRAMARRNARPVFMVHDLIPLTHAEYCRPGVEQMHRLRIRTALRHASGLIAN
FT                   SQATLDSIEQEAQAAGLPMPPCTIARLAPGITAHQPCPAPIGEPYFLMLGTIEPRKNHW
FT                   LMLHVWRSLVERHGARAPKLVIIGRRGWECENVVDMLERCTPLRQFVVEESECSDERLH
FT                   ALLQHARALLFPSFVEGYGMPLVEALASRIPVLASNLEVFREIAADTPDYLDPLDGPAW
FT                   AQRIMEYAAPASPARQQQMSRIEHFGAPTWSAHFACVDSFIGTLN"
FT   gene            697056..698288
FT                   /locus_tag="bglu_1g06520"
FT   CDS_pept        697056..698288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06520"
FT                   /product="Polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27845"
FT                   /db_xref="GOA:C5ABN4"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABN4"
FT                   /protein_id="ACR27845.1"
FT                   /translation="MRQFRSVDFPFPWQHMSLLLRGVTCSVLVSGALVGCSIIPTSGPS
FT                   RSAIVQSANGSAEATAGMAGIQVVDLTDSIARRLYAEREQGDFATTLGIDTHFRQQLGI
FT                   GDTIEVSIWEAPPATLFGAAQADTRSSGASAPSNARVTVLPDQTIDGDGNINVPFVGAV
FT                   KAQGKTPTQLERDITLRLKNMAHDPQVLVKLSRNVTSYVTVVGDVVSSNRMQLSARGER
FT                   LLDALASAGGVRQPIDKITLQVTRGDKVASLPLQTVIRDPRQNVPLHAGDVVTALYQPY
FT                   SFTALGATGKNQEINFEAQGISLAQAIARAGGLEDSRSDAQGVFIFRLEDANALPWPVK
FT                   PVRTTADGKVPVIYRMNLKDPSAFFTAQSFVMDNKDLLYVSNAPITELQKVLNLVFSVA
FT                   YPVVTGVQSFK"
FT   gene            698526..701204
FT                   /locus_tag="bglu_1g06530"
FT   CDS_pept        698526..701204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06530"
FT                   /product="methyltransferase, FkbM family domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27846"
FT                   /db_xref="GOA:C5ABN5"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABN5"
FT                   /protein_id="ACR27846.1"
FT                   /translation="MITSYAQNFEDVMLWRALSHIDSGFYIDIGAQDPLVDSVSLAFYE
FT                   HGWRGVHVEPTARYADALRAHRPDETVIQAAVAARSGMLNFFEIVGTGISTADPVIAEG
FT                   HRARGFELTEIVVPAVSLAEIFAMYAGREVHWLKIDVEGFELSVLQSWADSPARPWIVV
FT                   VESTLPLTQTLSHDKWEAQLLERGYEPVYFDGLNRFYVCAEHPELRAAFDAPPNLFDGF
FT                   RLSGTASAPFHALLHERIQQTSEQMQKTLQLRETELRDEAAAQTSELRGQLATARLREN
FT                   AALESLSEVAGQLRQAFGAVSSADGAGRHDDRLIDELDRFQRLHSRERDAYRDDDRLMA
FT                   EHLETLRAECGRLIRMGAAHDAALADALRDAEAATSRESSALRETREQMLRQQQDHRAE
FT                   LALQAAHAERREAVAAALHAQALERAAAELHEARAARRTAEQRHDEQRRQLSARLRLIR
FT                   RRNRMLRQFALKRERQLENELLDVSRRHEATLRVNAIESSARESRLVIELESARREFES
FT                   KAREWSESKQQMSHELAGLRALLETERRDFTQRDAQAFERILDIEGRYARADAKAVELY
FT                   GVIEDIRQSFSWKIMAPLRAVFDKRLAADVTALVTGAAADRGARSDENASCPMQGRLSN
FT                   GSTAENQSPASTERNMSDSLNRALRENGEVPRSGPHRLRDFMAVDDAGFVVLAYRVLLR
FT                   RDPDPSGFDHFLGRARRGDSRVRILEAIAQSDEGKINKVTVIGLNSAVSRLKIAAFPVI
FT                   GPIFGKIWGYDEQRELASWRFASIDARLESIAANQAALLATHERKTADIQASITALSAR
FT                   FDALSAYLSTSHAVASDVTSGSAENRDLPAGLAAGVPGDTSPKSVHAAPVVLTEPDARQ
FT                   VMHSLSALVGASLEARMLAAR"
FT   gene            701277..704624
FT                   /locus_tag="bglu_1g06540"
FT   CDS_pept        701277..704624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06540"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27847"
FT                   /db_xref="GOA:C5ABN6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABN6"
FT                   /protein_id="ACR27847.1"
FT                   /translation="MQKSSVMFDTNFSGRILQLTEALDFGDAVSNQVVALDQMFRGLGL
FT                   RSQIYSKWHHKSVGPYRKNLEELDIQDNDVLIIHFAGYSEHVMQAYHTKRCTKICVYHN
FT                   ITPHTFFEKGTDLHKFCLMGREQLREIVPSFDYFWGDSEYNLQEIIDLGVSPDRCSLVP
FT                   IIVDAPESAAAVRASRNREPGHWLFLGRVAANKGQVDLVQMFAEMHESSPQVAARLSLV
FT                   GGFNPQDPYYQKLLATIKKHKVEHLVDITGKVPDEAISSYFGKAFVYVSLSRHEGFGVP
FT                   LIEATLHGLPVVGLHNTAIGETLGVKDNPLDSIGKLKAEIARLAKDEAAYRNLVEFQRR
FT                   NTERFTSAAVRTHVVDALRKVLPEAKQFATVSIIICTYNRGDLLERCLDYLQYQTNQNF
FT                   EVVVVNGPSDDGTDAVLERYKDRIKIGRNPQRNLAISRNIGIDLADGDLLAFIDDDALP
FT                   FDDWVEGLLEEFNRRPLTLGALGGPAYYAGTLRYQSEDIGINKFAEAKVNIDSREIGEN
FT                   GWERSLLGTNTCFSAAAVRAVNGFDEQFDYFLDESELCFRMRKAGYLIAYRPDLHLRHE
FT                   FAQSHNRGGRYNYNWFTICKNTAYFIAAYSGLKGAELKKYLDQRMQSERIAPLAAAQQA
FT                   GEIGSDEYDRYLKAIRSGVQQGLKDAADFPKTRTLKKGIGRFEVFTGAAGYPLVGCDTP
FT                   RLHICIVTKEFPPYSGSGGIGTLYYHLASELLLMGHHVTVVTPGSSDFVYRCGRFSVRY
FT                   ALPVANVTDTLGSTGFVNNLHWGLTALRAVAELHAEHRIDVIESALWDTEALPIALLPK
FT                   HERPPVVVRLVTPFPVAARLNGWQLPPREADLFVTGEATLIEHADLVVPISESIAKTIE
FT                   AEHGVTRDARWQHSHCGIAYWPFFDAQKGYSALEDSAGKPLKISEDMKFVLFVGRLEGR
FT                   KGVGTLLDAAKRFLADDTDAHLVLVGRDIENWTERAKDLLGASLMQRVHFLGQVDDQLR
FT                   EKLLHAAHCVAFPSQYESFGLVPLEAFVHGKPVIASRAGAIPEVVGDGQSGLLFEAGNA
FT                   AELADQVLRVLTDKTLHARLSNGAREQIRKFSSRNSAIRAVNAYIALKREREDARGAHE
FT                   TTESAVKV"
FT   gene            704648..705682
FT                   /locus_tag="bglu_1g06550"
FT   CDS_pept        704648..705682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06550"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27848"
FT                   /db_xref="GOA:C5ABN7"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABN7"
FT                   /protein_id="ACR27848.1"
FT                   /translation="MKKAIITGITGQDGAYLAQLLLEKGYTVYGTYRRTSSVNFWRIAE
FT                   IGVEHHPNLHLVEYDLTDLSSSIRLLQSTGATEVYNLAAQSFVGVSFDQPVTTAEITGI
FT                   GPLNLLEAIRIVNPAIRFYQASTSEMFGKVQTIPQVESTPFYPRSPYGVAKLYAHWMTI
FT                   NYRESYDIFGCSGILFNHESPLRGREFVTRKITDTIAKIRLGKADVLELGNLDAKRDWG
FT                   YAKEYVEGMWRMLQADRADTYVLATNRTETVRDFVAMAARAAGFELAWQGSGLQEVGVD
FT                   TASGKAIVKINPKFHRPAEVDLLIGDPAKARAELGWEPATTLEALCQMMVEADIRRNET
FT                   GFSF"
FT   gene            705686..706579
FT                   /locus_tag="bglu_1g06560"
FT   CDS_pept        705686..706579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06560"
FT                   /product="GDP-6-deoxy-D-lyxo-4-hexulose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27849"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABN8"
FT                   /protein_id="ACR27849.1"
FT                   /translation="MTKVLITGIGGFTGRHLARELEGRGCEVEGLVHRPVAGLAWPAHV
FT                   CDLLDREAMGALMAACRPDVVIHLAAIAFVAHGDVGAVYQTNIMGTRNLLDAITSAGCQ
FT                   PRAVLVASSANVYGNTDRGVIDESVPPNPANDYAISKLATERVAALWSDRLPITIVRPF
FT                   NYTGPGQAANFVLPKIVEGFRSRSPVLELGNLNVIRDFSDVRMVVRAYADLIAGTWAGE
FT                   TFNVCSGNGYSLQDILQMMRSLTQHDPEIRVNPNFVRANEVHRLIGDNRRLTAAIGCLD
FT                   IVPLQETLAWMLESGR"
FT   gene            706576..707706
FT                   /locus_tag="bglu_1g06570"
FT   CDS_pept        706576..707706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06570"
FT                   /product="group 1 family glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27850"
FT                   /db_xref="GOA:C5ABN9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABN9"
FT                   /protein_id="ACR27850.1"
FT                   /translation="MKVAFAVDAIVPPLTGIGRYAWELAWHFTHFDEPLQSLRFFFGDE
FT                   PIEDPSWVISGDAEKGRRRPRWLPRSVTSTRRFRGLRMRHRLRGHLFHSPNYFLPYPVE
FT                   RGIVTIHDLSVFRFPETHPVERLKHFERSFDSTLRRASHLLTDSEAIRHEVAAYFGWPL
FT                   DRITAVPLGVRPEFRPRGAEELSMPLAQYGLVPGGYALSVSTLEPRKRIDRLMAAYAEL
FT                   PAALRERYPLVLAGGAGWLSEALHGAIASAEQEGWLRYLGFVPEPLLPVLYAGARAFFM
FT                   PSKYEGFGLPVLEALASGVPTLTSNTSSLPEVAGGAAWLVEPDDHEALRAGIEHVLSDS
FT                   AWRDEASRLGLRVAGAATWRRCAQRTLETYRRVAQS"
FT   gene            complement(707701..708966)
FT                   /locus_tag="bglu_1g06580"
FT   CDS_pept        complement(707701..708966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06580"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27851"
FT                   /db_xref="GOA:C5ABP0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABP0"
FT                   /protein_id="ACR27851.1"
FT                   /translation="MPGLKNWRAALLQHAATRWGLPLAGAARKAIATLRSEAARQASRQ
FT                   PRQLLVDVSIIAAQDAGTGIQRVVRSLLAELLETPPAGYTVRAIRATRKRPYVYADRYL
FT                   ETMTGAPIGDDDPPVQVRPGDLFLGLDLTSRISPARQADFLGWHAAGVRFAFVVYDMLP
FT                   ALHPAWFTPRAVQSFERWLTMLAIHADALFCISATVAEQTRRQPRLAAIPTGWFHLGAE
FT                   LAARQGAGQATADDITPCPAGAPRILMVGTIEPRKGHALVIDAFERLWRDGCQASLSIV
FT                   GRAGWAVEALTARLAAHPESGKRLHWLAGAGDAELARLYESSDGLILASEGEGFGLPII
FT                   EAAAQRLPLLLRDLPVFREIAGDHASYFSSVTAAELAPRLQQWLEAIAAGTAPDSGAIK
FT                   TLSWHESAIQLKSLISRLDARS"
FT   gene            complement(708982..709632)
FT                   /locus_tag="bglu_1g06590"
FT   CDS_pept        complement(708982..709632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06590"
FT                   /product="BexA"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27852"
FT                   /db_xref="GOA:C5ABP1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABP1"
FT                   /protein_id="ACR27852.1"
FT                   /translation="MIDLQGVCKDYHTRQGRRRVLNDINLRVAPGEKLGVLGRNGAGKS
FT                   TLIRMISGAELPTKGKINRSMSVSWPLAFGGAFQGSLTGMDNLRFICRVYGADAKQAEP
FT                   FVQEFSELGYYLNEPVKSYSAGMRARLAFAISMAIEFDCFLIDEIVAVGDNRFHAKCHH
FT                   ELFVRRADRSLIIVSHDAGYIREHCHRAAVLVQGHLHSFDEVDDAYAFYQQNG"
FT   gene            complement(709629..710420)
FT                   /locus_tag="bglu_1g06600"
FT   CDS_pept        complement(709629..710420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06600"
FT                   /product="CtrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27853"
FT                   /db_xref="GOA:C5ABP2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABP2"
FT                   /protein_id="ACR27853.1"
FT                   /translation="MHHDTPLASSLRIQLRVVGALLMREILTRYGRHNVGFLWIFFEPM
FT                   MFTLGVLALWTILNATHGTTLSITSFAVTGYSSVLLWRNCASRCALAILPNQALLYHRN
FT                   VRVIDLFFARLLLEISGATMSFVFLTVFFVSIGMMDPPKNISLVLGGWLHLAAFGTSLG
FT                   LIVGALSERSETVERVWHTIAYLLFPLSGAVFMVEWIPEKFRAAVLYLPMVHGTEMLRG
FT                   GYYGSLVKPHYSIPYMVACDSVLLLIGLFLVRDASKRVEPE"
FT   gene            complement(710433..711584)
FT                   /locus_tag="bglu_1g06610"
FT   CDS_pept        complement(710433..711584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06610"
FT                   /product="WcbD"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27854"
FT                   /db_xref="GOA:C5ABP3"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABP3"
FT                   /protein_id="ACR27854.1"
FT                   /translation="MENVTSSDLPPSSGTKPSLGQRLKKVNRLFLLTVALPTTLAVLYY
FT                   GVIASDVYVSESRFVVRSPQKQSQTNLVGALLQGTGFSRAQDDTYAVVDYVESRDALRE
FT                   LNAGNYIVDAYSQHGDPISRFHRWPDGSFESLWKYYGKRIVDIEFDSTSAIAKLQVRAY
FT                   TAEDAEKINERLLEMSERLINRMNRRAASDSVKFAQDEVDVAAAKAKEAAGALAAYRRT
FT                   YTVFDPDRQSALQLQQVTALQTQMLAAQTQLAQLQSISPKNPQIPVLQTNIANLEKQIT
FT                   AATSGVAGGKNSLADKAAVYARMQLDSQFADKQLASAMTALENARADAQRKQLYLERLV
FT                   EPNTPDVAIEPKRLKSILEVFALGVIAWGILELLLAGVREHND"
FT   gene            712047..713234
FT                   /locus_tag="bglu_1g06620"
FT   CDS_pept        712047..713234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06620"
FT                   /product="WcbO"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27855"
FT                   /db_xref="GOA:C5ABP4"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABP4"
FT                   /protein_id="ACR27855.1"
FT                   /translation="MLQGTASTFFSSLAAVLESRGHAVYRVNFCGGDWFYGKTKHAVNY
FT                   SGAAADLPAWYAALVQRENITDVLMFGDCREVHRPLHPIAEQYGLHVHVFEEGYVRPHW
FT                   ITLESHGVNGRSRMPRDPAEFLRLREHIPPAAPGKPTGYNLYERVFHDITYRLANGLLA
FT                   WRFPHYRSHRPRNGLVEYAGLAFRALMQGRHHRHAEAVTRAVLGGGRPYYLFPLQLNSD
FT                   AQIVVHSPFAGVREAIERVVRSFARHAPDDALLLIKNHPLDTGMIEYRRFALRIAGEEG
FT                   VAQRVDFINAGHLPTLLEHARGVVVVNSTVGLSALHHERPLITLGTAIYNLPGLTWQGT
FT                   LDEFWRQCGQPDMDLYHAFLDYVMHHTQINGDFYTRTGIAMAVAGAADRLERADG"
FT   gene            713227..714018
FT                   /locus_tag="bglu_1g06630"
FT   CDS_pept        713227..714018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06630"
FT                   /product="Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27856"
FT                   /db_xref="GOA:C5ABP5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABP5"
FT                   /protein_id="ACR27856.1"
FT                   /translation="MAEPSARHVVISGASAGLGRALALAYARPGVTLGLIGRDRERIEA
FT                   AAAACRARGAEVQTGVLDVREAAATAAWLDAFDARHPIGLLIANAGVASTIGSADDWEG
FT                   LERTARVVDTNFYGALHTVLPVLERMRARRAGRVVLVSSLAALRGMAISPAYCASKAAI
FT                   KAWGDSVRPLLARDGVRVTVVLPGFVKTAMSDVFPGDKPFLWSAERAAAHIRRGLDAGR
FT                   SEIAFPALLAFGMRLLPLLPAALADAILGRLSYLPAEDAAN"
FT   gene            714036..715541
FT                   /locus_tag="bglu_1g06640"
FT   CDS_pept        714036..715541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06640"
FT                   /product="Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27857"
FT                   /db_xref="GOA:C5ABP6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABP6"
FT                   /protein_id="ACR27857.1"
FT                   /translation="MFALTAAPSFALERIALPRGPWRRPWRSAWLHLLAVYAVANLMLA
FT                   VTSRPLFSAFATLALVGLLAAVSNAKYESLREPFVFTDLSLFSQLFSHPRLYLPFLSVG
FT                   KVAAIGAGIVLVVAGFIAERPAPPYPASVSLPLAALLFGLALPAAAALPLTLEAGADQR
FT                   RHGFLAVFVAYLLNGLRPATLRRFREALAASPYADGAPQRRPDVVVIQSESFFDARRLG
FT                   AAIAPGLLARFDEACREALWHGQLHVPAWGANTMRTEFAVLTGASQAALGYARFYPYAF
FT                   VRRRCASLAAWFGRGGYRTLAIHPYYADFFGRDRVFPLLGFSRLLDIGHFAGAARAGPY
FT                   VADAAVADAIIEALEAPGDEPRFVFAMTMENHGPLHLETVLPGESTNRHTLGDGAPWRD
FT                   LTAYLRHIENADAMLGRLLDHLRSSHRETVVCFYGDHVPALSRIFERLGSNPEHSDFFI
FT                   WRNHGTKGPERRDVRAEQLGGLLLLATQHGSRMDGSQASEKTT"
FT   gene            715544..723142
FT                   /locus_tag="bglu_1g06650"
FT   CDS_pept        715544..723142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06650"
FT                   /product="Beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27858"
FT                   /db_xref="GOA:C5ABP7"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABP7"
FT                   /protein_id="ACR27858.2"
FT                   /translation="MNGKIAIVGIACRFPGGANSPDELWSLLRAERDAVTQIPAERFGT
FT                   EFYLHPSKREAGKSYTFSAGVLDDIAGFDAAFFGISPREASQMDPQQRLLLELAWETFE
FT                   HAGLRPQDLRGSNCGVFVGVASPDYGNRSVDDLNSVDPYSATGNTLSIASNRVSYLFDL
FT                   RGPSLSIDTACSSSLVALHQAVQALHSGEAELALAGGVNLLMHPFGFVTFSKASMLSPR
FT                   GRCRAFDASGDGYVRAEGGAFVLLKPLERALADGDTIHAVIAGSGVNSDGFTQGGISVP
FT                   GAATQAALLRSVYARAGVDPASVSYLEAHGTGTAVGDPIEARALIDVMSAGRPADKPLL
FT                   IGSIKTNIGHLETASGMAGLLKAVLCLKHRAVPRSLHFVTPNPAIDFEGGRLRVADRYT
FT                   PLDAAGDVPLTIGVNSFGFGGTNAHVVLTEAPVTAGAASPAAAPAGAGARRAPLVLSAR
FT                   TPQALAGLAARYLAVLERGAGWQSVAATAARRRQWFAHRLVIAPASDDEGRAALAALAA
FT                   GAAELPACVVRGEAPADPGRVAFVYSGNGCQWAGMGQQLYDEEPLFRAALDEVDALWRA
FT                   DGSASLVEVMRHGASAAWLAATENAQPLLFAIQVGLTRVLKARGIRCDATIGHSVGEIA
FT                   AAWASQILSLADAVRVIKIRSRAQGTTRGSGRMAAAGLSEAAANELIARLGLTALVEVA
FT                   GVNSAEAVTLAGSLQALQAVEAAQRESGRFFQMLDLDYAFHSRQMDGIEPIVRDELAGL
FT                   APSAGDGGFVSTVTGARLDGTALDAGYWWRNIREPVRFGDGIANLIGEGVTIFIEVAPH
FT                   SILRSYMKNALLAAQAQGAVLPTMKRQQGSAAMLETAILSAVAHGAAVEVERFAPAAPP
FT                   VALPTYAWQHEHYWLEPSVEAYDLVNRRREHPLLGYRLHELAFGWENQLDPIRLPLLAD
FT                   HVVDGGVAFPGAGYVEMALAAARVYFESDSCALENVEIRAPVVFQPQQAKLFRFQIEPE
FT                   TAVFTIETRDRMSDTPWTLNVTGRLLASGCTLDADTAVPGALLDSLRAQPLIEGATLYG
FT                   GTSTIGLEYGPAFRWVRDLRVTREFALADLAAPAACGDAAALAAYHLHPALMDSGFHPL
FT                   FALLGAHAGDGDHAAYVPVQIGRVDFLRGDAIERVLVRIDRRSPHSVVASFEFLDARGA
FT                   VTARLAACRFRRVDLLGRRHHAPSRFVYALEHRPLPDEARADMLPAPAALLQDAAARVT
FT                   PVQNRASPDRDLNEMLPLIDGLPSLYTLRFLNAIHAFAPPQLPEHPQAPLVHRLAEIVI
FT                   HDGLLRRDGGLLVHADEACAALPPLDELWRGLLAESPHHVAELTLLPPCGAALPRVLKG
FT                   ELEASRVLSATGRSLVEQFFDASPTWEHTHAVMQACAMAAIDGWRETRRLRLLEIESTR
FT                   GDVLRPLAMRVPGDRCERTIVGTPDQLAAFDADASPGITTVAQLPGERFALKADPHELY
FT                   DLALVDRALAGRGDPADVLASIGAWVAPGGLVVLAESRRSRFADIVFGLQAGDGRAAAL
FT                   APTELAALCERAGLVEVARHTEHDLELEGTPSLVVARRPLPDEAALEPDDDSLDALERA
FT                   EQWVIVTAADDEVPLGALLADALTHAGHVVEAVEARQAADFIATMPATDPLHLVFCAPA
FT                   LRLADEVPAERLMQAQRSGAIALAALVRSLDTAHYAAGVRLSVITRGGAPFDGAAAGDP
FT                   AQATLWGLGRVLANEHPELGCRLIDVDPAAGVEVARLARELLIDVAEEEVLFTPAGRQV
FT                   PRMLSAERAAARAPLAAHAPAVLAFDAPGSLRNLEWFAQAPRALADDEVEIEPVATGLN
FT                   FRDVMYAMGLLSDEAVENGFAGATIGMELSGRVLRIGRGVSAFAPGDAVLGFAPASFAT
FT                   RVVTRAEAIAAKPAAMSFEEAATVPTTFFTAYYALVELARLRRGERVLIHGGAGGVGIA
FT                   AIQIARHFGAEVFATAGSDEKREFVRLLGADHVLDSRGLAFADQIHAITGGQGIDVVLN
FT                   SLAGEAMVRSIDTLRPFGRFLELGKRDFYENSHIGLRPFRNNISYFGIDADQLMGVLPE
FT                   LTARLFGEVMALFADGVLHPLPYRAFPAERAEDAFRYMQQARQIGKVLVTYPSGTPAPT
FT                   RGLAARAALALDPAGAYLVIGGTGGLGFATARRLVERGARHLTLASRGGALAEAAAAEV
FT                   ARWRETLGVAVEVAACDVTDAPALDALVARIAARGTPLRGVLHSAMQIDDGLVRNLDDA
FT                   RFEAVLAPKVAGAWNLHRATRGAPLDWFVVYSSATTYLGNPGQASYVAANSFLEALVVH
FT                   RRAAGLPATFMAWGPLDDVGFLARNDSTREALQARIGGAAISSAEALDALERALVDGRA
FT                   GEAVVRIDWQALARGMPAAGARRYAQMQTRPGSDGSRDGGDELREQVAALPREQAVAFV
FT                   AETLRAQIARILHMTPERIALDKSVLEMGMDSLMGMELGLAVEEVFEVKLSVMAIADGA
FT                   TVQSLAGRIVDSIAAQEANAGGAADGGGLDEVAALAAKHALDSEAKAALKAAANDPVGG
FT                   KKPRLEVAQ"
FT   gene            723139..724062
FT                   /locus_tag="bglu_1g06660"
FT   CDS_pept        723139..724062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06660"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27859"
FT                   /db_xref="GOA:C5ABP8"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABP8"
FT                   /protein_id="ACR27859.1"
FT                   /translation="MTSTAPAGWQATQGTLASELVLDGHGLHTGRRVRVRILPAAGRQP
FT                   ATRGIRFRRLDGGRELASFAVDPALRRAQPLCTMLRGPDGVGVRTVEHLLAALLACEID
FT                   HATVELDAEEVPILDGSAAPWIAALRATGRHALAAPKRFIRVTRALAVTDGAGGARREM
FT                   RLEPAPRYEMSVRNDLKGFGEMHWAGEMTPAAFAAEIAPSRSYGRVKWAVPAIVAGYLR
FT                   GVPILRGARPSCTASIVGRRVLGGMRLPDEFVRHRVLDLVGDLAMAGAPLLARVSALRP
FT                   SHEMNFRLVDALLSSPDAWEWAEFAA"
FT   gene            724100..725425
FT                   /locus_tag="bglu_1g06670"
FT   CDS_pept        724100..725425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06670"
FT                   /product="Glycine C-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27860"
FT                   /db_xref="GOA:C5ABP9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABP9"
FT                   /protein_id="ACR27860.1"
FT                   /translation="MGLGDHLRQQLAAKALKRQLERVTEGGADTAPAPAPAAAGVHASP
FT                   RSRFESMPQYQQLRIMREMGETLGVESPFFRVHDGLAGATTLIGGREYLNYANYNYLGL
FT                   AGDATVTAHAKQAIDRYGTSASASRMVAGERPVQRDLEHALAAFYGTDDCVVFVSGHAT
FT                   NVTVIGSLFGQGDLIVHDSLAHNSIVQGAQLSGAKRLSFPHNDWRALDALLARVRHEYR
FT                   NVLIAIEGLYSMDGDFPDLPKFVEIRKRHGAFLMVDEAHSLGVLGATGRGIREHFGVAA
FT                   EDVDLWMGTLSKTLAGCGGFIAGCQPLTDMLRHLAPGFLYSVGLAPVLAAASLSALEIL
FT                   QREPQRVAQLRERGRQFLDEARAAGLDTGTSAGYAVVPVITGSSLKAARWANALFDEGI
FT                   NVQPIFYPAVEEKAARLRFFICSTHEPGQITRTVAALARLAR"
FT   gene            725434..726072
FT                   /locus_tag="bglu_1g06680"
FT   CDS_pept        725434..726072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06680"
FT                   /product="putative acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27861"
FT                   /db_xref="GOA:C5ABQ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABQ0"
FT                   /protein_id="ACR27861.1"
FT                   /translation="MAAPLAGWTFRAARPEDAAACAPLILASGVREFGFFLGVPVEAMV
FT                   AFLASAFASRHGRFSWRRHRVAVAPDGSVAGVLAAHDGRMIAFDDPHVAWLLLRRFGLR
FT                   HTVASLLRGLVLEGELPAPKRSQTHVAHCAIDERWRGTGVFTALFEDTRRAGALGDGEG
FT                   REVVLDVLLSNSRAAALYRRLGFVEQPRAQPVSPKLPPELESIRMRLGR"
FT   gene            complement(726417..726492)
FT                   /locus_tag="bglu_1gt13"
FT                   /note="tRNA-Lys1 anticodon TTT, Cove score 92.38"
FT   tRNA            complement(726417..726492)
FT                   /locus_tag="bglu_1gt13"
FT                   /product="tRNA-Lys"
FT   gene            complement(726564..727313)
FT                   /locus_tag="bglu_1g06690"
FT   CDS_pept        complement(726564..727313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06690"
FT                   /product="tol-pal system protein YbgF"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27862"
FT                   /db_xref="GOA:C5ABQ1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABQ1"
FT                   /protein_id="ACR27862.1"
FT                   /translation="MTHRFPWLRAAAAACVAGVALGAAPAHAGMFDDDEARRAVLDLRT
FT                   RTDSLTNQLSAAQRTILDQSARLDQLNQQVATLRGQNEDLTNRLTTLERQQRDAYTDLD
FT                   ARLKKFEPQQTTVDGVEGTVQPGETDAFNAASQQFRSGDFKGAAASFRAFIAKYPQSPY
FT                   QPVAQYWLGNAQYALRDYKGSTATWQALVKAYPQHPRAGDALVAIGTNQLEQGQKAAAK
FT                   RTFEQVLSQFQGSSAAQAAQAKIESIK"
FT   gene            complement(727333..727845)
FT                   /locus_tag="bglu_1g06700"
FT   CDS_pept        complement(727333..727845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06700"
FT                   /product="OmpA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27863"
FT                   /db_xref="GOA:C5ABQ2"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABQ2"
FT                   /protein_id="ACR27863.1"
FT                   /translation="MMTNKARLALAVMMISALAACKSGVKLDDKANQGNAISTQPNPND
FT                   VAQVSVDPLNDPNSPLAKRSVYFDFDSYSVSDQYQPLLQAHAQYLKSHPARHILIQGNT
FT                   DERGTSEYNLALGQKRAEAVRRGLSLLGVPDSQMEAVSLGKEKPQATGHDEAAWAQNRR
FT                   ADIVYQQ"
FT   gene            complement(727863..729155)
FT                   /locus_tag="bglu_1g06710"
FT   CDS_pept        complement(727863..729155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06710"
FT                   /product="translocation protein TolB"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27864"
FT                   /db_xref="GOA:C5ABQ3"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABQ3"
FT                   /protein_id="ACR27864.1"
FT                   /translation="MTKLGFRSLVASCLIAAGSAANAQVNVLITGVGSTQFPIATANFV
FT                   NEAGLPQSVTAVVRADLARTGKFSNIDAGSTPISESAPVDYSAWKAKGANALVAGTVNR
FT                   EANGQVKVDFMLFDTVKQQSLGGLSLTATGDVEGMRKTGHKIADFIYQKLLGVRGVFST
FT                   RLSYVTHSGGKYRLLISDSDGENAIPALTSSEPIISPAWSPSGTKVAYVSFELRKPVVY
FT                   IHDLPTGRRYVISNQKGNNSAPAWAPDGQTLAVALSLTGNTQIYSVSATGTGLRRLTQS
FT                   SSIDTEPFYSPDGRWIYFTSDRGGQPQIYRMPAQGESAGAAQRVTFTGSYNTSPRVSPD
FT                   GKLLAYISRTGGGFKLYVQDLQTGAANAVTNTTHDESPSFAANGQYILYATRAGGRSVL
FT                   AAVPSDGSSPPQILPVQGGSFSEPSWGPFMQ"
FT   gene            complement(729262..730305)
FT                   /locus_tag="bglu_1g06720"
FT   CDS_pept        complement(729262..730305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06720"
FT                   /product="TonB/TolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06720"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27865"
FT                   /db_xref="GOA:C5ABQ4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABQ4"
FT                   /protein_id="ACR27865.1"
FT                   /translation="MNQRTRRSASPLQPPRERGTGRAFALAALMHVLLALFLYHGMQWQ
FT                   NSTPAGAEAELWSEVPDSPMPRPAPPPPPARVAPAPPPARDDEAEIALQEKRRKQQEAA
FT                   ARAAQLAEQRREQEKAQQEAEAKRAALAAQQLAQRQAAEKQRQAEKLRQQQLAEQQKKL
FT                   EQQKLEQQRKQEQAQAQADAEKKEQAEKAAAAKAEAAAKAKAEAAAKAKADAAAKARLD
FT                   KERQARLAQLQNQAGGGQGGGEGLARSGTGTGSGGNAASPGYADKVKRRVKPNIIWNGE
FT                   RSGLETRVQVRCSPNGDVLGVTVTRSSGNPGWDDAVVNAVRASTPLPPDVNGSTPSNIT
FT                   ITFRAAE"
FT   gene            complement(730302..730751)
FT                   /locus_tag="bglu_1g06730"
FT   CDS_pept        complement(730302..730751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06730"
FT                   /product="TolR protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27866"
FT                   /db_xref="GOA:C5ABQ5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABQ5"
FT                   /protein_id="ACR27866.1"
FT                   /translation="MAGTPLRSSMRGGRSRRAMADINVVPYIDVMLVLLVIFMVTAPLV
FT                   APSIVNLPTVGNASPQEQTPPVVVNIQADGKMSVRYKSDAGASQEDTMTKAELDDFIAS
FT                   RQADHPDQPVVIAADKTVQYDAVMTVMSDLKARGVKRVGLLVKSQ"
FT   gene            complement(730762..731439)
FT                   /locus_tag="bglu_1g06740"
FT   CDS_pept        complement(730762..731439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06740"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27867"
FT                   /db_xref="GOA:C5ABQ6"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABQ6"
FT                   /protein_id="ACR27867.1"
FT                   /translation="MNSAQDLSIVSLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFAL
FT                   RRARRQTERFERDFWSGGDLQALYQSAANNRHTIGSLERIFESGMREFLKAKEKRISDP
FT                   SLILDGARRAMRAAFQREMDMLEANLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQ
FT                   QATLANVAPGIAEALVATAIGLFAAIPAVVAYNRYAHEIDRLASRFETFVEEFSNILQR
FT                   QAQ"
FT   gene            complement(731621..732091)
FT                   /locus_tag="bglu_1g06750"
FT   CDS_pept        complement(731621..732091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06750"
FT                   /product="4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06750"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27868"
FT                   /db_xref="GOA:C5ABQ7"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABQ7"
FT                   /protein_id="ACR27868.1"
FT                   /translation="MNPPNRPPGPPETAFSFDWPVRVYYEDTDAGGIVFYANYLKYFER
FT                   ARTEWLRACGLDQRRLGDQTGAMFVVRDTAVDYRAPARLDDLLTVKSRIERFGRASLSF
FT                   VQEAWLGGVLLASGRIGIGWVERETLRPTGIPPVVRTALERGPMQCLSTADA"
FT   gene            complement(732210..732956)
FT                   /locus_tag="bglu_1g06760"
FT   CDS_pept        complement(732210..732956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06760"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06760"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27869"
FT                   /db_xref="GOA:C5ABQ8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABQ8"
FT                   /protein_id="ACR27869.1"
FT                   /translation="MIVFVTGASAGFGAAIARAFVKGGHRVVASARRKDRLDALAAELG
FT                   EALLPVELDVRDRAAVAAVLKGLPAAFTEIDVLVNNAGLALGVEPAQKASLDEWQTMID
FT                   TNCSGLVTVTHTLLPGMIARGRGHIFNLGSVAGTYPYAGGNVYGATKAFVRQFSLNLRT
FT                   DLLGTPLRVTDIEPGLCGGTEFSNVRFRGDDAKASNVYANVQPLTAEDIADTIYWIATR
FT                   PAHVNINTVEMMPVAQAPAGLAVHRG"
FT   gene            complement(733178..733465)
FT                   /locus_tag="bglu_1g06770"
FT   CDS_pept        complement(733178..733465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06770"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06770"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27870"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABQ9"
FT                   /protein_id="ACR27870.1"
FT                   /translation="MGSVKHTVSVKCVQVDRGGRVHCVAGGMASPTWRKYPVDARRDSH
FT                   RRCTQRRTTAAQANGKNGTLRFTVGGSTLNPEGSIASHAGGDERRSLLDA"
FT   gene            733448..734695
FT                   /locus_tag="bglu_1g06780"
FT   CDS_pept        733448..734695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06780"
FT                   /product="serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06780"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27871"
FT                   /db_xref="GOA:C5ABR0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABR0"
FT                   /protein_id="ACR27871.1"
FT                   /translation="MFDRAQSTIANVDPDLWQAIQQENQRQEDHIELIASENYTSPAVM
FT                   AAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKALFGAQAANVQPNSGSQANQ
FT                   GVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLDESEDIDYEAADRLA
FT                   QEHKPKMIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHAD
FT                   FVTTTTHKSLRGPRGGVILMKSEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEAGSAE
FT                   FKAYQQQVVENARVLAQTLVKRGLRIVSGRTESHVMLVDLQAKKITGKAAEAALGAAHI
FT                   TVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGTKEAEIVGNLIADVLDNPEDAATLER
FT                   VRAQVAELTRQFPVYR"
FT   gene            734702..735181
FT                   /locus_tag="bglu_1g06790"
FT   CDS_pept        734702..735181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06790"
FT                   /product="transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06790"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27872"
FT                   /db_xref="GOA:C5ABR1"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABR1"
FT                   /protein_id="ACR27872.1"
FT                   /translation="MRCPFCRHDDTQVVDSRVSEDGAAIRRRRRCSACDKRFTTYERVE
FT                   LALPAVVKKDGSRTEFDRRKIVASMQLALRKRPVAADAIDAAVARIEYQLLATGEREVR
FT                   SEKLGELVMNELRGLDTIAYVRFASVYRRFEDVSEFADVIEEFRRAGPSKAPRKR"
FT   gene            735339..735908
FT                   /locus_tag="bglu_1g06800"
FT   CDS_pept        735339..735908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06800"
FT                   /product="Tfp pilus assembly protein FimT-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06800"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27873"
FT                   /db_xref="GOA:C5ABR2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABR2"
FT                   /protein_id="ACR27873.1"
FT                   /translation="MRDRARAAGVTLVESMVAIALVALVATYAMPSFVAWRQRDRVDAR
FT                   ATAMLAALAAARVEAVSRGVRVVLCRGDGSAGQPCLAAQHRCDGEGAWSCAWAVVALDA
FT                   AAPGDTARGTVLRRIPADSGVRVEGAVADVVFTPPAGQVIGGFRRFEFSARARISSTGG
FT                   PVASRCLRIAAGGRARLSPGRCGAAR"
FT   gene            735926..736309
FT                   /locus_tag="bglu_1g06810"
FT   CDS_pept        735926..736309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06810"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06810"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27874"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABR3"
FT                   /protein_id="ACR27874.1"
FT                   /translation="MAGSSLLEVAIALLLLAGATVGVLGAQLAMRHVEADLSRRAQAWR
FT                   LADSRAELARSESVPTVDWARAAPDLPGARFDTSARDGHALVTVSWRRGGHGAAPAVCK
FT                   PRVSGTRQPAGCVALAYAAELSP"
FT   gene            736306..737112
FT                   /locus_tag="bglu_1g06820"
FT   CDS_pept        736306..737112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06820"
FT                   /product="prepilin-type cleavage/methylation-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06820"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27875"
FT                   /db_xref="GOA:C5ABR4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABR4"
FT                   /protein_id="ACR27875.1"
FT                   /translation="MSRWRRQRAHSLVEALVALALAAVVLAAAVALYRTQRDAYVASVD
FT                   AARARDAAAVALTLVAQSVRMAGFVPLDMRMAGFAPLFGCASARAAGDAMRPACVAATD
FT                   GSDGLLVRYVGDVRSTWPTADGRVTDCLGQGVGAAGDRPLVVNRYFVRQGRSAGVPELY
FT                   CEGSGRPGVAQPLVEGIERLRLRYRLRGRPAWRDASALAADAWREVVAIEVCVQVRGTA
FT                   PAPAGRYIDCDGISQTSRDGRRRWIARRWLSLRNTVAPVGATGANQ"
FT   gene            737256..737813
FT                   /locus_tag="bglu_1g06830"
FT   CDS_pept        737256..737813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06830"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06830"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27876"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABR5"
FT                   /protein_id="ACR27876.1"
FT                   /translation="MASALPGVLTIVAALLAASAGWFEVSMTDARSVGVYASRSIALHA
FT                   AEAALDVCERRLAERVLFIAETAPVAVGMPSPTVRRTSMPMQPGRAGASSAEPLMWRQP
FT                   GALDGPPAWRPFATWPGAAAPPACLIERWPIASHPRWRAYLITARGTGATHATTAWLQL
FT                   QLAYDDTRRVARRWRRVAAPPS"
FT   gene            737829..738308
FT                   /locus_tag="bglu_1g06840"
FT   CDS_pept        737829..738308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06840"
FT                   /product="Tfp pilus assembly protein PilE"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06840"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27877"
FT                   /db_xref="GOA:C5ABR6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABR6"
FT                   /protein_id="ACR27877.1"
FT                   /translation="MHIERIVARTNAAGRSAGGRPRAGFTLVELAIALAVAALIAAFAV
FT                   PSYRRQIARGHRLGAVTALYRAAHELAARSHFEPPGRELWLGNVPEQGAPVYRLAVRAA
FT                   PDDGGYVLSATPVGQGPMHDDRCGTYLLSADGARRNRSPGATGTGEVRDGCWTMR"
FT   gene            complement(738451..738948)
FT                   /locus_tag="bglu_1g06850"
FT   CDS_pept        complement(738451..738948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06850"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06850"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27878"
FT                   /db_xref="InterPro:IPR021751"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABR7"
FT                   /protein_id="ACR27878.1"
FT                   /translation="MNQSAPDEPFRPPRSRRRLNATQYRALRKELLILRSDVERLELAQ
FT                   AGSELRQAVTHFRWLKLLIPGFSGRGAFGKSGKGLNASLGALVGQYPLLSSLASVVLAK
FT                   PVRTLVVKSAGPAIKWGSIGFAVWEAYQIWRGAQRDKTAAEARQAGSTPAAAGARRNDG
FT                   RS"
FT   gene            complement(738970..739359)
FT                   /locus_tag="bglu_1g06860"
FT   CDS_pept        complement(738970..739359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06860"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06860"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27879"
FT                   /db_xref="GOA:C5ABR8"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABR8"
FT                   /protein_id="ACR27879.1"
FT                   /translation="MTTDTPQPRAEHGPLRRLLGSVFALLQTRLELVGIELAEEKERLI
FT                   GVLFLGLAAMMLATMALISLTVLVAIAFWDTYRWQSLAAITAVYAIGAIGCGIKARMGL
FT                   REAPSVFEATLHELEKDRELFRGKP"
FT   gene            complement(739469..739771)
FT                   /locus_tag="bglu_1g06870"
FT   CDS_pept        complement(739469..739771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06870"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06870"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27880"
FT                   /db_xref="GOA:C5ABR9"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABR9"
FT                   /protein_id="ACR27880.1"
FT                   /translation="MSEVNKEKLMSDIKTVLADAEDLLKQAAATTGDRASELREKALSR
FT                   LKQAKDKAADVQVVVVEKGKKAVRATDDYVHEHPWTSIGVAAGVGVLIGLLINRK"
FT   gene            740099..740740
FT                   /locus_tag="bglu_1g06880"
FT   CDS_pept        740099..740740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="bglu_1g06880"
FT                   /product="Putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:bglu_1g06880"
FT                   /db_xref="EnsemblGenomes-Tr:ACR27881"
FT                   /db_xref="GOA:C5ABS0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5ABS0"
FT                   /protein_id="ACR27881.1"
FT                   /translation="MSLRLGDTAPDFEQDSSLGRIKFHEWLGDSWGVLFSHPADYTPVC
FT                   TTELGLTAKLKDEFEKRNVKAIALSVDNVESHKGWINDINETQATSVNFPILADSDRKV
FT                   SELYDMIHPNANETLTVRSLFVIDPKKKVRLTITYPASTGRNFDEVLRVIDSLQLTDNY
FT                   KVATPGNWKDGDDVVIVPSLKDEDELKQRFPKGYKALRPYLRLTPQPNKQ"
FT   gene            complement(740882..742069)
FT                   /locus_tag="bglu_1g06890"
FT