(data stored in ACNUC30630 zone)

EMBL: CP001515

ID   CP001515; SV 1; circular; genomic DNA; STD; PRO; 1938709 BP.
XX
AC   CP001515;
XX
PR   Project:PRJNA32897;
XX
DT   24-JUN-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Bifidobacterium animalis subsp. lactis Bl-04, complete genome.
XX
KW   .
XX
OS   Bifidobacterium animalis subsp. lactis Bl-04
OC   Bacteria; Actinobacteria; Bifidobacteriales; Bifidobacteriaceae;
OC   Bifidobacterium.
XX
RN   [1]
RP   1-1938709
RX   DOI; 10.1128/JB.00155-09.
RX   PUBMED; 19376856.
RA   Barrangou R., Briczinski E.P., Traeger L.L., Loquasto J.R., Richards M.,
RA   Horvath P., Coute-Monvoisin A.C., Leyer G., Rendulic S., Steele J.L.,
RA   Broadbent J.R., Oberg T., Dudley E.G., Schuster S., Romero D.A.,
RA   Roberts R.F.;
RT   "Comparison of the complete genome sequences of Bifidobacterium animalis
RT   subsp. lactis DSM 10140 and Bl-04";
RL   J. Bacteriol. 191(13):4144-4151(2009).
XX
RN   [2]
RP   1-1938709
RA   Barrangou R., Briczinski E.P., Traeger L.L., Loquasto J.R., Richards M.,
RA   Horvath P., Coute-Monvoisin A.-C., Leyer G., Rendulic S., Steele J.L.,
RA   Broadbent J.R., Oberg T., Dudley E.G., Schuster S., Romero D.A.,
RA   Roberts R.F.;
RT   ;
RL   Submitted (17-MAR-2009) to the INSDC.
RL   Danisco USA Inc, 3329 Agriculture Drive, Madison, WI 53716, USA
XX
DR   MD5; d6a087a143acb4737b6d2609ffcd5dd7.
DR   BioSample; SAMN02603172.
DR   EnsemblGenomes-Gn; Balac_0016.
DR   EnsemblGenomes-Gn; Balac_0017.
DR   EnsemblGenomes-Gn; Balac_0098.
DR   EnsemblGenomes-Gn; Balac_0105.
DR   EnsemblGenomes-Gn; Balac_0186.
DR   EnsemblGenomes-Gn; Balac_0237.
DR   EnsemblGenomes-Gn; Balac_0238.
DR   EnsemblGenomes-Gn; Balac_0290.
DR   EnsemblGenomes-Gn; Balac_0291.
DR   EnsemblGenomes-Gn; Balac_0307.
DR   EnsemblGenomes-Gn; Balac_0319.
DR   EnsemblGenomes-Gn; Balac_0360.
DR   EnsemblGenomes-Gn; Balac_0361.
DR   EnsemblGenomes-Gn; Balac_0362.
DR   EnsemblGenomes-Gn; Balac_0369.
DR   EnsemblGenomes-Gn; Balac_0411.
DR   EnsemblGenomes-Gn; Balac_0422.
DR   EnsemblGenomes-Gn; Balac_0436.
DR   EnsemblGenomes-Gn; Balac_0462.
DR   EnsemblGenomes-Gn; Balac_0488.
DR   EnsemblGenomes-Gn; Balac_0489.
DR   EnsemblGenomes-Gn; Balac_0490.
DR   EnsemblGenomes-Gn; Balac_0508.
DR   EnsemblGenomes-Gn; Balac_0587.
DR   EnsemblGenomes-Gn; Balac_0615.
DR   EnsemblGenomes-Gn; Balac_0743.
DR   EnsemblGenomes-Gn; Balac_0748.
DR   EnsemblGenomes-Gn; Balac_0749.
DR   EnsemblGenomes-Gn; Balac_0762.
DR   EnsemblGenomes-Gn; Balac_0764.
DR   EnsemblGenomes-Gn; Balac_0809.
DR   EnsemblGenomes-Gn; Balac_0829.
DR   EnsemblGenomes-Gn; Balac_0833.
DR   EnsemblGenomes-Gn; Balac_0834.
DR   EnsemblGenomes-Gn; Balac_0835.
DR   EnsemblGenomes-Gn; Balac_0836.
DR   EnsemblGenomes-Gn; Balac_0910.
DR   EnsemblGenomes-Gn; Balac_0975.
DR   EnsemblGenomes-Gn; Balac_0983.
DR   EnsemblGenomes-Gn; Balac_1013.
DR   EnsemblGenomes-Gn; Balac_1074.
DR   EnsemblGenomes-Gn; Balac_1075.
DR   EnsemblGenomes-Gn; Balac_1252.
DR   EnsemblGenomes-Gn; Balac_1277.
DR   EnsemblGenomes-Gn; Balac_1278.
DR   EnsemblGenomes-Gn; Balac_1279.
DR   EnsemblGenomes-Gn; Balac_1280.
DR   EnsemblGenomes-Gn; Balac_1281.
DR   EnsemblGenomes-Gn; Balac_1319.
DR   EnsemblGenomes-Gn; Balac_1422.
DR   EnsemblGenomes-Gn; Balac_1439.
DR   EnsemblGenomes-Gn; Balac_1493.
DR   EnsemblGenomes-Gn; Balac_1505.
DR   EnsemblGenomes-Gn; Balac_1506.
DR   EnsemblGenomes-Gn; Balac_1507.
DR   EnsemblGenomes-Gn; Balac_1526.
DR   EnsemblGenomes-Gn; Balac_1549.
DR   EnsemblGenomes-Gn; Balac_1579.
DR   EnsemblGenomes-Gn; Balac_1580.
DR   EnsemblGenomes-Gn; Balac_1581.
DR   EnsemblGenomes-Gn; Balac_1585.
DR   EnsemblGenomes-Gn; Balac_1586.
DR   EnsemblGenomes-Gn; Balac_1587.
DR   EnsemblGenomes-Gn; Balac_1614.
DR   EnsemblGenomes-Gn; EBG00001016067.
DR   EnsemblGenomes-Gn; EBG00001016070.
DR   EnsemblGenomes-Gn; EBG00001016073.
DR   EnsemblGenomes-Gn; EBG00001016077.
DR   EnsemblGenomes-Gn; EBG00001016079.
DR   EnsemblGenomes-Gn; EBG00001016083.
DR   EnsemblGenomes-Gn; EBG00001016085.
DR   EnsemblGenomes-Gn; EBG00001016087.
DR   EnsemblGenomes-Gn; EBG00001016088.
DR   EnsemblGenomes-Gn; EBG00001016089.
DR   EnsemblGenomes-Gn; EBG00001016090.
DR   EnsemblGenomes-Gn; EBG00001016093.
DR   EnsemblGenomes-Gn; EBG00001016096.
DR   EnsemblGenomes-Gn; EBG00001016099.
DR   EnsemblGenomes-Gn; EBG00001016102.
DR   EnsemblGenomes-Gn; EBG00001016106.
DR   EnsemblGenomes-Gn; EBG00001016112.
DR   EnsemblGenomes-Gn; EBG00001016114.
DR   EnsemblGenomes-Gn; EBG00001016116.
DR   EnsemblGenomes-Gn; EBG00001016118.
DR   EnsemblGenomes-Gn; EBG00001016120.
DR   EnsemblGenomes-Gn; EBG00001016122.
DR   EnsemblGenomes-Gn; EBG00001016124.
DR   EnsemblGenomes-Gn; EBG00001016125.
DR   EnsemblGenomes-Gn; EBG00001016130.
DR   EnsemblGenomes-Gn; EBG00001016132.
DR   EnsemblGenomes-Gn; EBG00001016134.
DR   EnsemblGenomes-Gn; EBG00001016136.
DR   EnsemblGenomes-Gn; EBG00001016137.
DR   EnsemblGenomes-Gn; EBG00001016138.
DR   EnsemblGenomes-Gn; EBG00001016140.
DR   EnsemblGenomes-Gn; EBG00001016142.
DR   EnsemblGenomes-Gn; EBG00001016145.
DR   EnsemblGenomes-Gn; EBG00001016148.
DR   EnsemblGenomes-Gn; EBG00001016151.
DR   EnsemblGenomes-Gn; EBG00001016157.
DR   EnsemblGenomes-Gn; EBG00001016159.
DR   EnsemblGenomes-Gn; EBG00001016161.
DR   EnsemblGenomes-Gn; EBG00001016163.
DR   EnsemblGenomes-Gn; EBG00001016165.
DR   EnsemblGenomes-Gn; EBG00001016167.
DR   EnsemblGenomes-Gn; EBG00001016169.
DR   EnsemblGenomes-Gn; EBG00001016171.
DR   EnsemblGenomes-Gn; EBG00001016172.
DR   EnsemblGenomes-Gn; EBG00001016173.
DR   EnsemblGenomes-Gn; EBG00001016175.
DR   EnsemblGenomes-Gn; EBG00001016177.
DR   EnsemblGenomes-Gn; EBG00001016179.
DR   EnsemblGenomes-Gn; EBG00001016182.
DR   EnsemblGenomes-Gn; EBG00001016185.
DR   EnsemblGenomes-Gn; EBG00001016188.
DR   EnsemblGenomes-Gn; EBG00001016191.
DR   EnsemblGenomes-Gn; EBG00001016194.
DR   EnsemblGenomes-Gn; EBG00001016197.
DR   EnsemblGenomes-Gn; EBG00001016198.
DR   EnsemblGenomes-Gn; EBG00001016201.
DR   EnsemblGenomes-Gn; EBG00001016203.
DR   EnsemblGenomes-Gn; EBG00001016205.
DR   EnsemblGenomes-Gn; EBG00001016207.
DR   EnsemblGenomes-Gn; EBG00001016209.
DR   EnsemblGenomes-Gn; EBG00001016211.
DR   EnsemblGenomes-Gn; EBG00001016214.
DR   EnsemblGenomes-Gn; EBG00001016217.
DR   EnsemblGenomes-Gn; EBG00001016220.
DR   EnsemblGenomes-Gn; EBG00001016223.
DR   EnsemblGenomes-Gn; EBG00001016226.
DR   EnsemblGenomes-Gn; EBG00001016229.
DR   EnsemblGenomes-Gn; EBG00001016232.
DR   EnsemblGenomes-Gn; EBG00001016235.
DR   EnsemblGenomes-Gn; EBG00001016238.
DR   EnsemblGenomes-Gn; EBG00001016241.
DR   EnsemblGenomes-Gn; EBG00001016244.
DR   EnsemblGenomes-Gn; EBG00001016246.
DR   EnsemblGenomes-Gn; EBG00001016248.
DR   EnsemblGenomes-Gn; EBG00001016250.
DR   EnsemblGenomes-Gn; EBG00001016251.
DR   EnsemblGenomes-Gn; EBG00001016253.
DR   EnsemblGenomes-Gn; EBG00001016255.
DR   EnsemblGenomes-Gn; EBG00001016257.
DR   EnsemblGenomes-Tr; Balac_0016-1.
DR   EnsemblGenomes-Tr; Balac_0017-1.
DR   EnsemblGenomes-Tr; Balac_0098-1.
DR   EnsemblGenomes-Tr; Balac_0105-1.
DR   EnsemblGenomes-Tr; Balac_0186-1.
DR   EnsemblGenomes-Tr; Balac_0237-1.
DR   EnsemblGenomes-Tr; Balac_0238-1.
DR   EnsemblGenomes-Tr; Balac_0290-1.
DR   EnsemblGenomes-Tr; Balac_0291-1.
DR   EnsemblGenomes-Tr; Balac_0307-1.
DR   EnsemblGenomes-Tr; Balac_0319-1.
DR   EnsemblGenomes-Tr; Balac_0360-1.
DR   EnsemblGenomes-Tr; Balac_0361-1.
DR   EnsemblGenomes-Tr; Balac_0362-1.
DR   EnsemblGenomes-Tr; Balac_0369-1.
DR   EnsemblGenomes-Tr; Balac_0411-1.
DR   EnsemblGenomes-Tr; Balac_0422-1.
DR   EnsemblGenomes-Tr; Balac_0436-1.
DR   EnsemblGenomes-Tr; Balac_0462-1.
DR   EnsemblGenomes-Tr; Balac_0488-1.
DR   EnsemblGenomes-Tr; Balac_0489-1.
DR   EnsemblGenomes-Tr; Balac_0490-1.
DR   EnsemblGenomes-Tr; Balac_0508-1.
DR   EnsemblGenomes-Tr; Balac_0587-1.
DR   EnsemblGenomes-Tr; Balac_0615-1.
DR   EnsemblGenomes-Tr; Balac_0743-1.
DR   EnsemblGenomes-Tr; Balac_0748-1.
DR   EnsemblGenomes-Tr; Balac_0749-1.
DR   EnsemblGenomes-Tr; Balac_0762-1.
DR   EnsemblGenomes-Tr; Balac_0764-1.
DR   EnsemblGenomes-Tr; Balac_0809-1.
DR   EnsemblGenomes-Tr; Balac_0829-1.
DR   EnsemblGenomes-Tr; Balac_0833-1.
DR   EnsemblGenomes-Tr; Balac_0834-1.
DR   EnsemblGenomes-Tr; Balac_0835-1.
DR   EnsemblGenomes-Tr; Balac_0836-1.
DR   EnsemblGenomes-Tr; Balac_0910-1.
DR   EnsemblGenomes-Tr; Balac_0975-1.
DR   EnsemblGenomes-Tr; Balac_0983-1.
DR   EnsemblGenomes-Tr; Balac_1013-1.
DR   EnsemblGenomes-Tr; Balac_1074-1.
DR   EnsemblGenomes-Tr; Balac_1075-1.
DR   EnsemblGenomes-Tr; Balac_1252-1.
DR   EnsemblGenomes-Tr; Balac_1277-1.
DR   EnsemblGenomes-Tr; Balac_1278-1.
DR   EnsemblGenomes-Tr; Balac_1279-1.
DR   EnsemblGenomes-Tr; Balac_1280-1.
DR   EnsemblGenomes-Tr; Balac_1281-1.
DR   EnsemblGenomes-Tr; Balac_1319-1.
DR   EnsemblGenomes-Tr; Balac_1422-1.
DR   EnsemblGenomes-Tr; Balac_1439-1.
DR   EnsemblGenomes-Tr; Balac_1493-1.
DR   EnsemblGenomes-Tr; Balac_1505-1.
DR   EnsemblGenomes-Tr; Balac_1506-1.
DR   EnsemblGenomes-Tr; Balac_1507-1.
DR   EnsemblGenomes-Tr; Balac_1526-1.
DR   EnsemblGenomes-Tr; Balac_1549-1.
DR   EnsemblGenomes-Tr; Balac_1579-1.
DR   EnsemblGenomes-Tr; Balac_1580-1.
DR   EnsemblGenomes-Tr; Balac_1581-1.
DR   EnsemblGenomes-Tr; Balac_1585-1.
DR   EnsemblGenomes-Tr; Balac_1586-1.
DR   EnsemblGenomes-Tr; Balac_1587-1.
DR   EnsemblGenomes-Tr; Balac_1614-1.
DR   EnsemblGenomes-Tr; EBT00001542038.
DR   EnsemblGenomes-Tr; EBT00001542039.
DR   EnsemblGenomes-Tr; EBT00001542040.
DR   EnsemblGenomes-Tr; EBT00001542041.
DR   EnsemblGenomes-Tr; EBT00001542042.
DR   EnsemblGenomes-Tr; EBT00001542043.
DR   EnsemblGenomes-Tr; EBT00001542044.
DR   EnsemblGenomes-Tr; EBT00001542045.
DR   EnsemblGenomes-Tr; EBT00001542046.
DR   EnsemblGenomes-Tr; EBT00001542047.
DR   EnsemblGenomes-Tr; EBT00001542048.
DR   EnsemblGenomes-Tr; EBT00001542049.
DR   EnsemblGenomes-Tr; EBT00001542050.
DR   EnsemblGenomes-Tr; EBT00001542051.
DR   EnsemblGenomes-Tr; EBT00001542052.
DR   EnsemblGenomes-Tr; EBT00001542054.
DR   EnsemblGenomes-Tr; EBT00001542055.
DR   EnsemblGenomes-Tr; EBT00001542056.
DR   EnsemblGenomes-Tr; EBT00001542057.
DR   EnsemblGenomes-Tr; EBT00001542058.
DR   EnsemblGenomes-Tr; EBT00001542059.
DR   EnsemblGenomes-Tr; EBT00001542060.
DR   EnsemblGenomes-Tr; EBT00001542061.
DR   EnsemblGenomes-Tr; EBT00001542062.
DR   EnsemblGenomes-Tr; EBT00001542063.
DR   EnsemblGenomes-Tr; EBT00001542064.
DR   EnsemblGenomes-Tr; EBT00001542065.
DR   EnsemblGenomes-Tr; EBT00001542066.
DR   EnsemblGenomes-Tr; EBT00001542067.
DR   EnsemblGenomes-Tr; EBT00001542068.
DR   EnsemblGenomes-Tr; EBT00001542069.
DR   EnsemblGenomes-Tr; EBT00001542070.
DR   EnsemblGenomes-Tr; EBT00001542071.
DR   EnsemblGenomes-Tr; EBT00001542072.
DR   EnsemblGenomes-Tr; EBT00001542073.
DR   EnsemblGenomes-Tr; EBT00001542074.
DR   EnsemblGenomes-Tr; EBT00001542075.
DR   EnsemblGenomes-Tr; EBT00001542076.
DR   EnsemblGenomes-Tr; EBT00001542077.
DR   EnsemblGenomes-Tr; EBT00001542078.
DR   EnsemblGenomes-Tr; EBT00001542079.
DR   EnsemblGenomes-Tr; EBT00001542080.
DR   EnsemblGenomes-Tr; EBT00001542081.
DR   EnsemblGenomes-Tr; EBT00001542082.
DR   EnsemblGenomes-Tr; EBT00001542083.
DR   EnsemblGenomes-Tr; EBT00001542084.
DR   EnsemblGenomes-Tr; EBT00001542085.
DR   EnsemblGenomes-Tr; EBT00001542086.
DR   EnsemblGenomes-Tr; EBT00001542087.
DR   EnsemblGenomes-Tr; EBT00001542088.
DR   EnsemblGenomes-Tr; EBT00001542089.
DR   EnsemblGenomes-Tr; EBT00001542091.
DR   EnsemblGenomes-Tr; EBT00001542092.
DR   EnsemblGenomes-Tr; EBT00001542093.
DR   EnsemblGenomes-Tr; EBT00001542094.
DR   EnsemblGenomes-Tr; EBT00001542095.
DR   EnsemblGenomes-Tr; EBT00001542096.
DR   EnsemblGenomes-Tr; EBT00001542097.
DR   EnsemblGenomes-Tr; EBT00001542098.
DR   EnsemblGenomes-Tr; EBT00001542099.
DR   EnsemblGenomes-Tr; EBT00001542100.
DR   EnsemblGenomes-Tr; EBT00001542101.
DR   EnsemblGenomes-Tr; EBT00001542102.
DR   EnsemblGenomes-Tr; EBT00001542103.
DR   EnsemblGenomes-Tr; EBT00001542104.
DR   EnsemblGenomes-Tr; EBT00001542105.
DR   EnsemblGenomes-Tr; EBT00001542106.
DR   EnsemblGenomes-Tr; EBT00001542107.
DR   EnsemblGenomes-Tr; EBT00001542108.
DR   EnsemblGenomes-Tr; EBT00001542109.
DR   EnsemblGenomes-Tr; EBT00001542110.
DR   EnsemblGenomes-Tr; EBT00001542111.
DR   EnsemblGenomes-Tr; EBT00001542112.
DR   EnsemblGenomes-Tr; EBT00001542113.
DR   EnsemblGenomes-Tr; EBT00001542114.
DR   EnsemblGenomes-Tr; EBT00001542115.
DR   EnsemblGenomes-Tr; EBT00001542116.
DR   EnsemblGenomes-Tr; EBT00001542118.
DR   EnsemblGenomes-Tr; EBT00001542119.
DR   EuropePMC; PMC2698493; 19376856.
DR   EuropePMC; PMC2869156; 20348299.
DR   EuropePMC; PMC2937518; 20805404.
DR   EuropePMC; PMC3318781; 22307308.
DR   EuropePMC; PMC3697524; 23645200.
DR   EuropePMC; PMC4335975; 25515139.
DR   EuropePMC; PMC4908950; 27379055.
DR   EuropePMC; PMC6238047; 30266728.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001515.
DR   SILVA-SSU; CP001515.
XX
CC   Genome was manually curated based on annotation generated by the
CC   NCBI Prokaryotic Genomes Automatic Annotation Pipeline Group.
CC   Information about the Pipeline can be found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1938709
FT                   /organism="Bifidobacterium animalis subsp. lactis Bl-04"
FT                   /sub_species="lactis"
FT                   /strain="Bl-04; ATCC SD5219"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:580050"
FT                   /culture_collection="ATCC:SD5219"
FT   gene            134..1885
FT                   /gene="dnaA"
FT                   /locus_tag="Balac_0001"
FT   CDS_pept        134..1885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Balac_0001"
FT                   /product="ATPase for DNA replication initiation"
FT                   /note="COG0593 ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45399"
FT                   /protein_id="ACS45399.1"
FT                   /translation="MNAENLDPATQAQTIWSDTLALIKQNSRLTAREQGWLAGVTAEAV
FT                   VGTTIILDVENAQTLQVLQTELNEPIIGALEIANGGSPMFPAFKVMPPAQPEPQTTASP
FT                   EDSGSRAADAQGAAKESVQPDEDSRTPRHSAEQTGDSRPAAAQEREDSAVHMARPDEQT
FT                   AESHREPEHEPAQQPVTSHYDEAIVQTFEDIDPVAGFGPSVAGTTAPQYPPQSEMQGSF
FT                   TPGVTGNYRDPVTHLNSNDTFDTFIQGDSNRFARTVALAVAEGSGRDYNPLCIYGGSGL
FT                   GKTHLLHAIGNYAVQNQKPRPRVLYVTSEEFTNDFIESIRTSGQDNEDPAMEKFYRKYR
FT                   EVDVLLIDDIQFLGGKRGILEQFFHTFNSLYQANKRIVIASDVPPHNLEDFEDRLISRF
FT                   EQGITVDVKPPNLETRIAILRMLAEQNHIRVPNDVLNLIAERFANNVRELEGALKRVIA
FT                   MASLNHQPVTRALTERTLQDFFTTDVEVKPTDIIARVAKYFHLTFDDIVGPGRPRSVTL
FT                   ARQIAMYLTRDMTSMSLMNIGQIFGGRDHTTVMHACKHIADKMQEKQEIYNYVNELTVE
FT                   LKQHLND"
FT   gene            2489..3613
FT                   /locus_tag="Balac_0002"
FT   CDS_pept        2489..3613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /note="COG0592 DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45400"
FT                   /protein_id="ACS45400.1"
FT                   /translation="MKVEVNTASFADAVAWTTSVIDARPANPILAGVKLEAADGTMQLS
FT                   AFTYEISARDHIEAGVDESGTVVVLGKLLADISKVLPAEKTYLSANETTMTITSGPATF
FT                   TLQLMPESEYPDLPQLPPQIGQVDAETFTQTVTQAAVAVAHDENRPVLTGVHMRFAGEE
FT                   VTLSSTDRFRLGRASFRWTPDEADLDTAALVRGSHLVKIARSVDERANVVIYLDPANPK
FT                   LIGIANAGRISTVQLIDGEFPAVDRLYADSYPIQAVIRKEDLLGAAKRVSLVAERNAPI
FT                   RMVFTDQQLTLTAGGADEASAKETLQIDLDGEDITVAFNPSYLREGLSVISEPYIRMKM
FT                   TTAVKPVEFNGQQDEDGEESMSYRYLLVPMRFNV"
FT   gene            3659..5086
FT                   /locus_tag="Balac_0003"
FT   CDS_pept        3659..5086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0003"
FT                   /product="recombination protein RecF"
FT                   /note="COG1195 Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45401"
FT                   /protein_id="ACS45401.1"
FT                   /translation="MITVSRLALDHFRSWTNCVLDFKPGVNILEGPNGLGKTNIVEALE
FT                   VLSTGSSHRASTSQPLVEQGFPAAAIRANIEELSEDFENNTETIDDRTTTFELTIRVRG
FT                   ANRARVDGGPSLYMRDIVGRVPLVAFTPDDQRLVWGDPAVRRSFIDQAASVLVRGYTDL
FT                   LQRFTHIAKQRAALLKQIGAQEGVSVSEEARQMRMNGLEVWTAQFIETGLELTRQRMAV
FT                   IGMLNEYFGTIVQELSDVDQTATLVYEPSFDELYLTQGAEAGEQGGPERVKAAISEHFQ
FT                   RIYTGEVARGVNLIGPQRDDVSIELNGMPAREYSSNGESWTLALALKMALYRLLERKAG
FT                   ERPIVVLDDVFAQLDPSRRAKIMEFALRQDQVIITVAAAGDVPELPGDAHAHVIDVAAL
FT                   KLQGSGGEGTAFMPEPLPADDPFAGQLAAVQASRRTAGMHAGSDGKHKVEQSADQSAEQ
FT                   VSGEREIGLTKHESAHA"
FT   gene            5083..5586
FT                   /locus_tag="Balac_0004"
FT   CDS_pept        5083..5586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0004"
FT                   /product="hypothetical protein"
FT                   /note="COG5512 Zn-ribbon-containing, possibly RNA-binding
FT                   protein and truncated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45402"
FT                   /protein_id="ACS45402.1"
FT                   /translation="MSEPPIAVTLKLDERALPAEEFEHVSARAGLIAERRVKREEALEN
FT                   FGKPGRDEVAFGSLFAGIAKRAGWVPHMKLAQLRHDWASIVGDVIARNTWVGAIDNGVL
FT                   TIHAKSPSWTTQLTFMLPELREKVLERLNGLDIRDIRVTGPQAHGPATRRKQYVRQNMH
FT                   YRPQ"
FT   gene            5777..7894
FT                   /gene="gyrB"
FT                   /locus_tag="Balac_0005"
FT   CDS_pept        5777..7894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Balac_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo
FT                   II,topoisomerase IV, B subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45403"
FT                   /protein_id="ACS45403.1"
FT                   /translation="MADQPTDSAAESLESASNDPIDQNLEANGTDQNDEQLDDTLSPEH
FT                   YDASDLRVLEGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYATHIEVTIL
FT                   PDNGIRVVDDGRGIPVDEVPGEGKSGVETVMTKLHAGGKFGGGGYAVSGGLHGVGISVV
FT                   NALSTRVDVEVRRQGYYWTQTYIDQHPTGPLERGRAMRDDESTGTSVTFWADPKIFETT
FT                   IYDFETLRSRFQQMAFLNKGLKITLTDMRQVDEARDEVAGDGDNTVEELHQTVTYQYKN
FT                   GIKDYVAFLVKSRGSAPIEPDVIDIESEDLTIGVSAEIAMQWTSAYSESVHTFANTIAT
FT                   TEGGTHEEGFRAALTSMINRYARDKNILKDKDDNLSGDDVREGLTAVISVKLTNPQFEG
FT                   QTKTKLGNSEAKTFVQRVMNEKLGDWLDAHPNEAKNIIQKALEASRARLAAKKARENTR
FT                   RKSIFESAGMPDKLKDCQSNDPSECELFIVEGDSAGGSAIQGRNPLTQAILPLRGKILN
FT                   TERASLDRMLKSDTIESLITAIGGGYGEDFDLDKVRYHKVIIMADADVDGAHIATLNLT
FT                   LFFRYMRPMITAGYVYVAMPPLYRLKWTKGPHDFVYTDAERDRVLAEGKANGRQLPKGE
FT                   GIQRYKGLGEMSYQELWETTMDPDHRILKQVHIEDALQADETFSMLMGDEVEPRRLFIQ
FT                   RNAHNARWIDA"
FT   gene            7963..10725
FT                   /locus_tag="Balac_0006"
FT   CDS_pept        7963..10725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /note="COG0188 Type IIA topoisomerase (DNA gyrase/topo
FT                   II,topoisomerase IV, A subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45404"
FT                   /protein_id="ACS45404.1"
FT                   /translation="MADEPTNNGLDNGPVNDSGDEQHLPDGSLEPLSPQEADNTDYGLM
FT                   VGQRVQPIDLQDEMRQSYLSYALSVIVERALPDVRDGMKPVHRRVVYAMYDGGYRPDRG
FT                   YNKCSRVVGDVMGKYHPHGDSAIYDTLVRMAQSWSMRYLLVDGQGNFGSPGDDPAAAMR
FT                   YTECRMAPLAMEMVRDIDKDTVDFVPNYDGKTQEPTVLPARFPNLLVNGSSGIAVGMAT
FT                   NIPPHNMREVADGVHWALDHPEASREELLDALIERIKGPDFPTGATILGHKGIEQAYRT
FT                   GRGLITMRAVVNTEEIKGRMCLVVTELPYQVNPDRLVASIREAVRDGKITGIADMRDET
FT                   SGRTGQRLVLVLKRDAVPKVVLNNLYKHSQLQQTFGANMLALVDGVPRTLSLDAFIRHW
FT                   VSHQLDVIARRTAYLKREAEERDHILQGYLKALDMIDEVIHLIRSSQTVEIARTGLMDL
FT                   LGVDDVQADAILAMQLRRLAALERQKILDEHDELMRRIADYADILAKPERQRKIVGDEL
FT                   DEIVARYGDDRRTKILPFSGEMNVEDLIAEENVVVTVTHAGFIKRTKADEYRAQHRGGK
FT                   GIKGAKLRDDDVVDHFFLTSTHNWLLFFTNKGRVYRCKAYELPEGSRDSKGQHVANLLQ
FT                   FTPDESIQTVLSIPDYEVADYLVLATRSGKVKKTRLSEYDSPRQGGLIAVRLMQDESGE
FT                   TADELIGAALCNATDDIILVSKLGMSLKFRADDEQLRPMGRQTAGVQGMKFRAGDELLA
FT                   MDVIWGETDKDLLVVTNQGFAKRTAISEYRLQGRNGFGVKAVQLTDERGTLVGAVVVSE
FT                   EDQIMAIMKSGKVIRSNVSEVKLTGRTTQGVTLAKPDAGDEIISIARNAETEDEADGDT
FT                   VVTESSAEATATQPAQGEPVFEVKSENGMPMIEEESAAIDKTKEESREE"
FT   gene            10851..11387
FT                   /locus_tag="Balac_0007"
FT   CDS_pept        10851..11387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45405"
FT                   /protein_id="ACS45405.1"
FT                   /translation="MSNTNPLEPGQQPRAAASSAADNAPRVARSASNTPLIADRDRPEE
FT                   NRPVRPIRNRKKPHARRMNLSLTRVSAWSVAKVSFMLSLAGAIIQIIAVLFLWLLLKAV
FT                   GVFDQVTQIFSSAGLDSGSINLSNILSLPTVLSAVTIFSIVEMVIITILCTIFALLYNV
FT                   VSALVGGVHVTLGDD"
FT   gene            11591..12664
FT                   /locus_tag="Balac_0008"
FT   CDS_pept        11591..12664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0008"
FT                   /product="hypothetical protein"
FT                   /note="COG4767 Glycopeptide antibiotics resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45406"
FT                   /protein_id="ACS45406.1"
FT                   /translation="MLWPFVSLLLTLPIVAFVYHRNHRLSFTSAFSAYVAVLYALGLVA
FT                   FTMYPMPDDPTLFCATHNLAPQLDILRFIQDAQTGLYGVLQLVMNVVLFMPLGFMLCRW
FT                   AGWRFWVTSAFALGCSIFIETSQLTGIWGIYPCAYRQFDVDDMLTNTLGAMLGYACALL
FT                   YTKLVPKKAKQLTGTNTRPGFVHRMVSMCIDFLLIALVYVPLSILYIFLFYLVFKSTGD
FT                   GHYVWLSLTVEPRVLDYMTWITAALSFLLFEVWIPWRHHGQTLGCRYTHMTIETRDRSR
FT                   GQRIAFYAIRTLFFGVIFGGLATNHPIWGWTLLALLIFWLVKKCMPWDLVPGTDPQTPP
FT                   TSPQPQVSTLPEPNLQR"
FT   gene            complement(12745..13539)
FT                   /locus_tag="Balac_0009"
FT   CDS_pept        complement(12745..13539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0009"
FT                   /product="Putative hemolysin III-like membrane protein"
FT                   /note="COG1272 Predicted membrane protein, hemolysin III
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45407"
FT                   /protein_id="ACS45407.1"
FT                   /translation="MKRNNRHIGQVTRSQKPRKVVTAKKLRAQSKRNEQYRTKMQLRQI
FT                   LLEKPKLRGWLHLIAFPFSVATSVILICLAPSGWMKVAISVYSATIILLFGNSAALHLG
FT                   HGYFPKAVDDVLCRIDYSNIFLVIAGTCTPFFFALNNTVICWVYVGVVWVTALLGTFVH
FT                   LIYPVGLDWLFTIVYIVLGLAPITIIWLFWKSPYIGPVPTILVIAGGACYIAGAVCFAL
FT                   RKPNPFPKWFGFHELFHLGTIGGYVCHVIALFMVVLRMRALM"
FT   gene            complement(14018..15364)
FT                   /locus_tag="Balac_0010"
FT   CDS_pept        complement(14018..15364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0010"
FT                   /product="glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /note="COG0334 Glutamate dehydrogenase/leucine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45408"
FT                   /protein_id="ACS45408.1"
FT                   /translation="MLTDEYVKRVYAQVEARDPDQSEFLQAVQEVFESIEPVFAKHPEY
FT                   EAAGVLQRFVEPERLVKFRVAWADDNGDVQVNRGYRVQFNSAIGPYKGGLRFHPTVTES
FT                   VIKFLGFEQILKNSLTGLPMGGGKGGSDFDPKGRSDAEVMRFCQAFMTELQRHIGQFTD
FT                   VPAGDINVGAREVGYLFGQYKRLRNEFAGVLTGKGLEFGGSLARTEATGYGLCYYTQEA
FT                   LRVLRDDSFEGKTVVVSGSGNVAIFAIEKATQLGAKVVTCSDSNGYVYDPNGIDLDVVK
FT                   DIKLNKRGRIREYADRVDGAEYHEGCREVWTVPCDIALPCATQNEIDGESAQKLVDNGC
FT                   TVVCEGANMPSTPQAIEVYQKNHVLYGPAKAANAGGVAVSGLEMSQNSYRLSWSFEKVD
FT                   EELKGIMKNIVAESLDAAKEYGHDGDLMFGANVAGFTKVANAMVAQGIF"
FT   gene            complement(15477..16799)
FT                   /locus_tag="Balac_0011"
FT   CDS_pept        complement(15477..16799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0011"
FT                   /product="multidrug transport protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45409"
FT                   /protein_id="ACS45409.1"
FT                   /translation="MTAGNNTHRKTSSATDSATDSTQRQSNPSGYTTSAGERAAGKARE
FT                   RLITRDVALIMAATFFYMTSSMMGTPIIAGFSQSLGASGALMGFLAGALSLSALICRPI
FT                   AGNLSDRTSKRKLAVIGALIFLASNLGYYFVPNTAWLLAARILNGVGFACISVCLSTWL
FT                   SMLLPISRMGAGMGLYGTMNALAQAVGPDLGIRASKAIGYRNTFLIAVGLTCCIVICVL
FT                   LIKDGGKPPRARLGRQQGGERHHIRLDSLFEPRVIPIALIFMLFAIPYFANQSFIVDYA
FT                   NARHAHVIVSLFFPCYAITLLISRIVLRNWFDTKSFLFFMVTGTICQIVMLASLTVMRN
FT                   NWFVMLAGLATVGAYGMMSSVTQARAVLIAGKARSGMANTTYYAGIDLGMFLGPLIGGF
FT                   LYGGLPIIWFYPALLLTMPVAWIVYAFAHRTIQSSERAPRI"
FT   gene            16847..16990
FT                   /locus_tag="Balac_0012"
FT   CDS_pept        16847..16990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45410"
FT                   /protein_id="ACS45410.1"
FT                   /translation="MCGARKANGSDHKLVIQMNANGVTFEAYPSLKGKDAQVRQAGRVE
FT                   RG"
FT   gene            16983..18170
FT                   /locus_tag="Balac_0013"
FT   CDS_pept        16983..18170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0013"
FT                   /product="mannan endo-1,4-beta-mannosidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45411"
FT                   /protein_id="ACS45411.1"
FT                   /translation="MASWDKDSAGKLPNQKLLSKVGSFAIYVNDNDNELQNNAGRPRTG
FT                   DLVFDSIKLVGERDPYVPEEKSSEPSNAKLITIDDFESYADEAAMKEAWGNREHTDVLS
FT                   LTTEDDDNKYLQYSNPHGGWLDVATFIQNDTARNNWTGLGKLTFRLKHDGSNNAMDLQI
FT                   GTADGKYFHVDQKLASEDGADWKTVEIDLVNNPSLTQSWPEDENKGKTMTADDLALFKE
FT                   VVIAGNTWNKDSPAVNFAVDDLKVVPSGDASDSKPETKPEEPSEPTEPTEPEETPDYSA
FT                   DMAAGDPATCPIDFTQQDTEDPSDPSDPDQPTDTDKPAGTDKPADANKPAAGDNAQSGD
FT                   NAQSGDNAQQSNAKADENKSVVNTGSSIAVVAAIAVALVLAGAATLVWARQRHQQ"
FT   gene            18418..18918
FT                   /locus_tag="Balac_0014"
FT   CDS_pept        18418..18918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0014"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /note="COG1970 Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45412"
FT                   /protein_id="ACS45412.1"
FT                   /translation="MIDGFKKFIARGNMVDMAVGVVMGAAVTAVVNSVVDGIINPLVAA
FT                   IFGKPDLSKTWNWTITNWAGENSVISFGSVLNALLNFLLIALAVYFCIVVPINNLRDMT
FT                   EKAMAKVKGDDSDVAAEEPDLSPEEQTVILLQDIRNALAAQQPAGAHAAPVATDTTAAP
FT                   ESK"
FT   gene            19174..19449
FT                   /locus_tag="Balac_0015"
FT   CDS_pept        19174..19449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0015"
FT                   /product="hypothetical protein"
FT                   /note="COG2308 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45413"
FT                   /protein_id="ACS45413.1"
FT                   /translation="MICGLLCGSFRKICRGEDNLRIPSGASSPLFECDIERRTTPRLFR
FT                   DVRVRYKTVFFLIMVGLLCGDAVIDHTAENYGRLLTQMYGNRPYLP"
FT   gene            complement(19649..19721)
FT                   /locus_tag="Balac_0016"
FT   tRNA            complement(19649..19721)
FT                   /locus_tag="Balac_0016"
FT                   /product="tRNA-Ala"
FT   gene            complement(19753..19826)
FT                   /locus_tag="Balac_0017"
FT   tRNA            complement(19753..19826)
FT                   /locus_tag="Balac_0017"
FT                   /product="tRNA-Ile"
FT   gene            19968..20732
FT                   /locus_tag="Balac_0018"
FT   CDS_pept        19968..20732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0018"
FT                   /product="hypothetical protein"
FT                   /note="COG1451 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45414"
FT                   /protein_id="ACS45414.1"
FT                   /translation="MVMPFNSVPRARSISRRAQFDRSTRAREVLNVDGLQVNVLRKKNR
FT                   NMYLRVKPPYGAIEVTAPVRMPQHTIVEFVRERRSWVDEALHKMAQARSRTFASPDLDP
FT                   DVGGSRTTVLRDARDPGSPRMETPHETSSFTWNEEYVERARRSIEQQLPDLLSKWTPIV
FT                   GKSPTKITLRTMTSRWGSCTPKTGRIRLNLQLGLMDPQFLEYVLVHELTHLWESGHGRT
FT                   FQERMSLVLPNWKELRRELNRCTIFDVPQSRG"
FT   gene            complement(20757..21182)
FT                   /locus_tag="Balac_0019"
FT   CDS_pept        complement(20757..21182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0019"
FT                   /product="membrane-anchored glycerophosphoryl
FT                   diesterphosphodiesterase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45415"
FT                   /protein_id="ACS45415.1"
FT                   /translation="MAEATKHTITVDLDMFDKTPEEKTAHANEIAREFGVGEDALAAVE
FT                   DFKKELTKHNAWDLPFMGYVNEDGYGYAYVPNAAITTTPYWDAHAAFLALPKDAQTAFA
FT                   IRMLFTHRPVDRYGADMFLHYQRGISTNFIGTGANKY"
FT   gene            complement(21820..22608)
FT                   /locus_tag="Balac_0020"
FT   CDS_pept        complement(21820..22608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0020"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG2865 Predicted transcriptional regulator
FT                   containing an HTH domain and an uncharacterized domain
FT                   shared with the mammalian protein Schlafen"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45416"
FT                   /protein_id="ACS45416.1"
FT                   /translation="MFRNDPVNIDVYSDRVEISSPGNLWGGKTLQNLTNGVSRCRNTTL
FT                   MQLLQKTPLIRGDHDGSAVEGQGSGIQFMINRMKELSLAQPDFHPTFDRFRVILYRGGA
FT                   EIAANQQWVRSHVGHDLPGRESSVLYTVRALGRASVYDIRDRLGYDSDDIRAILATLVE
FT                   SGLIRQVATDIYEPPETPAITNASDAPAPPAAAPSSRQAIIDTIPTFGTISARDIAEAT
FT                   GKSLQTVHRILRELVDEGVITAIGKKQSRLRTYTRKQTID"
FT   gene            22644..22898
FT                   /locus_tag="Balac_0021"
FT   CDS_pept        22644..22898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45417"
FT                   /protein_id="ACS45417.1"
FT                   /translation="MPRVVPQLESPVHRAFRSPREGIGTQIAQDGFDRVIDHFLQSTMA
FT                   LHAIEEADFVILRFADARMNSDIHIQPREELLWIYACDE"
FT   gene            23538..26039
FT                   /locus_tag="Balac_0022"
FT   CDS_pept        23538..26039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0022"
FT                   /product="ABC transporter related protein"
FT                   /note="COG0178 Excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45418"
FT                   /protein_id="ACS45418.1"
FT                   /translation="MAQTIDITGARVHNLKRVDVRVPIGKMVAVAGVSGSGKSSLALGV
FT                   LYAEGSRRYLEGLSTYTRRRISQSGEAKLDAIEHVPPALALHQRPSVPGIRSTFGTMSE
FT                   LLNSLRLMTSRLGNYTCPNGHMLDPTPNVALERPIICPVCGEEVQALGAEDLAFNSGGA
FT                   CPTCSGTGIVRTVNQATLIADPNLTIEQGAVAPWRSLMWSIMVDVCREMGVRTDVPYKD
FT                   LTAHEKEIVLHGPAEKRHIIYHSKKENRAGELDFTYFSAERTVLNALDKAKDAKALKRV
FT                   EPFITEEPCPDCHGTRLNKRARILPVDGKTLPEQCAMQLDNLAQWVRTVPATMPDDMHE
FT                   MAQSIVDEFTRTARRLLELGLGYLTLDRAGSTLSTGERQRIQLARAVRSELTGAMYVLD
FT                   EPSIGLHPANVDGLLGVMRDLKAQGNTVVVVDHDTRVLRDTDWIIEMGPGAGSHGGTVI
FT                   AQGTVSDIEGNPHSLIAPFLASERLQIVRPQTPANKVFDEGALEIKTAPLHTVHALDAR
FT                   VPKHRLTVVTGVSGSGKTTLVLESLVPALTAKIAGERLPEHVRALDAPGIDRVTMIDAT
FT                   PIGANVRSTVATYSGVLDDLRRLYARTDAAKARGLKAGAFSYNTGSLRCPTCDGTGQIT
FT                   LDVQFLPDVDIDCPDCHGTRYGDVAGEITWTPKNGHKPVSLPDLLAMTVDEALDIFTGT
FT                   GQRRLHAELETLHELGIGYLTLGESTPALSGGEAQRLKLASEMGRAQDGTLFVFDEPTI
FT                   GLHPLDVRTLIGVFQKLIDHGASVVVIEHDLDMIANADWIIDMGPGGGENGGEIVATGT
FT                   PVQIAENPLSVTGRYLKPCVE"
FT   gene            26398..27153
FT                   /locus_tag="Balac_0023"
FT   CDS_pept        26398..27153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0023"
FT                   /product="methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45419"
FT                   /protein_id="ACS45419.1"
FT                   /translation="MDYQSENAQTIDRWVDEGWQWGVPISHDAFVDAQHGSWNILLTPT
FT                   KPVPHEWVGDVRGKRVLGLASGGAQQMPVMAALGAQCTVLDYSSRQCEREYEVADREGY
FT                   DIEVIQADMTQPLPFADESFDLIINPVSNCYIEQVKPVFRECYRVLKPGGSLIGGYDNG
FT                   INYIFDNEETTLTYALPFNPLHDERARQLLLDEDAGMQFSHTLDEQIGGQLEAGFTLRA
FT                   LYEDTNGEGNLHEHHVPTFVATWSVKPAR"
FT   gene            27202..28116
FT                   /locus_tag="Balac_0024"
FT   CDS_pept        27202..28116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45420"
FT                   /protein_id="ACS45420.1"
FT                   /translation="MAEYSGSSGYAEYEYLGTANGTSFAKRHPYLLWQIIGWSILLADA
FT                   VFFVVAALQDFGEWCYPVIVFPFIAALFAVIGSPFLIYFSRKAKIPQAASKREASVVRS
FT                   HITMISQIRGESHPVLMALLIIALALGLLVLTLQLGMRGYILPGFLAMVAMVVVPFVVY
FT                   AQYSAAQRKRFMAVPDAAYLVGVHYADQSRYESVELRETDALMMPVPAKPSTAMLDFVY
FT                   NWLREYLATDWLTVTVLSFDDLLRSGVVVNDSDTEDTDPTASFPLIPARQFNLDGDARA
FT                   QLDEESKAIGAFWLSRWRGYTQM"
FT   gene            28439..29038
FT                   /locus_tag="Balac_0025"
FT   CDS_pept        28439..29038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0025"
FT                   /product="oxidoreductase"
FT                   /note="COG0431 Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45421"
FT                   /protein_id="ACS45421.1"
FT                   /translation="MAQLTNEERIEVNDGREMKVLMIVGSLRKNSFNKQLAAMAEQELG
FT                   DRASVSVLDWSEVPVFNQDEEFPTPKSVAEARVAVNEADAIWIFTPEYNHSVPGSLKNL
FT                   FDWLSRPLEDGTPSVLTGKVMTMSGVGGLNTLRYAFAAWMPSLTLFKMRIVPVPFTGVT
FT                   LNREMFSTDKLELNAAMRTSLKYQADATLQAIAEAE"
FT   gene            29241..29954
FT                   /locus_tag="Balac_0026"
FT   CDS_pept        29241..29954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45422"
FT                   /protein_id="ACS45422.1"
FT                   /translation="MHAPYLLAACVLMCGFIDKTFIYIIKLADFYLLEKVIAMRQWRGI
FT                   VSVIAAMAMIGGFAGCGQSQEQAGFSKSPQSSQTATGGASGEIGNMESEHHILPSSDVE
FT                   ELELRLESIGESTATGNLTLLGELHPTASYTERDGGRGMPSLQNQDELTFSDCKSYMLS
FT                   VLCMGEGSVSIEWTLGTQSEQRNLECAPKIAETALGMSNVNAKSSTVKIVAEEGSKAEI
FT                   AYRLDEIGKPGVVVD"
FT   gene            30678..30914
FT                   /locus_tag="Balac_0027"
FT   CDS_pept        30678..30914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0027"
FT                   /product="hypothetical protein"
FT                   /note="COG1198 Primosomal protein N (replication factor Y -
FT                   superfamily II helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45423"
FT                   /protein_id="ACS45423.1"
FT                   /translation="MANMGDYADMDAENVESAEVVCPRCGSRHVAQILHGMPAFTEELQ
FT                   RELAEGKVVLGGCDIDIFHPTPSYHCNDCEEEF"
FT   gene            31096..31371
FT                   /locus_tag="Balac_0028"
FT   CDS_pept        31096..31371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45424"
FT                   /protein_id="ACS45424.1"
FT                   /translation="MGIQEALRKAAEMQSHLQIISVVEYGPYWIFSYCEPGLTPEECPG
FT                   MPMLKMRRTDGFSTYLHVQDKDFLDIVKHATKVDLPEHTLPYSPTS"
FT   gene            31555..31824
FT                   /locus_tag="Balac_0029"
FT   CDS_pept        31555..31824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45425"
FT                   /protein_id="ACS45425.1"
FT                   /translation="MALFMLNHHVLAEVAYDSGARTYAVDFPDRQPWLPSGFSFQVCTA
FT                   YTQVVSCEDSADTTIPADEKIRQMLNEQIEIWHRDWQCTGETWE"
FT   gene            complement(31962..32285)
FT                   /locus_tag="Balac_0030"
FT   CDS_pept        complement(31962..32285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0030"
FT                   /product="MazG nucleotide pyrophosphohydrolase domain
FT                   protein"
FT                   /note="COG1694 Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45426"
FT                   /protein_id="ACS45426.1"
FT                   /translation="MISDDTLRMIHQFSADRDWQQFHAPANMAKSVSIEAGELLECFQW
FT                   SDEPRDGDWEHVYEELADVMIYCIQMADVLDVDLDEIIRSKMAKNAKKYPVEASRGSSA
FT                   KAE"
FT   gene            32313..32663
FT                   /locus_tag="Balac_0031"
FT   CDS_pept        32313..32663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45427"
FT                   /protein_id="ACS45427.1"
FT                   /translation="MRSMSMPTTSSRSTYIVHIPACPGELDEETLHSIIESQLKQSIPA
FT                   DSVVEQHAREYLEQYPVVYIVHAEDVKQRKDSSETRYIVYVGETNDIVSPTRQHLIGDA
FT                   KNEIPTYALKEV"
FT   gene            32673..33755
FT                   /locus_tag="Balac_0032"
FT   CDS_pept        32673..33755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45428"
FT                   /protein_id="ACS45428.1"
FT                   /translation="MAGKEKIDVRILRYTENGQKRYMAASCLLVLILSIVNAYVHEIEY
FT                   MLRKKEYNYSWSELYNYFIDFYPNVNSPFSLLLELFSFLSTLAIALAVVVEGEGKMLIL
FT                   SKFSYWLCVGSCSVLAVMSRALFSGLGVIKAIAVIVSSIIILYYLGRFSIVIGQKNFIN
FT                   ARMAFDKSVSLIYLKLYERYGGERSAARSLVKVFVLLSILLIMAIGPWVLLITDALSAT
FT                   RYDNGNILSVLLVFLFIYCLTFVALLKNEEHGMNGLLLVTSCFVPLLPLLFYVFHSIHN
FT                   SIHYVIIFFIALSLSFWSLFCVACSRMSSGELSEKLRKRRPWILVAEIESIHSIKARLY
FT                   MKIHLKYIDRVEYMNGLGGS"
FT   gene            33890..34099
FT                   /locus_tag="Balac_0033"
FT   CDS_pept        33890..34099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45429"
FT                   /protein_id="ACS45429.1"
FT                   /translation="MFLSGAKRAFWCRYVLSSKYSKISKVLTNYLVFLFCWDCILIVGV
FT                   RVVIGVGWFCLYAYVAYSSMVMLV"
FT   gene            34600..35961
FT                   /locus_tag="Balac_0034"
FT   CDS_pept        34600..35961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0034"
FT                   /product="site-specific DNA-methyltransferase"
FT                   /note="COG0270 Site-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45430"
FT                   /protein_id="ACS45430.1"
FT                   /translation="MSENALLNTKETAQYIGVSAGVVTRLANTGELEFDTCGARKVFRK
FT                   EAIDAYLERNNLIQAAVDQVSTKDFEDNICALSFFSGAGGLDLGFERAGISAALYCENN
FT                   RECRMTLHRNRPDVALLGDITKISADEVRRMARIPQGREIDVMFGGPPCQAFSTAGARR
FT                   AFEDPRGNVFLRYLDLASELKPRYLVIENVRGLLSTPFPVESGGKPIRGGVMRYILNKL
FT                   EEMGYGVSFNLYNAANFGAAQIRERVVIIAKRDGTKCDWLIPTHTDPDGKYVQNWNLPS
FT                   WVTFRDVVYDIEDSRQTHTDFPEKRLLYFSMLKEGQCWNKLPIEIQEEAMGKAYKLGGG
FT                   KTGFYRRIAWDRPSPTLVTSPTMPATDLCHPKELRPLSVEEYKRVQGFPDDWWIAGSIH
FT                   DQYRQIGNAVPVSLGEAIGRAILDDMRGEAHDERWRNFPYSRYAHTSDQNWNLA"
FT   gene            complement(36056..36901)
FT                   /locus_tag="Balac_0035"
FT   CDS_pept        complement(36056..36901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45431"
FT                   /protein_id="ACS45431.1"
FT                   /translation="MRIYDSAAEEEARRESARSILNAYIQSRIAFYDGTGSSSMTYERL
FT                   LGKDFAIYALRGIETAEDYAREAFHAVESSSEETAMGTRWQELIASIAENAIDTGDLTA
FT                   TRDGAVYVIELKSQENTTNSSSFPNELRSLRQRMKEITGRKRASNQRVEAAICITRSTI
FT                   SKDEWRTFEVSGVTQENADLKNFRYRYLSGTAMWQWLCGIDSPYGLIRPFSSINSEAVL
FT                   LARESSLERVTTQLLEELDKNGLPHTLDGVAELSDRYKAEKEAKRREREAKRNARNTGR
FT                   "
FT   gene            37469..39892
FT                   /locus_tag="Balac_0036"
FT   CDS_pept        37469..39892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45432"
FT                   /protein_id="ACS45432.1"
FT                   /translation="MGSGELQTWNGHFDRGVYIDYTLEPLQSERHIEGTKDEASQSGSR
FT                   IDEDTTIEIEDIEEENNSDQDESHRVDYMLAAGCGIISGAIDSLWVGKFDFDRAREWGS
FT                   ERVNEFVMAVAKMDPEYKGDDVKSAIRFLEKKYPFVGDRATSEFGGGRQHHLRDFSHHM
FT                   SLGGLAFSLLTQFTGKVYGTDQHGVFMVVPVADEELIGKTIEEKLMLGAVRWFFHMVSD
FT                   MAGSSGSAGKGTGIPGPILSLMKQLSALPLFKDAMTDEALFRKMLSKLFNGTLLKTVDE
FT                   EGKKIYRRFDLRAELGIAHELARQSVPVLVNECLVCVCYAARRLYTMCSNGEVHDFKSL
FT                   LSVGLDALLPHGSPLGTRMVTIATGVFSVVDMTDGAIRTLMRSGGKLNPGMVSDFLLHV
FT                   NVVGVVRFVFAVHTDYKVHAKAKRETRLQAKFHGRGNGYGDDASVMRFFELDMAQANMV
FT                   VSIEYQAARLDIEQTKNKKTREEKEREFSDWENDNCSEFILRDKEALVNEIHRIQRYAT
FT                   PVWQKLVALEASQFMPYQSKKLKYDAATLDMVCSDLPGFEDKECTKYRKAVIKETSAIK
FT                   GVKKAVLAGCVGIGVVAVATGGAAYVFAPAIAPILAGPSVAGLSGAALTSASLAAVGGG
FT                   SLAAGGLGMSGGVALIAGGGALLGAVTGGGAATLGTWVLANQDAYVLNTCAKLIVFCRD
FT                   VLMEIDGGVELVRQVRQSVCEQLRETEPQLDFLGQLKQFIKQSGSRDADSDPSAKRERS
FT                   EALKGIDKSEKNMKRSVKYMRKCVKELGKVTGITDENRGASGAQWKPVAQIEKG"
FT   gene            complement(39920..40501)
FT                   /locus_tag="Balac_0037"
FT   CDS_pept        complement(39920..40501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45433"
FT                   /protein_id="ACS45433.1"
FT                   /translation="MVRRLVDVMAHDLGVPRRASDDPDGEALACRCTFTALRFWMQAYC
FT                   IDDGYGGAAGIAQTAVEQKSLAWIKQMSALYPQLRSKFTPALIHQYCSALTAIGDLAET
FT                   SEGMLRCTKPHDLRIPYSGGTFVIAQLGLRDLTVQDWEGCVLSDAVVFAGVSKHNGIVG
FT                   FDPDMIGWELPYRDELLFLAKWQEASNALR"
FT   gene            complement(40482..42617)
FT                   /locus_tag="Balac_0038"
FT   CDS_pept        complement(40482..42617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45434"
FT                   /protein_id="ACS45434.1"
FT                   /translation="MSQQFNESRQSWGLFVWNDNGDGQFIRIIDYVTDSAGNGCYDWVA
FT                   YPRWWERSRNPSSDDPLDPKTLYNPKLTQIMVKSDSDFKFLQWTPNYNRPDHPFVEIFQ
FT                   GGLRTTEPPLYEVIDCPANRAEELPDVLSQGIQYSGRPTAKILLLFAENNNMLDAAVLD
FT                   RSMTTIHNGLLTLSNTAPNSVPRVILDRRHVRIINQGFNRGDRLVYNLPTQLKSHSQVV
FT                   IKPMRDLAQLYVNWYIRKEHAMNGDELMRTAGDVLEQAFEKPANLEEYLGAKPSHNDVR
FT                   ALQTAIKATIRSNTDDVSEIIYDVLKNDDDVMAEFRKQATAQLDDEFEKHKQVLCKQLD
FT                   ELRAQRDEESEKAEQATAQLAELNQQLQRKRGEIRDAQAELELQKEEQHKALQDLENNV
FT                   ALKLGLQQIAQQNHSMMEELTIRHSTAPDSSRQLRMAPMMGPAKTQAATDMQQAVAQNM
FT                   QILGCTFTGQSNRNNERITHFAAHLCRTLRTTRLLAVDTVHVPTIANTLAFALAGTPAQ
FT                   HTGIPIDFSDFTMLEEFLEHSESPVIVLDNVFDTVNESLLFALNRYSPAKSVVILPIGS
FT                   FANIRLLAPEVWNKVFYVPTTGMVELSASDKPLHHAQEALKRIDITSRSILAQMDILRR
FT                   MTSIPQNALVTPSAITAIAQDTASARQWIMPHLCIETYEYQGAEKAHELSQEPTNKTIA
FT                   AQLAALIDRIDHGSQAR"
FT   gene            42959..43327
FT                   /locus_tag="Balac_0039"
FT   CDS_pept        42959..43327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45435"
FT                   /protein_id="ACS45435.1"
FT                   /translation="MWGKTKQTNTSWIEMITVETRKINVIVYGIFVAGCKWCLVYLLTI
FT                   REQGFVYAVRTQLGRPNGNGVEIKTGESETVICKPEISLCTIQRIPQRDDAHHEKIAVR
FT                   RVDFADGNGYVETALKST"
FT   gene            43526..43639
FT                   /locus_tag="Balac_0040"
FT   CDS_pept        43526..43639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45436"
FT                   /protein_id="ACS45436.1"
FT                   /translation="MNGVFAVGHKIGKIVGDPVYSECSAIFAQFGDEIMPE"
FT   gene            44261..44464
FT                   /locus_tag="Balac_0041"
FT   CDS_pept        44261..44464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45437"
FT                   /protein_id="ACS45437.1"
FT                   /translation="MRNLDEVIAAQGEDYAQFDQQAKQSVAACASLAMSIKSVLDTPIL
FT                   DESGALTDESGTLMRGFDGNPE"
FT   gene            complement(44728..44958)
FT                   /locus_tag="Balac_0042"
FT   CDS_pept        complement(44728..44958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0042"
FT                   /product="hypothetical protein"
FT                   /note="COG3041 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45438"
FT                   /protein_id="ACS45438.1"
FT                   /translation="MGPSKLKEVIELVIENSPASIAVLKQRHNMHTLAGKWQGRNECHV
FT                   ANAGDGPVIWSCNGKVAFFEHTGSHDELFGT"
FT   gene            complement(45029..45178)
FT                   /locus_tag="Balac_0043"
FT   CDS_pept        complement(45029..45178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45439"
FT                   /protein_id="ACS45439.1"
FT                   /translation="MFASCNAHNAHEEPNTESMQAIAEGDAFLASGQEGRFSNAESLIK
FT                   AALN"
FT   gene            45214..45474
FT                   /locus_tag="Balac_0044"
FT   CDS_pept        45214..45474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0044"
FT                   /product="hypothetical protein"
FT                   /note="COG2336 Growth regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45440"
FT                   /protein_id="ACS45440.1"
FT                   /translation="MTMLTLSKWGNAQAVRLPKAMREQVGMPDDSQIEATVENGAIVLK
FT                   PARSAKRAIRVANLASVFKDRKEPYRACEDDFGAPAGNEGL"
FT   gene            45476..45859
FT                   /locus_tag="Balac_0045"
FT   CDS_pept        45476..45859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0045"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="COG2337 Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45441"
FT                   /protein_id="ACS45441.1"
FT                   /translation="MCHYGDVLMVDLDPSKGHEQRKRRPVVVVSNDAFNRNCTLTVVAA
FT                   ISHGRGDFELHIPFSPVPASDVSNGGSGVADGFVQLEQIRALDLSARNAVKIGSLRQKD
FT                   MDTVTSMLLGCFIQPDMMVLPSY"
FT   gene            complement(46047..46937)
FT                   /locus_tag="Balac_0046"
FT   CDS_pept        complement(46047..46937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0046"
FT                   /product="transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45442"
FT                   /protein_id="ACS45442.1"
FT                   /translation="MTELEALRELVAFREYGTLSAAADELRITQPTMTRTMRKLERELG
FT                   VPLFDRRAKNRLSLTHTGELAAQEAEQLLDAYDRFVETVRNDANLHNEIVVGSVAPGPL
FT                   HFLEQAGERNAKWESSITVRHSLIEPDAVLDDLLLRKETMIITDREVDDPRVESLYLGE
FT                   EYLGVAIDNFNPLAQRTSVTFADLAGMDFVVAHDIGPWRAVIEEQIPGAHFLYQQDLSA
FT                   LEQISKYSAFPFFYSNLTRSLRMTDERFMPHTRTAVSIADPANRIDFYATFLGDNRRLA
FT                   LPIQQYLAQHRPREQ"
FT   gene            47066..47329
FT                   /locus_tag="Balac_0047"
FT   CDS_pept        47066..47329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0047"
FT                   /product="aldo/keto reductase"
FT                   /note="COG0656 Aldo/keto reductases, related to
FT                   diketogulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45443"
FT                   /protein_id="ACS45443.1"
FT                   /translation="MIGELMQYVTLNDGNKMPQLGFGVFQVPDLAVCEQAVSDALETGY
FT                   RLIDTAAAYANEEAVGAAIAKSSVPREDIFRDLQAVGRPLHV"
FT   gene            47292..47942
FT                   /locus_tag="Balac_0048"
FT   CDS_pept        47292..47942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0048"
FT                   /product="aldo/keto reductase"
FT                   /note="COG0656 Aldo/keto reductases, related to
FT                   diketogulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45444"
FT                   /protein_id="ACS45444.1"
FT                   /translation="MTSKLWVDHFTYEKAKQGIDDSLRKLGLDYLDLYLLHQPYGDVAG
FT                   AWRALEEAQQAGKIRSIGVSNFAPDQLINLELMSNVKPAVNQIEVSPWYQEKDEVRFAQ
FT                   EQDVQVEAWAPFAEGKHHIFTDPTIAAIGEKYGKTNGQVILRWLLQRGIVAIPKSVHKE
FT                   RMAENFDVFDFELSDEDMATMASLDKHESQFFDHRDPTAIVSIFGQSLRALRS"
FT   gene            complement(48034..50283)
FT                   /locus_tag="Balac_0049"
FT   CDS_pept        complement(48034..50283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0049"
FT                   /product="putative beta-glucosidase"
FT                   /note="COG1472 Beta-glucosidase-related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45445"
FT                   /protein_id="ACS45445.1"
FT                   /translation="MPHASQQNTTPAHELPLEKRAALTSGADAWHLNGLSESTSYMITD
FT                   GPHGLRKAAQSTSMDIEHSMPATCFPPAAGMASSWNPGLVREVGVAIGEECVQEKVAVL
FT                   LGPGVNIKRNPLGGRSFEFWSEDPYFAGHEAIGIVEGVQSTGVGTSLKHFAANNQETDR
FT                   MRIDARVSERALREVYLPAFEHIVTKAHPWTVMCAYNQLNGTPCSQNSWLLTKVLRDEW
FT                   GFDGVVISDWGAVHDRVEALKAGLNLEMPPTNTDEQVVVAVRDGLLDEDQLDRMAQGML
FT                   DLIEKAAPAMQQDDHPYDLVNHGAIARRAAQESMVLLKNDGGILPLAADGSVSIAVIGE
FT                   FARTPRYQGGGSSKLTPTYVSSFLGSLHIRDIPVDFSPGFTLDDAKQDAALTAHAIDMA
FT                   WRNDVVLFFAGLPEEAESEGFDRETIDLPQKQLRLLADIVKVNPNVVVVLSNGSAVSVT
FT                   PWRDSVRGLLEGWLLGQEGGNALADVIFGDVSPSSKLAQTIPMSVLDDPSMPNWPGEAG
FT                   HVDYGEGVFVGYRYYDTFGRQVAYPFGYGMTYSTFEIRNLSAIPHDNTVQVSAIVTNTG
FT                   QVRASEVVQLYVAPCACDAARPAHELKGFEKITLDPGEASIVTFELDSRSFAYWSEPRN
FT                   DWHVERGTYTIEIGSSSRDIAERVQVELPGDGIRLPLTLSSTFDEWSDDPIGGPILQAA
FT                   INRLSQQEGHPIIPESDMLRMLLGSMPMNATNVLLGSAAGRLCERIMGLYNASNQ"
FT   misc_feature    complement(50497..51309)
FT                   /note="potential frameshift: common BLAST
FT                   hit:gi|116630082|ref|YP_815254.1|
FT                   aminoglycosidephosphotransferase"
FT   gene            51542..51979
FT                   /locus_tag="Balac_0050"
FT   CDS_pept        51542..51979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45446"
FT                   /protein_id="ACS45446.1"
FT                   /translation="MPAPPVQQMRPNAYRLPTNRSLTKFILLGLITFGIYDIVIMTTTA
FT                   EALNTIASPRDGKKTMNYCLMYFLIGWLTLGIGWLVWFHNFSDRIGEEQRRRGMVPTVT
FT                   ASTFWLWEVLGSLIVVGPFIYHYKMLHAMNDLCASYNAYGI"
FT   gene            complement(52309..53442)
FT                   /locus_tag="Balac_0051"
FT   CDS_pept        complement(52309..53442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0051"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="COG3464 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45447"
FT                   /protein_id="ACS45447.1"
FT                   /translation="MRSSWLRTLAHVPYGDDAVHLPVRVRRYECVPCSRSWSDDLEAVG
FT                   AGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGMLLLEQADRFSS
FT                   VRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQVLREWMQARGG
FT                   EFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTKVRCRLQRDATGR
FT                   RGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDAYQRVIHAYRCD
FT                   DRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRHPRSSNGPTEAI
FT                   NGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
FT   gene            53714..55240
FT                   /locus_tag="Balac_0052"
FT   CDS_pept        53714..55240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0052"
FT                   /product="glycoside hydrolase family protein"
FT                   /note="COG5520 O-Glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45448"
FT                   /protein_id="ACS45448.1"
FT                   /translation="MMKALKTTVHYDVTAGRTHTEQTELSVMDEAMNTEHIVESNVVGI
FT                   YPDYTFQMMEGYGCSLTESACYLLSKMDSATRKEALAQWFGPAGMDAWFVRVHIDSCDY
FT                   SLSEYQAVEDPLADPELETFSIDRDRQYILPVLKEAMAMAGHPIHVLLSPWSPPAQWKT
FT                   PPEMTRNDASVYGGEEGDVIDLSKPGRCFGGRLKPEYYSSWARYLVRFISAYMAEGVPV
FT                   TMLSIQNEAAAATSWDSCLWTGDQEREFLKHHLYPAMEEAGLTDAVKIFIWDHNKERAI
FT                   EHIDEFMSDPEAAKEVGGFAYHWYSGDHFEALSMLRGKYPDKVLMHSESCGLHIPGKVT
FT                   MLDMTDEQIEALPDGDYKTMVQTTTPNEMDFNDATAYAHDIIGDLNHGMQRWIDWNMIV
FT                   DRQGGPRHTPGGFAAPIVAEDDGRYTLTISYRYIREIAQAIKPNAVVLGTSTYSRDIEA
FT                   VSARNADGSIGVVLLNQAERDIPVNIRMGGLLVADVPLPARTLSTLVFTE"
FT   gene            complement(55366..57471)
FT                   /locus_tag="Balac_0053"
FT   CDS_pept        complement(55366..57471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0053"
FT                   /product="beta-galactosidase I"
FT                   /note="COG1874 Beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45449"
FT                   /protein_id="ACS45449.1"
FT                   /translation="MARAYTDPILFGAAYYDEYIPRDLDRIDTDMEMMTRAGINVIRIG
FT                   ESTWSTCEPQPGHFDWTHIDRALDAATNAGINVIVGTPTYAVPTWLVAMYPDVLATTPA
FT                   GEPHYGARQIMNIVNPAYRLYGERVIRSLISHVAQQPCVIGYQVDNETKYYDSVSHDMQ
FT                   VMFIKQLRHEFKNDLEALNEAYGLDYWSNRINAWEDFPDLTGSINESLRARFDRFRRDQ
FT                   VAEYLAWQASIIREYMRDDQFITHNFDYEWRGHSYGLQPAVDHFRAARALDICGVDIYH
FT                   PSEDALTGKEIAFGGDMARSAGGGNYLVLETQAQGQHGWLPYPGQLRLQAYSHLASGAD
FT                   GIMYWHWHSIHNSFETYWRGLLSHDFESNPTYEEAGRFGREIGDPRIGDTLSHLSKRNA
FT                   VAILASNESLTALSWFHIETGFPMGGTLTYNDVLRSIYDALFELNVEVDFLPADASADQ
FT                   LAGYSLVIAPALYTTDQQTIDRLARYVKNGGHLLATMRSFVADENVKVWHDKAPHHLVD
FT                   IFGMTYNQFTRPMGVSLKCPDTLADLAGASANDFIEMLSPAPETHVLAWYDHYAWDSYA
FT                   AITRHAFGSGDAQWVGTQLQADAWRTVLAEALSNAGVHTPGMELAGTVCVRSGTNTAGD
FT                   TVTYLLNYSGSPITFRAPASGTFLLGHPTDDGEQAVTAETPVTVGDAVTLPRWGVDIIV
FT                   GRQPTMN"
FT   gene            57881..59035
FT                   /locus_tag="Balac_0054"
FT   CDS_pept        57881..59035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0054"
FT                   /product="glycoside-Pentoside-hexuronide (GPH: cation
FT                   symporter family protein)"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45450"
FT                   /protein_id="ACS45450.1"
FT                   /translation="MFMVAAVLLPQRLRDVMGADAATAAFGVINACTAFISLLSNLVVG
FT                   NLSDHTRSRFGRRTPWVISGGIVGGVSLALVGFLDNVWLIGISYCVCMIGLNMMIAPVI
FT                   ATLSDRVPANMRGTMSAFLAGGTAVGSALGQMLGSRFLSNQIPGFLLSGTLMGLAGICT
FT                   VLVWPKEPSSKHLAKTSNGFGDMLKSFIPPTKGARDFWLAFVGRSLFIFAYYMILNYQL
FT                   YVLEDYVGQSAQQAGNTIAVMSMVSMIVGLVSSLAGGPISDRIGKRKIMIVLASVLMAV
FT                   GFVLPWILHSPLSMILFAGFSGFGYGLYGAVDQALNVDVLPNKEEAGKDLGILNIATTL
FT                   GQMVGPIVTSAVVAATGGYTVVFPVAIGFAAFASLFIMLIKSVR"
FT   gene            complement(59090..59731)
FT                   /locus_tag="Balac_0055"
FT   CDS_pept        complement(59090..59731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0055"
FT                   /product="TetR-type transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45451"
FT                   /protein_id="ACS45451.1"
FT                   /translation="MQPSVEESVNTRTRKSPQQREEEILRATVKLISQRGYNGISLRDV
FT                   ASEVGMTQQGVLHYVGNKAGLAAMVMKEFYDPTSMPGDFLASGLPGSDRDAPHFPAYLR
FT                   YVVRENAKRRDLVQMFAILQAESIDPDHPAHDYFEHRPAIIWQTLSNYQWKLPPQIGTW
FT                   ENFKPLHRMALEAMDGIQLRWLRSDPIDLYDEWIAFERILFPSPVWDNYR"
FT   gene            complement(59884..60366)
FT                   /locus_tag="Balac_0056"
FT   CDS_pept        complement(59884..60366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0056"
FT                   /product="DNA-binding ferritin-like protein for protection
FT                   from oxidative damage"
FT                   /note="COG0783 DNA-binding ferritin-like protein (oxidative
FT                   damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45452"
FT                   /protein_id="ACS45452.1"
FT                   /translation="MALSFIIPGLDEVASEKIIGILQERLSQEQEAALVLKHAHWNVAG
FT                   PNFIAVHEMLDPQVDEVLAMADETAERIAALGGSPSGRPDDIVRYRTWDKFELEGRQNT
FT                   LDYLRALDKYYDSFIKADRTAIKELDDLDVISSNIVQDHVLKLEQFQWFMRSFLID"
FT   gene            complement(60491..61846)
FT                   /locus_tag="Balac_0057"
FT   CDS_pept        complement(60491..61846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0057"
FT                   /product="hemolysin-like protein"
FT                   /note="COG1253 Hemolysins and related proteins containing
FT                   CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45453"
FT                   /protein_id="ACS45453.1"
FT                   /translation="MSLGLNILLIFVFLLLGSVFAGTELALVSLRGSQIDQMEQEDARG
FT                   KRVAKIARDPNTFLSTVQIGVTLSGFLSASFGESSISPFIVPVVEGWGVPSNVAAPLTT
FT                   IVLTLVISYCSIVISEMVPKRIAMQRNEQIARAVVPAISAFAKVCRPIIWLIGKNTNGI
FT                   VRLLGFDPNETESEVSDEELRVLVSSNTNLTKDERTILDDVFDASETIVAEVMRPRADV
FT                   VFLDGDTPLADAAAQVRELPYSRYPVIGKSFDDVLGFVHVRDLLDVRDPNAKTVADVTR
FT                   EGISLPGTSKLLPSLSLLRKRGIHLAVVIDEYGGTDGIVTLEDMTEELVGDIRDEYDLP
FT                   EDTPKDKLPTDVFVDGVATIDGGMTIEDFADLTGIELEDGPYETVAGYFLAHSGKMGEV
FT                   GDHLVVDDAYTMTITKVDGRRIETIEVRKGTANGGTEVSDDQQANDPEHSDK"
FT   gene            complement(62130..62759)
FT                   /locus_tag="Balac_0058"
FT   CDS_pept        complement(62130..62759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0058"
FT                   /product="Carbonic anhydrase"
FT                   /note="COG0288 Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45454"
FT                   /protein_id="ACS45454.1"
FT                   /translation="MLAGNRRFAEGNAEHPWRDKETRESLIDTQNPDAAVLSCSDSRVP
FT                   PEIIFDAGLGDMFTVRTAGEMLDQAVLQTLEYAVSSLHVSLLVVLSHQHCAAVAQAEKE
FT                   LDALTEHLTHEITDAQERERIMEDLDEVIASSSSEFLKNIGISVWQARMAGLDSRDDYE
FT                   QVHIAHTIEQLVTSSEMIRDALAHERLMIVGARYRLDTGLVEVLSF"
FT   gene            62901..64016
FT                   /locus_tag="Balac_0059"
FT   CDS_pept        62901..64016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0059"
FT                   /product="LacI-type transcriptional regulator"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45455"
FT                   /protein_id="ACS45455.1"
FT                   /translation="MAGHRGAKRPSIFEVAKLAGVSHQTVSRVINHSPNVAEATRAKVE
FT                   HAIAELGYHPSNSARSLASNRTRTVGMIAGGQRFYGPVSALASIEATARAHGMFVSVAM
FT                   VHEAECTQQEFDDLCGMFMQQGVDAFIFLTPTDEMFKVACKSQVSQPCVIITSSHGGVS
FT                   VSEGLHMFNARQRRRVSLVGIDQWAGMASVMRLIRKHGHRNVLFFAGPGQWRDASTRLM
FT                   AWNKLCAQNTVNSVTVQCGDDWESADAYRRMNHILDNIGSNGGRLPTCAVCSNDVMAIG
FT                   VIRALLEHGVRVPDDMSVTGFDDMPGMSNLYPPLTTVRQDFDDLGTMAMKEALFLMGEE
FT                   AEPGYPNSQHGVGLVSADLIVRQSVRAAPRR"
FT   gene            complement(64069..64296)
FT                   /locus_tag="Balac_0060"
FT   CDS_pept        complement(64069..64296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45456"
FT                   /protein_id="ACS45456.1"
FT                   /translation="MNINSTARARLYALTAVACAIWLFQNCVEANASGDLLSWSNIILS
FT                   ICLIIVTGYCAVNAVLGWNTKSADTEDPSK"
FT   gene            complement(64454..64624)
FT                   /locus_tag="Balac_0061"
FT   CDS_pept        complement(64454..64624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0061"
FT                   /product="ABC-type xylose transport system permease
FT                   component"
FT                   /note="COG4214 ABC-type xylose transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45457"
FT                   /protein_id="ACS45457.1"
FT                   /translation="MHQRGFAGAVVGALVMGVINQGLSIMGVDTAVVKTIKGLVLLGAV
FT                   AVDILSKRKKS"
FT   gene            64619..65323
FT                   /locus_tag="Balac_0062"
FT   CDS_pept        64619..65323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0062"
FT                   /product="ATP binding protein of ABC transporter for
FT                   pentoses"
FT                   /note="COG1129 ABC-type sugar transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45458"
FT                   /protein_id="ACS45458.1"
FT                   /translation="MHVLAGLEQPDAGSIAVGGETVRLDGVAKAIDLGIAPAFQQPQFC
FT                   ENLDVSANIFLGREMRQGFASRDDEGMYNKAREVLNTLSTSVRAGQSIASLSGGQRQTI
FT                   AIARTLLNDPSLIVLDEPTASLSVTQTAEVLDYIVRLRSDDRSVIMVCHDLPNVFAVAD
FT                   RIVVMRLGEIRAVHNTSETSYEEDIAEIAGVGGSGTTPSRPCERASRARMPIARESHPR
FT                   PSRGGDRDGTMA"
FT   gene            65524..65865
FT                   /locus_tag="Balac_0063"
FT   CDS_pept        65524..65865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45459"
FT                   /protein_id="ACS45459.1"
FT                   /translation="MGAAEIVVTVVTAVACLGMGVFLGSLPFKRDELTEWHMKYQQLGG
FT                   VLACGIVIVLMLLGYDLASWLAIAALAVGVAVSRIPVVRRGLLARFPELHPAERQSPLR
FT                   KGTSKKRRS"
FT   gene            complement(65860..66894)
FT                   /locus_tag="Balac_0064"
FT   CDS_pept        complement(65860..66894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0064"
FT                   /product="RbsR-type transcription regulator/ ribose operon
FT                   repressor"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45460"
FT                   /protein_id="ACS45460.1"
FT                   /translation="MAKGVTIKDVAAEAGVSFKTVSNVINGTGSMRESTRGRVLEAMDK
FT                   LNYTINLSARSLKTGTTGLLGLAIFDFSQPFASYLADQIIVCAREHHYGVIINTYGQNE
FT                   HGLARAMRQANNLAADGWIVFADHAMGQHSKMLDQSYPLVLTGDWDAYGKVDQVTMPNV
FT                   EAMRYTTNRLLDSGYRSIALFGADGSLGARHYRQATEGTQELRVQGYMQAYEEHGIEAR
FT                   MDMLFSGGLLTSDSGVRATNLMMDQGVRPDAIICLNDAMALGALHQLQVRGIRVPDDVQ
FT                   VVGFDNVPEATYANPSLTTIDPHIDSYARHAVDMLIERIQGYDGAKRVYTSDFTLVERS
FT                   STSL"
FT   gene            complement(67012..68553)
FT                   /locus_tag="Balac_0065"
FT   CDS_pept        complement(67012..68553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0065"
FT                   /product="Alpha-L-arabinofuranosidase"
FT                   /note="COG3534 Alpha-L-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45461"
FT                   /protein_id="ACS45461.1"
FT                   /translation="MPQHSEAQARLVVDDEFRVGPVHDRVFGSFVEHLGRCVYTGIYEP
FT                   GHPTADAEGFRQDVIDLVKELGATTIRYPGGNFVSGYQWEDGIGPKENRPRRLDLAWHS
FT                   TETNQFGLHEMVSWLNKAGGNELMEAVNLGTRGLPEALDLLEYANVPEGTARSEERIRN
FT                   GADNPFDIRMWCLGNEMDGPWQLGHKDAEAYGKLAASVAAGMRMLDPDLELVVCGSSNH
FT                   TMDSFGKWEETVLEHTFDKVDFVSAHAYYFPQLMENGSRDMASFLASGVDMDGFIKDVG
FT                   AAIDATKARLKSDHNVYISFDEWNVWYYEEEPSKNPEGIGNWPVAPRLLEDVYTVADAV
FT                   VVGDLLITLLQNADRVHAASLAQLVNVIAPIMTEPNGPAWRQTTFYPFSLTAAWAKGGD
FT                   VLEPKIESTQYHTNRYGNVNSTNAVAVRGKDGSVSVFVTNRSLDDGCDFEIKLPEGFTP
FT                   TELDVRTLHDDDMLATNTVNHQDRVVPHPNDTASIQDGMVTVTLPPVSWTAIHLR"
FT   gene            68830..70491
FT                   /locus_tag="Balac_0066"
FT   CDS_pept        68830..70491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0066"
FT                   /product="sugar kinase"
FT                   /note="COG1070 Sugar (pentulose and hexulose kinases)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45462"
FT                   /protein_id="ACS45462.1"
FT                   /translation="MTHEFIAELNPEAGGTMADSKAIAQAIRDGRTSLGIEFGSTRIKA
FT                   VLIDDERNTITTGDYGWQSHLVDGLWSYDVDKIWRGLQSVYADVADRVEADYGLKLTRI
FT                   GQIGFSAMMHGYLAFDADGELLVPFRTWQNTNTSEAHEKLSELFQYNIPERWSIAHLYQ
FT                   AVLDNEPHIGSVRYFTTLSGYVHWKLTGRKVLGIGDASGMFPIDPNTKTYEQGFIEQFD
FT                   ALPEVAAQPWKLNDLLPEPLVAGTPAGELTPEGAALLDPSGVLQPGTMLAPPEGDAGTG
FT                   MVATNSVRRRTGNVSAGTSIFATVVLEHKLSKLRPEVDLVTTPAGDLAGMSHANNFTAD
FT                   LNGWVDLFRQFSQLNGRNVDDGTLYGELFRAAIGEDADPDAGGLLAYPFRTGEFLAGLA
FT                   EGRPLFVRGPEARFSLANFMRAQLFGAFSPVTIGMNVMTEDEGVEIDSLVGHGGIFATP
FT                   VVAQRILAAAFNTPIRVMTTASEGGAWGMAVLADYLRHADLTLADYLDDVVFAGAESVT
FT                   EAPRPDDVDGFQRFFARFVKALPVERSAVEHVEIGG"
FT   gene            70547..71239
FT                   /locus_tag="Balac_0067"
FT   CDS_pept        70547..71239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0067"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="COG0235 Ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45463"
FT                   /protein_id="ACS45463.1"
FT                   /translation="MATLADYGPEVRAEVKQVREVVAALHEQLIKWNLVVWTAGNVSQR
FT                   LRTADLMVIKPSGLRYEYLTPSSMVVCDLDGNVVDGAESPSSDTASHAYIYRHMPEVYG
FT                   VVHTHSTYATAWAATGQNIPCGLTMMGDEFGGPVPVGPFRLIGSEAIGEGVVETLKAYP
FT                   KSPAVLMQNHGPFTIGKDAEAAVKAAAMTEEVAHTMWAAKQLGDIIPIPQEDIDKLNDR
FT                   YQNVYGQH"
FT   gene            71503..73020
FT                   /locus_tag="Balac_0068"
FT   CDS_pept        71503..73020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0068"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="COG2160 L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45464"
FT                   /protein_id="ACS45464.1"
FT                   /translation="MAMENPFEGKEIWFGVGSQDLYGEEALRQVAQQSAEIVDSLNASG
FT                   RIPVKLVLKPTLKSSDGVRRFMVDASADDSCIGVITWMHTFSPAKMWIRGLEALRKPLL
FT                   QLNTQHHFEIPWETIDMDFMNLNQAAHGDREYGYIVTRLGIPRKIVVGHYTDPAVADKI
FT                   GVWARACAGWQASNTMNVMRWGDNMRNVAVTEGDKTEAERVFGASINTWAVNELVAAYD
FT                   AVKENQIKDLIEDYKAKYEIAPELLDKDYDSLFIAAREECAMVNMMRANGCTAGVDNFE
FT                   DLGALPQLPGVGPQRFPSEYGWGFSAEGDWKTAVLVRIGAVMGYGLEGGASLMEDYSYN
FT                   FTPGNEMIMGSHMLEVSPSVGTIAKPRLEIHPLGIGGKADPVRLVFTVAPKKDAVVVSL
FT                   ADVRTRFRMLMNVVDVVEPLGSLDKLPCARALWKPEPNLEISAECWLRAGGSHHTCMTT
FT                   SVGREAWEDFARIAGVELAAIDAETTPREFERELEIEDVFHELANRH"
FT   gene            73155..74018
FT                   /locus_tag="Balac_0069"
FT   CDS_pept        73155..74018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0069"
FT                   /product="dehydrogenase or reductase protein"
FT                   /note="COG0656 Aldo/keto reductases, related to
FT                   diketogulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45465"
FT                   /protein_id="ACS45465.1"
FT                   /translation="MSTLADQTPDIPLITLHDGSRIPQIGLGVLRIDDEGVVPVVESAL
FT                   AIGYRHIDGAAGYNNEEGVGRALAATGYNTGEQRESLWMTTKLRDSEQGYDSAMHAFDR
FT                   SLELLQLDYVDMYMIHWPTPFDWRSGETWKAFAKLREDGRVRTLGVCNFMPEHLDRLYE
FT                   ETGEYPTVNQIELHPTWQQRDVVEYCHAHDIAVEAYSPMARGADLANGVIERIAEAHGV
FT                   TPAQVILRWHIENGTIIIPKSVHTERQRENLDLFGFSLTPQEHAEIDALDGPTRAGHDP
FT                   MTFTYA"
FT   gene            complement(74259..77015)
FT                   /locus_tag="Balac_0070"
FT   CDS_pept        complement(74259..77015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0070"
FT                   /product="hypothetical protein"
FT                   /note="COG2352 Phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45466"
FT                   /protein_id="ACS45466.1"
FT                   /translation="MTDQEQTITPADATIVSSGLGTKGPEERTLPATLQEDMDLCLNIL
FT                   RQVLSEYDENLLKTFDTVRQYAVDASAERFSGVLTDTHPERDDLEMAVKTIDAMNLHDA
FT                   QLLARAFATYFHLANLCEENYRVAVLHEREAKVDDTQAIDPVNEMTKAYHQLISEMGPA
FT                   KAKELLERLEFHPVFTAHPTEARRKAVEGKIRRIAQLLEAHRLLGGSDKKEDSRRLYSE
FT                   IDALFRTSPIALKKPTPVEEADTILDIFDNTLFHTIPMVYRRFDDWMLGDKAGIEPPAC
FT                   PAFFHPGSWIGSDRDGNPNVTAKVSRQVARKFSDHVLAALEEATRTVGRNMTVESETTP
FT                   PSDELRALWNQQKEISERLTGKASLISTKELHRAVLLVMADRLHYTIKRDTDLMYHNCD
FT                   DFLADLRVVQRSLAEAGDKRAAYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALDDI
FT                   REHGLHGERGPLQPMTHEVLDTFRALGAIQKRNGVKAARRYIISFTKSAKNVRDVYELN
FT                   RLAFSNPDDAPVIDVIPLFEQLEDLEHSVSVLDEMLKIPEVQARLKQTGRKMEVMLGYS
FT                   DSSKDAGPTTATLALHSAQERIAKWADENDIDLTLFHGRGGAVGRGGGPANRAVLAQPK
FT                   GSVKCRFKLTEQGEVIFARYGNPVLAIRHVESVAAATLLQSAPSVEKTNTEMTEKYKPM
FT                   ANQLSEVSHETFLDLLNSEDFAPWFSIVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTI
FT                   PWIFSWAQARINLAAWYGLGSACESFGDLATLRKAYEEWPLFSTFIDNIEMSLAKTDER
FT                   IAKMYLALGDRPDLSKKVLDEMELTRKWVLKIVGDEWPLQHRHVLGQAIRIRSPYVDAL
FT                   SVTQVLALRSLRKKVDKEELSESQQAGFIYLILCTVSGVAAGLQNTG"
FT   gene            77254..79002
FT                   /locus_tag="Balac_0071"
FT   CDS_pept        77254..79002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0071"
FT                   /product="hypothetical protein"
FT                   /note="COG2966 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45467"
FT                   /protein_id="ACS45467.1"
FT                   /translation="MSKSEEESATTTDDMHGHDRHSARVHWRSRPVKSAAGAVRRFHSH
FT                   AIPLDMEDIERDWDKPITDAGIAAKASVIVRVGMLDLGAGTGSFRVREMMHRIAYPLGV
FT                   HVRADVNLTDVQASCTDGKERITEVVNLPTTGVNTERIWLLEHFADWFSVNLGAGTMYH
FT                   RRTEVSRQLMQPNTLGTRDASQISAETAKQLRERLRQEARAQKLAAKRASLRSRVAERV
FT                   AERAKKKLPEDEYAEHFDHLEEHAEKRVRESGPITVGQVHKRLDLIERRKPLYSSAFSG
FT                   FAAACACAAFVFLLGGAPYDMIGAFIGAGLGQWARRRLFAHHLNQFFVTFVAVAVAALA
FT                   CVGTLRLIGIFDPVALHHDTAYIGAMLFVIPGFPLITGGLDMAKIDFPSGVQRIAYVCC
FT                   IILMATLAGWMVAVLVHLNPQGFDTPPLNPWATGALRALFAFVGVWGFSVLFNSPQRMC
FT                   LVAATIGMITDTLRLEIVDWGVPAEAGAFIGALLAGLIASAWRSAVRHGLLAPHLGYPR
FT                   ICLTVPSIVIMVPGLYMYRAMFYLGQFNTLLALDWAFRAFMVIICLPIGLAMARVITDK
FT                   SWRYDV"
FT   gene            complement(79093..80226)
FT                   /locus_tag="Balac_0072"
FT   CDS_pept        complement(79093..80226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0072"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="COG3464 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45468"
FT                   /protein_id="ACS45468.1"
FT                   /translation="MRSSWLRTLAHVPYGDDAVHLLVRVRRYECVPCSRSWSDDPEAVG
FT                   AGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGMLLLEQADRFSS
FT                   VRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQVLREWMQARGG
FT                   EFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTKVRCRLQRDATGR
FT                   RGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDAYQRVIHAYRCD
FT                   DRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRHPRSSNGPTEAI
FT                   NGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
FT   gene            complement(80579..81682)
FT                   /locus_tag="Balac_0073"
FT   CDS_pept        complement(80579..81682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0073"
FT                   /product="Tryptophanyl-tRNA synthetase"
FT                   /note="COG0180 Tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45469"
FT                   /protein_id="ACS45469.1"
FT                   /translation="MTDDMNAQLTAAGNEMSASFLAAKKRSDETLAKLKANPGKFTMLT
FT                   GDRPTGRLHLGHFFGSIRERVAMQNLGVNTNIIIADYQVITDRDTTEHIDDNVLNLVLD
FT                   YMAAGIDPEKTMIFTHSAVPAENQLMLPFLSLVTEAELHRNPTVKSEMESSGHALTGLL
FT                   LTYPVHQACDILFCKANVVPIGKDNLPHVEITRTIARRFNERYAKKNPVFPEPAAILSE
FT                   APEIPGLDGRKMSKSYGNSIMLGATAEETAKLIKKSPTDSERTITFDPVNRPQVSALLT
FT                   TAGLVTGRDPSEIAAEIGNAGAGALKKYVIDSVNEFLAPHRERRAELAKDMDSVRDILH
FT                   DGNARANAIANQTLDEVREAMGMRYDR"
FT   gene            81843..82190
FT                   /locus_tag="Balac_0074"
FT   CDS_pept        81843..82190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45470"
FT                   /protein_id="ACS45470.1"
FT                   /translation="MGRGRQKAKQQKIARKLKYMTTDTDYDELAKELGAHEPGTGSFDP
FT                   FADVENDEFEAQDVDETVDDLDEYAKWAAEAAAKATTGEMPETHAQPKPKPHKPIPMPV
FT                   PETFKHTDQQE"
FT   gene            complement(82389..82772)
FT                   /locus_tag="Balac_0075"
FT   CDS_pept        complement(82389..82772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45471"
FT                   /protein_id="ACS45471.1"
FT                   /translation="MMRGMQAYDDWCTAARAAAETTPALDIAPRLDRATMAMAVRYSLH
FT                   QLEIKAPGPGVEVRVAPYAVVKILEGPASDPHNLTPPDVIELDPQVWLRVASGITTWHE
FT                   EQKAGRISAVGERDDLSPLLPLG"
FT   gene            83374..85830
FT                   /locus_tag="Balac_0076"
FT   CDS_pept        83374..85830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0076"
FT                   /product="glycogen phosphorylase"
FT                   /note="COG0058 Glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45472"
FT                   /protein_id="ACS45472.1"
FT                   /translation="MTELTAPKSPLTANEFADEIRQALKYTQGVTPEQAKTADVYVATA
FT                   TVVRRHLMDSWMKTQQDMINGDTKAVGYLSAEFLMGKQLRNALLNAGLTPQFEEAVRGL
FT                   GFDPQAVVDAEYEPGLGNGGLGRLAACFIDSLASLGVPAFGYGIQYKYGIFRQEFDDEG
FT                   RQIERPDYWLSNEDPWGHIDYERDQRVNFGGKVVEENGKRVWKPSWAVRAIPVDYMVPG
FT                   YASGRVNTLRLWQARSYDEFDLLTFNKSEYLDAVKPQVKAEDISKVLYPEDSTEVGKEL
FT                   RLEQQYFFASASIHDAIRVFYPDTDKPDLTTFADKITFQLNDTHPVIGIPELMRIMIDE
FT                   YGYDWDTAWEVTHKTFNYTCHTLLPEALEVWPASLIGKLLPRHLEIIERINKQFVSELE
FT                   AKGASEDQIKRMLILTDDEHPVVRMAYLATYAGSNVNGVAELHSQLLKDVTLRDFSDVY
FT                   PAKFKNVTNGVTPRRFIKLANPRLSELITEGLGTDKWLEDLDLLEGLAPLAQDDEFVKK
FT                   FAAVKHENKVAFADFSKQRYGAELDANTMFDTMIKRLHEYKRQALKILEIIATYSDIKS
FT                   GKVNVQDITPRTYIFGAKAAPGYYLAKMTIQLINNVAKVIDNDPDVNGKIKIFFPWNYN
FT                   IEVAQMLIPATELDEQISQAGKEASGTSNMKFALNGALTVGTLDGANVEIRERVGADNF
FT                   FLFGMTVDEVEKMYEQGYDPSKYYEADPRLKAAIDMVADGTFSNGDRNTYAPLVSDWLT
FT                   KDWFMTLADFSAYHDIQADIDALYADQLEWNRKAILNVANSGYFSSDRSIKDYLDRIWH
FT                   TRSLDK"
FT   gene            complement(86071..86298)
FT                   /locus_tag="Balac_0077"
FT   CDS_pept        complement(86071..86298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45473"
FT                   /protein_id="ACS45473.1"
FT                   /translation="MEKKSSNGWKFFALLFGGLLAAVVGLYIYKQQNPDYDPWEEPWEN
FT                   SSSPVDLTLAQDKTEDDLDQPAADAAKDAA"
FT   gene            86641..87342
FT                   /locus_tag="Balac_0078"
FT   CDS_pept        86641..87342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0078"
FT                   /product="rhomboid family membrane protein"
FT                   /note="COG0705 Uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45474"
FT                   /protein_id="ACS45474.1"
FT                   /translation="MVTSAIILVCVAVWLLETLFRFVWPAGLAGMLGFGMMQPASMTRE
FT                   PWTLVTAMFLHQPASLWHIGFNMLTLWSVGPVLERLMGHWAFLILYMVSGIGGDAGMMI
FT                   WALLNRSGEGWFTSSYGASGALFGLFAAILVVYRKVGQDLTSMIVWMAINFLMPVIVPN
FT                   IAWQAHVGGFVIGGLFTILMTDGVRALRRRPVLERALIYGAVLLVLLLVVCYACNTANP
FT                   MRTGSWIPFLD"
FT   gene            88340..89746
FT                   /locus_tag="Balac_0079"
FT   CDS_pept        88340..89746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0079"
FT                   /product="N6-adenine-specific methylase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45475"
FT                   /protein_id="ACS45475.1"
FT                   /translation="MCIYAGGYAPRNAYVGLQLIPRHALRRRRNGMWLARISHIEEKTA
FT                   AHEMANGCGTGSLVGMANLQMSQETREFIRAHAGEDVRELALHTKRDVPGLDLPFALDQ
FT                   IAGREIARTKLPQWAACEGIVYPPHLAMEQCSSQFTAEYKAQVAAQLVEEESEPTLVDL
FT                   TGGFGVDFSAMVRGFAHGTYVERQERLCEVARHNLRELGLGGRADVVCGDGVDHLAQMP
FT                   PATLIYLDPARRDEHGARTYAIEDCTPNALALRGQLLDKAPFVMIKLSPMLDWRKTIAD
FT                   FVGSVAQVHITATGNECKEIVVVLARGEHERVRVVCVNDAQRLEFEVGADSAGSWQRAD
FT                   VLDACELGAQRYLYEPNAAIMKAGAFGEITRNYDVRQIGANSHLFVSEHPVADFPGRAF
FT                   EITALGTMNKRDVRQVLGGISAANVSVRNFPLTVQQLRRKLKLRDGGDVYLFATTVAGG
FT                   HMLLRTRKLA"
FT   gene            complement(90000..90575)
FT                   /locus_tag="Balac_0080"
FT   CDS_pept        complement(90000..90575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0080"
FT                   /product="putative septation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45476"
FT                   /protein_id="ACS45476.1"
FT                   /translation="MAEEELHKTDADVSANDAADSNATVTDDVVVDAATDSEGDAVAVE
FT                   SETVTEEPQTDSEKKAEREEKRAEDNEKRAEEAAVVSEEEADDLSLDKIQAVLNSTIDE
FT                   KDMSPQMRRMVKRQQENTKRVEESIKGTKANPSWFVPLFCAFMIVGLIWVVVFYMTAKY
FT                   PIPGIGNWNLAVGFALIMIGFLMTVAWR"
FT   gene            90682..91479
FT                   /locus_tag="Balac_0081"
FT   CDS_pept        90682..91479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0081"
FT                   /product="hypothetical protein"
FT                   /note="COG3879 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45477"
FT                   /protein_id="ACS45477.1"
FT                   /translation="MAKHGARHVRKTSVVGSMAVLVVVALVGYLVVTNLRVNKSATVSN
FT                   DAAELIEHRVQRVDELQSEVNKLGSQIDDYNTLLRNNEMQSGNSEEAGQSTMLPAVTGP
FT                   GVTVTLNDSSMWRSAVDSSGSTADIDKYVVHQQDVEAVVDALWAGGAESMQIMDQRVLP
FT                   TSAVICSGNVLLLQGRKYSPPFTISAIGPVDGMLQSLDDSRAIQIYKQYVDAFGLGYDV
FT                   EVNRSLTFQRTPLVLNPLRYAKAFESGGSNESANGGQTTSATN"
FT   gene            91567..92721
FT                   /locus_tag="Balac_0082"
FT   CDS_pept        91567..92721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0082"
FT                   /product="hypothetical protein"
FT                   /note="COG3764 Sortase (surface protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45478"
FT                   /protein_id="ACS45478.1"
FT                   /translation="MKHGGRRGNASARQDGRIDRLPEVGGKRSVMRSVVMILAEILLTV
FT                   GLVCALYVVWMQWWTGVQSENRQIEERQSVGWAQPASDGANAKIAHPQQGDPPLQPEHA
FT                   SIGELIGRVYIPRFGDAWERNLVQGTDLAELNLHGLGHYVDSQMPGQVGNFAIAGHRNG
FT                   YGQPLGDVDKLQPGDAVVVRTKDYWYVYTYTNYTIVTPDETSVISANPEDPSAPPTKRL
FT                   LTMTTCEPKYTAPTHRWISFGEFKYWAKVSDGVPAELAKKGADGATKFISNEQTPFFAK
FT                   LKTLQPVIWGALIAYAIIFIAAAIAWRWPLLRAIREGRRPRPDVDIYGVLVRHQPGPAP
FT                   IRWLLALLLFVAVSLAIIEWACPWAASHIEILREMSNYTAVNTQ"
FT   gene            92962..93609
FT                   /locus_tag="Balac_0083"
FT   CDS_pept        92962..93609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0083"
FT                   /product="Para-aminobenzoate synthase
FT                   glutamineamidotransferase component II"
FT                   /note="COG0512 Anthranilate/para-aminobenzoate synthases
FT                   component II"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45479"
FT                   /protein_id="ACS45479.1"
FT                   /translation="MTDSARILVIDNYDSFVYTIVGYLKTLGATVTVVRNDALDPHEDG
FT                   VLDDYDGVLISPGPGAPSESGVSEDVIRLCAQTGTPMFGVCLGMQALAEVYGCTVSHAP
FT                   TIMHGKTSLVEHVDDEIFAGVANPMTATRYHSLAAEPDSVPDELQVTAWTVDDHIVQGI
FT                   RHRELPLFAVQFHPESVLTQDGYRLFANWLAVCGQESAVEKSLGLQPKLAAE"
FT   gene            complement(93919..96051)
FT                   /locus_tag="Balac_0084"
FT   CDS_pept        complement(93919..96051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0084"
FT                   /product="serine-threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45480"
FT                   /protein_id="ACS45480.1"
FT                   /translation="MSSMPTTLDNGRYQLGQLVGRGGMAEVHIALDTRLGRTVAVKIMR
FT                   ADLAHDEIFLTRFRREAHSVAQMNNPNIVNIYDSGEEVVTLDNGQTEHLPYLIMEYVQG
FT                   QTLRDIIKANGALSVSDTEHVMIGVLNALEYSHRMGIIHRDIKPGNIMISEQGIVKVMD
FT                   FGIARALDDSATTMTKSQGVVGTAQYLSPEQARGENVDMRSDLYSAGCVLYEMLTGRPP
FT                   FTGDSAVAIAYQHVSEVAAKPSSIVPGLNPMWDQIVAKAMAKDRQNRYATATEFKNDIL
FT                   TYMNGGLPSAAAFNPLQDLSTINATKTQTMAAANDYPANEGSTRVYNPVTGQFQTVPQD
FT                   PNAAAGDTDTMVKSRSQKRLEAARKRKRNTIITVVVLVVLALAAAGGWYAWAHMQPPKK
FT                   EYVTVPTFSATTTEERAKAQLAELGLQASIKQDTDSREPAGTFTKQAPAGGRSVEKGST
FT                   VTVWFSAGPKSVPVPNVTGQSQADARAALEAAGFEVNSSVQTEDSATIERDHVTRTDPA
FT                   AGTSAEQGTTVSLWVSSGMTKVPSGLIGKSKDEAVDELQKNGFAVEINTENSSQPENTV
FT                   TRIEPNEGTSVERGASVTIWVSNGKVAVPNVVGRTLGEAKAALTDSALNLKWKVAANSK
FT                   DNDDAVVTASNPSAGSQVNPGTEVTLTTEPKESPSPSPSPSNSNGSSGSNGNSGNGDSN
FT                   SGSQSSQNQQNSDNKH"
FT   gene            complement(96044..97069)
FT                   /locus_tag="Balac_0085"
FT   CDS_pept        complement(96044..97069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0085"
FT                   /product="serine-threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45481"
FT                   /protein_id="ACS45481.1"
FT                   /translation="MRLIEGQLIHCRYRLDSRLAQGGMGEVWKGYDIQLGRPVAIKALR
FT                   KDTTNQESKLRRLRAEARNSANLAHPNIAALFEYYEHDGIGFLIMEYVPSKSLADLYHE
FT                   LDGPMDPIRLLPILIQTARGLFVAHSHGVIHRDVKPANIMVSDNGEVKITDFGVSYSTN
FT                   QEQITQDGMVVGTAQYISPEQAQGQQATPQSDIYSLGVVAYEGLCGHRPFTGATPVDIA
FT                   AAHVNNPVPPLPNTVDFQLSQFVMSMLAKDPADRPQDALTVARVLSRIERRLLDQQTAL
FT                   SDTTMVNINGRVPRRVTSAPHHDLQTYQSAFPFAQQTQRDAGTDSPGHAIAGGFGRSIN
FT                   E"
FT   gene            complement(97066..98532)
FT                   /locus_tag="Balac_0086"
FT   CDS_pept        complement(97066..98532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0086"
FT                   /product="penicillin binding protein transpeptidase"
FT                   /note="COG0768 Cell division proteinFtsI/penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45482"
FT                   /protein_id="ACS45482.1"
FT                   /translation="MNKTLRQLFTAVIVLFVILGISSSIIMVNRANRLSHDSRNTRALY
FT                   QTYGAPRGSILASDGTIIAKSDPVNDSFSYQRSYPQGDIYAPITGYFSIAQNADRGIEA
FT                   SENELLTGESNALFWQHVKALFTGKENKGASIETSIDPKLQTAAMEALKNNDGAAVAIE
FT                   PKTGRILAMASTPSYDPNELASHDTGSVSKAYTELVTNPSNPMLNRAISELYPPGSTFK
FT                   TVVAAAALDSGKYQLDTQIPAGASYTLPGTQTQLTNAEEPGNGTDGKISLKDAMAWSSN
FT                   TAFAQLGVALGDESVSNMAKKFGFDKPIVIDGTDSNGLPMQAVASRFPTNVGDDRLALA
FT                   SIGQGDTVETPLQNAMIAAAIANDGKVMKPTLVDRVRFSDLSVMPDTKPQVMDTAFSAD
FT                   TANKLTEAMEAVVTDANPNLEIPGVKVAAKTGTAQIGANNSSIDGWVMGFAPADDPKIA
FT                   VAVVVHNVDLYGSFAAGPIMTAIMKEALQQ"
FT   gene            complement(98525..100267)
FT                   /locus_tag="Balac_0087"
FT   CDS_pept        complement(98525..100267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0087"
FT                   /product="Bacterial cell division membrane protein"
FT                   /note="COG0772 Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45483"
FT                   /protein_id="ACS45483.1"
FT                   /translation="MAARVRYLLQIIFALLISALGFFQLSERMNGKPTSGSVVMQIVCA
FT                   IMFLVAWGLMSRFQKFGNQSIFACVLMLTSIGILMISRIDGEMDTAVAIRQMMWLCLAL
FT                   VCCYALFAFMKDYRILRRFSYVSMVIGLALLLSPMIPGLGREIGGARIWIGVGSYQLQP
FT                   GEFAKLFLAFFFASYLFNHRDQLAVGGRKVLGLQLPRLRDLGPIVIVWVASMGVLILQH
FT                   DLGTSLMFFAMFVAMLYVATGRASWLIIGFLAFAIGCVAAAHLFAHVGYRVDAWLHPFD
FT                   SEIYNRYPGGSSQIVQGLFGLAAGGLFGTGLGEGHPAITPLANSDFIFASAGEELGLVG
FT                   VFAILMLYLLIIAAGMITAMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLTGLT
FT                   MPYMAAGGSSLIANYILAALLIIISNAANKPQNDLMTDTFRMEAVHALSSRKPRQRKAS
FT                   GNATQVTKPRGNREEEPRPRTSQLPVTSAAVQQSAAVSASPAQDDSATQVVSPQPIVAP
FT                   QQTSEPVSNTRNIPVSPQQATPSAGEETEAMAPLNPSVPPLPQQPHTPTNHQATTSEGG
FT                   AEHE"
FT   gene            complement(100270..101808)
FT                   /locus_tag="Balac_0088"
FT   CDS_pept        complement(100270..101808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0088"
FT                   /product="phosphoprotein phosphatase"
FT                   /note="COG0631 Serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45484"
FT                   /protein_id="ACS45484.1"
FT                   /translation="MYSTTVSDVGTVRSNNQDSSFAGEHLVAVCDGMGGHAGGDTASTI
FT                   AIRSLAHIETDSAGGDVAKAAAIIEASTLAAHDAIVGKAKRERKLAGMGTTVTAITLVS
FT                   DYWVIAHIGDSRAYLLRDGKLMRLTTDHSYVQHLIDTKRINEVEARNHPQRNVVMRVLG
FT                   DFDIDAHPDISIRRAEAGDRLLLCSDGLCGVLEDSTIEETLSHFTDPEECAQTLVSMAL
FT                   KAGSTDNVSAVIADSTIALDADSFDLPHQTPLIGGAASATLEPIADIIHEPVASAPALI
FT                   TRSSPAERAAALIASDSNKAAQSEEHDATQQVAQPSTVREENGELQDPDTGEIPVIRKS
FT                   DGRYSADPNDPEVARAIHHEHLQEKKQARSRRFRGKIIGSVVAVAIVAVLALGTWAAYA
FT                   WSQTQYYLASDNGVVTVYQGVPTNIFGYELSHAIEHTDLKVDELPEQWQDRLRQGISVD
FT                   GYDEALSHVELIRTQFNDLKKEQEQKAKEDADAKAKQQKQANDSKSPTKSAQSR"
FT   gene            complement(101830..102375)
FT                   /locus_tag="Balac_0089"
FT   CDS_pept        complement(101830..102375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0089"
FT                   /product="hypothetical protein"
FT                   /note="COG1716 FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45485"
FT                   /protein_id="ACS45485.1"
FT                   /translation="MITELTFAVLKYAFLILLWLFVWFITRSLYRDVAAFSPRKSRARR
FT                   RKEREVRKSNDALAVSASAQPLPVSAPTPSAAAPSDTAPTPTLLVIIDGPLAGTSVPLN
FT                   SSVITLGRAASNTVVLDDEFVSSHHARVYPDPNTGVWAIEDLHSTNGTVVNQQRISAPT
FT                   ILGPRVPVRIGATTFELR"
FT   gene            complement(102394..103095)
FT                   /locus_tag="Balac_0090"
FT   CDS_pept        complement(102394..103095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0090"
FT                   /product="hypothetical protein"
FT                   /note="COG1716 FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45486"
FT                   /protein_id="ACS45486.1"
FT                   /translation="MSVLDRFEKSVEGAVNGVFAKFGSKDLQPVDLSSALEREIDAEAM
FT                   PVGRDRTVAPNEYRFKLSTPDFDRIESWGSEAMANELADNLTQYAKSQHYAFVGPVVVI
FT                   FEEDLQLTKGNFKLTSESVQGNAVPVTTDEQAEDCPMLEVNNNQYLLTKDKTILGRGSG
FT                   CDIVIDDPGISRKHLEIDITDNGVIARDLGSTNGTYVEGHQVPAATLLDGNTITIGRTR
FT                   ILYWASSQDQR"
FT   gene            103860..106274
FT                   /locus_tag="Balac_0091"
FT   CDS_pept        103860..106274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0091"
FT                   /product="Dipeptidylaminopeptidase/acylaminoacyl-peptidase"
FT                   /note="COG1506
FT                   Dipeptidylaminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45487"
FT                   /protein_id="ACS45487.1"
FT                   /translation="MESAIEEYPVRKAKTVRFTCGAPRSPKLIGDGSRMLFLRSAGEQD
FT                   TENSLWLAICGEDAYAEVELVNAGELVNTLGSDDVPAAERARRERARESATGIVAYSVD
FT                   GLGNHVAFTVNGELFVTTIDWDALAYTVGDDGVRAQVGAGVRTEHLVPQFADSAQNEFA
FT                   GPVLNPRMSPDGKRVAYATGSAVVVVDVQTAVANAVFTVSPQDRETMRAGLAEFAAGEE
FT                   MDRYDGFWWGPDSRTLLVECFDSSPEPVWTISDPADPAARGIQHRYPRALTENAVVDLF
FT                   AVRLGDDGTSVQKTAMIDWDNVAYEYLAVVDWQAERPVLRVLDRLQQHEQILRVAMPAE
FT                   NEWGDLRALDGNVMALLPVEVIAEHHNDQWIDLVGGTPCVTPSGAVVCSVNDMEADTNR
FT                   LSVDGRVFTPAGWQVREVLDAGTDDVLCVVQRTAERAAEVPEQWADSTAERYHDARSFD
FT                   IVTISYADGSVRAVSDEPGVWRASRRGDGLVVWGRTMDSAKAVMRLSYGAEGARTGHDV
FT                   CNVAAEPDFVPNVRFVRLGERKLFTAIVAPSASSRFAGAAELPVLMHPYGGPGHQEVVM
FT                   SRAAYLDAQWWADQGYLVVIADGRGTTGRGPVWDREVYLQMKRVSLADQVDAVHALAGA
FT                   VDELNRMGGAAEGCEFGGHDDAARPLPKPDLERVAMIGWSYGGFLSALAVLDAPDTFAA
FT                   ACAGAPPTDWTLYDTCYTERFLGLDPQVYADNSIVLDAPKLVRPLMLIHGFADDNVTIA
FT                   HSLRLSQALMEAGRPHTFLPLTGITHMTNDPDVARNLLILQRDFLSDALAR"
FT   gene            complement(106313..107365)
FT                   /locus_tag="Balac_0092"
FT   CDS_pept        complement(106313..107365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0092"
FT                   /product="putative permease"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45488"
FT                   /protein_id="ACS45488.1"
FT                   /translation="MSEHSDPQHDHGTRNVNSPEELHEMLARSAATEQADARDVLVEEA
FT                   VSGKGEQTPSFEQTPRKMAIGIACVLIGGTCWGVNGAVSKILMEEYHAAPLWIACVREI
FT                   IAGIIFLVAAMIGTPHSLRSAVTSWREYPKFVGAALTCVTLVQVAYLFSIHWTNAGTAT
FT                   VLQTVNLLMVLIYVCVRAKRRPTKREVIGVALAFVGVWLLATGGKLSTLSMPLPGLFWG
FT                   LMDAFSCACLAIIPVGLIARYGNLTFNGLTFLISGLILLPFVKPWQNMPHFDARGWWLM
FT                   AFTVVVGTVVAFWLFMAGVVRIGSMRATLLATIEPVTATISSVLWTGSVFTPVDIVGFV
FT                   LILIMSFLVQ"
FT   gene            complement(107450..108535)
FT                   /locus_tag="Balac_0093"
FT   CDS_pept        complement(107450..108535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0093"
FT                   /product="hypothetical protein"
FT                   /note="COG2267 Lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45489"
FT                   /protein_id="ACS45489.1"
FT                   /translation="MEIAMINEHEFQQDLEATALPALDSCMHDGYMDPAVSDWHGHRLR
FT                   TLHPADGTPNKLHVVRYDVEKFHALQIPGSSRQTHGTVLISHGFTEFAAKYKEMAWYFL
FT                   LAGFSVCILEHRGHGYSARDVRNDQIVYIDTWHRYVADLAKCARTIARPMAADKPLVLF
FT                   AHSMGGGIAAAMLERYPNIVDKAVLSSPMIEANLHTPNWLAALVCGAACDFGHAKSMAP
FT                   GQRAFTPLIDIKDNQGACMQRLEWMKKLRIADTHYQTSAAANEWVRQAIRLSIAMQDPH
FT                   MCERIETPILLFQAGNDHWVRNKAQNRFVKRVGKDGGDIRMVRVPGSVHEIFTMPNSVM
FT                   APYLKEILTFLQTSEPVTVLV"
FT   gene            108714..109052
FT                   /locus_tag="Balac_0094"
FT   CDS_pept        108714..109052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45490"
FT                   /protein_id="ACS45490.1"
FT                   /translation="MVAQNIIMTVLNVIVLVALLVFGVYAVYNNKPNFELTPAHLYDQQ
FT                   MGQKYGIWVFICVIISWLVTLPGLFGPLSNTWNQILWWVELIFNIATLVFCVLASFYYS
FT                   RLNTRPHD"
FT   gene            109132..110085
FT                   /locus_tag="Balac_0095"
FT   CDS_pept        109132..110085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0095"
FT                   /product="methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45491"
FT                   /protein_id="ACS45491.1"
FT                   /translation="MSPEKLARFADSWKYFVCPLCREELRLEGTSLRCERGHTYDVARQ
FT                   GYVNLAPGARQSEYYSRESFEHRGQILSAGYYSHIVDAVLSAVGRYCGQIAASIDFAGL
FT                   RTRSGAQLRGARGRADLRSSGPQMRAPVILDVGCGEGFYARAVQAAHPDATVLAFDISK
FT                   DSVQLAAREDAGCAVRWFVGNLAELPVRDGAVDCVLDVFSPVNYAEFTRVLGGSGVVIK
FT                   VVPGARHDEQLRELARGQLRHGDYSNEQVVGQFAEHFDVLERRLVSQTFPMPADDVLAF
FT                   ARMTPLLFNVDVDSLDLSRIHELTVEAEILVGSVCG"
FT   gene            complement(110587..110841)
FT                   /locus_tag="Balac_0096"
FT   CDS_pept        complement(110587..110841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0096"
FT                   /product="hypothetical protein"
FT                   /note="COG2261 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45492"
FT                   /protein_id="ACS45492.1"
FT                   /translation="MHWLWVLIVGAIIGAIAGAITHHSGAMGRISNIIAGLVGSALGEA
FT                   LLGHWGPQLAGMAIIPSLIGAIVVVAVVSFFLMRSSAKN"
FT   gene            complement(111113..111370)
FT                   /locus_tag="Balac_0097"
FT   CDS_pept        complement(111113..111370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0097"
FT                   /product="integral membrane protein"
FT                   /note="COG2261 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45493"
FT                   /protein_id="ACS45493.1"
FT                   /translation="MDTMFWIWTLIVGAVIGAIAGAITNNGHSMGWISNILAGLAGSAL
FT                   GQGLFGSWGPSLGGMAVVPSVLGAVIVVAIVSFIVMKVRA"
FT   gene            complement(111926..112011)
FT                   /locus_tag="Balac_0098"
FT   tRNA            complement(111926..112011)
FT                   /locus_tag="Balac_0098"
FT                   /product="tRNA-Leu"
FT   gene            complement(112141..113589)
FT                   /locus_tag="Balac_0099"
FT   CDS_pept        complement(112141..113589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0099"
FT                   /product="ferredoxin/ferredoxin-NADP reductase"
FT                   /note="COG0493 NADPH-dependent glutamate synthase betachain
FT                   and related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45494"
FT                   /protein_id="ACS45494.1"
FT                   /translation="MTQDSELRIAVIGAGPAGVYSSDIFLRQLAKLGDELGLGTDARID
FT                   LFEKLPVPFGLVRYGVAPDHPSIKFIASALEKTLDNPNIHLYADVEFGKDVTLEDLLER
FT                   YDAILFATGAIKDKPLAIPGADLDGVYGAARFVEWYDGYPTGVREWPLEAERVAVIGGG
FT                   NVAMDVARELMRNADDLRAKTDIPDNVYEGIKNNKAKELHLFIRRGVAQAKFSVQELRE
FT                   MEKLPGVQLIIDEDDFELDDDTVEEAGKDKLTRQMVEELFVIRDMAEDMEDDGDVDFEG
FT                   NPADRKYYIHFNSAPTEILGEDGKVRGIRVERTETGADGKMHRTGEFTDYPVEAVYHAI
FT                   GYKPESVPGIAYDEGGAHLANANGDGRITVDHENGEVRERLYATGWAKRGPVGLIGSTK
FT                   SDALMIVTAMLEDLAQNKENARLAPDRDPESIDRLLAERGVRPIDFAGWKRVDAYERAE
FT                   GAKEGREHKKVIDPDQFRALAHGE"
FT   gene            complement(113779..116013)
FT                   /locus_tag="Balac_0100"
FT   CDS_pept        complement(113779..116013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0100"
FT                   /product="cation-transporting ATPase V"
FT                   /note="COG2217 Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45495"
FT                   /protein_id="ACS45495.1"
FT                   /translation="MKKIIDLCKEVPLLPLTILAAIPLALIPQWRPWGHIHPAFDPGVG
FT                   EWIIILFVAWTIYTSIREMIDSIRHGHIGVDLLAIVALVSTVCVQQYWASWAVVLMVAS
FT                   GEAIESYAQNKARGNLTALIKAAPQQAHVVTLPGVADGGEAQLTEEGFRKVQQAVEQAQ
FT                   REGKPITMGNGHFDTVPVNDVKLGSVLIVLPGEIVPVDGQLLSGTASVDLSNINGEPVP
FT                   RTLFVGAKVLSGSINGSTTMMIRTTSLAADSQYQQILKLVSSAEESRAAVVRTADMLAV
FT                   PFTIISFAIAIVAWIVSGTGLRFAQVLVLATPCPLLIAAPVAYVAGTARLAKQKILIKS
FT                   QDVLENLGRVTHVFFDKTGTLTVKQPQVVRVEKAKDMPANVSEDEILMLAGMVEGFSVH
FT                   VLAKGIVAAGKEAMARLHRLPSSSGKTAADGAGQRELPNPNENYPVVGNVSETPGKGVT
FT                   GTVDGHKVEVGRFAFVTEQSIASEEVHTAQEEERNEKAMEQADREAAKLWPTELEPDEM
FT                   ATYIAIDGKLAARIVLRDVPRYNAKQSIAQLRELGVKEETMLTGDKKASAMIIANEVGI
FT                   TDVRYELLPQDKVNAVREAAAAEKTGRESGWKRFLAKLLGEPIHRDVTMMVGDGVNDSP
FT                   VLAVADIGMAMTDGTSTAASESAEVVIMNDDIGAVPLGVKIARQTKQRMLQAVLIGIAL
FT                   AIVGMVCAAFNLIPVVVGAFLQEAIDVVSILWALTALFNRKQASHAGIRT"
FT   gene            complement(116322..118163)
FT                   /locus_tag="Balac_0101"
FT   CDS_pept        complement(116322..118163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0101"
FT                   /product="DO serine protease"
FT                   /note="COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45496"
FT                   /protein_id="ACS45496.1"
FT                   /translation="MADDNNNWPTGTPDQNAGSDEHHTDANIGANTEDLNTAPAAPADE
FT                   QPTSVLTPVSGSATEQGEKNDSTSVDGTRKPEPYRLAPQYGAYAPTSQQETTRIPTPPQ
FT                   QGAPNAQQSGLPYQTQNNPQNMPYGVRVDQNQPNAPQGAPNAQNRNPYGVPTGNPFAPS
FT                   NGTPAGPGNPNGPTQSPFGPGSPQQGQPARTPSNIIVAVVAALVAAAICLGVGYAALTN
FT                   GWVKIPTSSSLSSVSSNNHGSGSATVEGGQAPNWASVSANVSKSVVSIQTVVDQGEAKG
FT                   SGAILDKEGHIVTNNHVVSGAKQIQVTLDNGDIYSAKVVGTDSTTDLAVIKLDNPPKDL
FT                   TPITFANSDSLTPGEPIMAIGNPLGYDGTVTTGIVSALNRPVTVMDEENNNAIVTNAVQ
FT                   IDAAINPGNSGGPTFNAAGQVIGINSSIASTASSTQTAGSIGIGFAIPANLVKRVADEI
FT                   IQNGKVEHVALGVTIQSATVEADGVTRGGAVVKSVVANSPAAKAGVKTGDTIVGFNGLA
FT                   VNNNYSLLGFVRAAAMGSTAKLTVVRDGHTMELNVTFDQAEAAVNGSNRNENQNNQNGQ
FT                   NDQNNNGQNDQNNNDGNSDNNNRNRNNDGLIDPFGMW"
FT   gene            118338..118952
FT                   /locus_tag="Balac_0102"
FT   CDS_pept        118338..118952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0102"
FT                   /product="alpha beta hydrolase"
FT                   /note="COG1011 Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45497"
FT                   /protein_id="ACS45497.1"
FT                   /translation="MQTDFSAVVFDYFDVLVDWRPHRVVGAFYPPGVTDMFFDDHDPHG
FT                   YEFCRARAAAGVPDGKILDDYTREHGPAVGWILRLLLQHRALGFYDMPVGMPTLLRELR
FT                   AAGVRMVGLANCSETAVEQMQVKYPWLGLLDGTMVSARECIAKPDPALFERAIRAFHLD
FT                   TAHTLFVENTAANAAAACELGLHAVRFESAEQIRALLLPVS"
FT   gene            119450..120979
FT                   /locus_tag="Balac_0103"
FT   CDS_pept        119450..120979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0103"
FT                   /product="hypothetical protein"
FT                   /note="COG0790 FOG: TPR repeat, SEL1 subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45498"
FT                   /protein_id="ACS45498.1"
FT                   /translation="MEDFEFLHEHEKGFEPSGEFIESRSKVPILEYGMDYYCFADIVIG
FT                   PVLPAVYLTNPLFATDNEGKPHYYGRERVGRYPGGTWWDWGPDEPKSSTMRIEPVPISP
FT                   VNVMGETVVPYERWVESYRNLPGTPFYSSLDDSGDYCDKASVFDPHGREAYRRAMFYME
FT                   EAMRVHRAYSDEDERQRFHDCVKLAEILFRHAAGRGDARAWVALGKIYKEDLNNGDYFN
FT                   SYYTASIKGHPPMIEQPPIGERARICFERAAELGDPEALVFLGDLRIEGMVCERDESAA
FT                   FELYRRAYALVDERHAMHYIKASAALRLARCLEYGVGCEIDLMQARDLYRFAHTYLRAI
FT                   ARTYFWWFARERREAMAHDQDLTQLLSHPSHVQRVALSRMGTPHPYESVTKFLPMLESM
FT                   GEFGDVVNPFYVSYNGIVLRFMDEVNRVLDRQPDLGFFDYLGLLHAKLLDAPIDVVDPA
FT                   DYDARTVMAMIIYVVRQEKFGEGLMLHSLNHGLIQRWLRRLVQIDDERASS"
FT   gene            121079..122416
FT                   /locus_tag="Balac_0104"
FT   CDS_pept        121079..122416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0104"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /note="COG0343 Queuine/archaeosine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45499"
FT                   /protein_id="ACS45499.1"
FT                   /translation="MTANTESIVQAPAPQLVEHPRGAEPGKPGDRSAFRFEQTTRLPDS
FT                   PNGKGKGGARYGRTGILHTPHGDIKTPAFVPVATQGAMKAVLPESMTQLGAQCLLSNAF
FT                   HLYERPGEDVLDEAGGLAKFMNWNGPTFTDSGGFQVLSLGAGFKKTLAMDVKGMKSDDV
FT                   IAEGKERMAFVDEDGVTFKSPLNGSLHRFSAEISMNIQHKLGADIMFAFDELTTLMNTR
FT                   RYQENSVERTYRWAQRCVAEHERLTQSRLGKPYQALYGVVQGANYEDLRRHAASQIASL
FT                   DFDGVGIGGAMEKRIIGDICAWICDEMPESRPRHVLGIAAVDDIFACVENGGDTFDCVA
FT                   PARCGRNGAIFTRDGRYNIKRAQYKHDFGPLEEGCQCYTCTHYTRAYVDHLLRAHEMNG
FT                   FTLATIHNEYFFVHLLDDIRASIDGGYFDEFRDETLARFYANGSRG"
FT   gene            complement(122476..122549)
FT                   /locus_tag="Balac_0105"
FT   tRNA            complement(122476..122549)
FT                   /locus_tag="Balac_0105"
FT                   /product="tRNA-Gly"
FT   gene            complement(122644..123615)
FT                   /locus_tag="Balac_0106"
FT   CDS_pept        complement(122644..123615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0106"
FT                   /product="protease HtpX-like protein"
FT                   /note="COG0501 Zn-dependent protease with chaperone
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45500"
FT                   /protein_id="ACS45500.1"
FT                   /translation="MTGKLHLHNHYNGLKTAVLFAIMWAIIMIIWWATGARTSTLGIYL
FT                   AIGVGTSFISYWFSDKLAIASMHAQPVTEQQAPELYRIVRELSQRAGKPMPRIYIAPTE
FT                   TPNAFATGRNENHAAVCCTQGILRILDEREIRGVLGHELMHVYNRDIRTSAIAGAMATV
FT                   LTYLGYSMMYIGNSSSSNRDRDNGAGLLGLIGILLSTVLAPIAASLIQMAISRTREYDA
FT                   DEDGSELTGDPLALASALRKISGGVDANPLPKTSTDTSTAAMMIESPFRGADVSRLFST
FT                   HPPTEDRIARLNQMAVDMGQIAPGAASPQVAGYAQYSQYRQH"
FT   gene            complement(123665..124825)
FT                   /locus_tag="Balac_0107"
FT   CDS_pept        complement(123665..124825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45501"
FT                   /protein_id="ACS45501.1"
FT                   /translation="MRLFADRPSQADGSRARIASAILNWERSLAHWKRVLTVIFSALLT
FT                   VIAVVCLGVGLNIVGLGRDTQAIPPAPVTEVEAPQLPVPLTDDAIKAAGLHEATPTVSV
FT                   SQMTATALDNLSAVDGSSALDTVAISLSSDQREQIEQNLQAFADAGAQVSFAVADLGSG
FT                   GVIAANGGVARYPASSIKAPYIVSLLQEGAVNLDETASGSTLSAQINADHIAGVLRYSD
FT                   NDGYDALWNAHLNSAIIPWSEGLVENPERMRGFQYPDVSAVELAKMWVKTYGYLFADAE
FT                   GEPNAGETASAPAREWLASSMHHSLNSSIDAAHGGEENPDGTVVLSKAGWINGEGDYYA
FT                   LNDAGIVLPSGESGNEPGYAIAIMSNACGRNDLLADLAGTLHNILS"
FT   gene            124983..125624
FT                   /locus_tag="Balac_0108"
FT   CDS_pept        124983..125624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0108"
FT                   /product="hypothetical protein"
FT                   /note="COG2135 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45502"
FT                   /protein_id="ACS45502.1"
FT                   /translation="MCAHYLGLTDAELERLVDELTMQCQRSRARVGADDEFAGVGVEAY
FT                   PKSVVPIIVPKFDTAVGVPELEPGSLETARAQWGFEQQWTPQPVFNTRIESADKPMWRA
FT                   PMEHDRCVIACRWFYESHGSEMAVSARTGRKIKQQYVFRVPDEPVMLIGGVRRGSQFSM
FT                   VTTQANADMEPIHPRMPLIVRQGELDLWLGPDYRALADRSDIPLESKPVR"
FT   gene            125727..126971
FT                   /locus_tag="Balac_0109"
FT   CDS_pept        125727..126971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0109"
FT                   /product="AraJ-like protein"
FT                   /note="COG2814 Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45503"
FT                   /protein_id="ACS45503.1"
FT                   /translation="MTGATNMATRADRGGKQGRTGGNGLGLFALAAGAFVLGAAEFVMM
FT                   GILPQTAQTLQVSIPTAGHFISAYAIGVCVGTLMLVFGRRIPPRTLIVMFMVIACAGNA
FT                   LSAMAVNAPMLVGARFLAGLPHGAFFGTATLVAKLLARKGKEARAVASMVTGQTVANML
FT                   GVPAGTLLAEHMSWRLAFVALAVCAAVTAVLARAWIPSVAPVRDAGLRGQFRFLRQPGP
FT                   WMVLIAVFVGNTGIFCWWSYVSPWLQKVGGWPNNTISALMMLAGFGMVVGGLIGGRIAD
FT                   RWVPGGTSALGQCIACVGLLAVFLVPGSRWSTALFAFVISFALFFVSAPQQLLMAEAGK
FT                   GGGELIGGATVQIAFNFGNAVGSMVGGGVLDASHMNYHYPALSGVPFAALAVLLLVLYS
FT                   VRYERRGRDENPLRA"
FT   gene            complement(127054..127317)
FT                   /locus_tag="Balac_0110"
FT   CDS_pept        complement(127054..127317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45504"
FT                   /protein_id="ACS45504.1"
FT                   /translation="MGILFINGGEIGGNTAHLGHAFLEGRDFTQIDLAGKRLFFLFRGG
FT                   APTQQMYERGEYTINRFAGLYGMDYMGMARNASEARALAAKL"
FT   gene            complement(127630..127935)
FT                   /locus_tag="Balac_0111"
FT   CDS_pept        complement(127630..127935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0111"
FT                   /product="hypothetical protein"
FT                   /note="COG3077 DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45505"
FT                   /protein_id="ACS45505.1"
FT                   /translation="MADIYFISQKTIGVRMSETATVSFRTDPKVKEEAKALYESMGMDL
FT                   STALNVFLRQSIRDNGMPFKITREQPESIEARRQTEAHEGRSFTSSESLMKDLMDA"
FT   gene            complement(127988..128467)
FT                   /locus_tag="Balac_0112"
FT   CDS_pept        complement(127988..128467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0112"
FT                   /product="methylated-DNA--protein-cysteinemethyltransferase"
FT                   /note="COG0350 Methylated DNA-protein
FT                   cysteinemethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45506"
FT                   /protein_id="ACS45506.1"
FT                   /translation="MQGFATYASEYGPVRVDWQDDAVVRLRIIPQADYDADGAGETTGL
FT                   TDETFRELEQYFAGELRRFTVPIAFASGTPFQQAVWRALLQIPYGETRTYAQIAEAVGH
FT                   PKAVRAVGSANNRNPIPFIVPCHRVVGANGNLVGYAYGVEMKRSLLQMEMRTLGQ"
FT   gene            128864..130081
FT                   /locus_tag="Balac_0113"
FT   CDS_pept        128864..130081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0113"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45507"
FT                   /protein_id="ACS45507.1"
FT                   /translation="MTGQTIARVSADSSVTDDVSQWYSQWKGRRQEIGVAPQYQLSSVR
FT                   IRTVQRLPNIASRYDQSDGRNIYVRLDATVRPRFASIQRITDVHGCQTYAVESGINESC
FT                   VFTSEPRQDGYRIAQVMEPIMYQRLAYPEQFEKTEPDPTAPVLDGRNGYRLSKERLEVT
FT                   YDGGTTWREVPDGVARIVGGINANTTLWLEPSRYVITPQFTAFVGYDEGTHTAQLLYSW
FT                   DAGSTWLTSALGHGVQAPSYISVVGDRIGVAYGYGDTLGSVGYAMVAGTLPELRADAEA
FT                   VWRQIPMYMQYPSDLTMAGWVNDTTVIVGQAGSLHVSSDSGATWRELGIPKEPGLEGKL
FT                   GYYPFDTPTHVWVEDGTAYLAMGQGEDADYAPNGTVVEAVFSYDPATDACTFIRQQPAP
FT                   TPMPAG"
FT   gene            complement(130041..130808)
FT                   /locus_tag="Balac_0114"
FT   CDS_pept        complement(130041..130808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0114"
FT                   /product="putative carboxymuconolactone decarboxylase"
FT                   /note="COG0599 Uncharacterized homolog
FT                   ofgamma-carboxymuconolactone decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45508"
FT                   /protein_id="ACS45508.1"
FT                   /translation="MAGITEQPNERLKETDPQFAERMLHFADVEVARDPETELEPTTRY
FT                   LAILATLLGCQGADEFRIQLGRALDAGLTPVQAKEVVHQAVDYLGIGRVRPFLAITNEV
FT                   LEARGVALPLPDQTTTTMENRLEAGNAKQVELFGEGMDKSYERSKVNYWLADNCFGDYY
FT                   TRTGLTNLQREMITFCYLAAQGSVEPQLLAHTKANIALGNTADFLRTVVLQNLPYIGYP
FT                   RTLNALRIVAEADKAKQGAAFNLQALAWGRAVA"
FT   gene            complement(130832..131275)
FT                   /locus_tag="Balac_0115"
FT   CDS_pept        complement(130832..131275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0115"
FT                   /product="carboxymuconolactone decarboxylase"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45509"
FT                   /protein_id="ACS45509.1"
FT                   /translation="MNNYPIPVGVPTAYAQSLMFPVGEPNDAYAQYFTGRSWLAPVSGE
FT                   QVSMANVTFEPGCINHWHIHHATKGGGQMLICVGGRGYAQIEGQEPIAMTPGTVVHIPA
FT                   NTKHWHGAAPGSWFSHIAIDVPGEGKSNDWLEPVDEAFYRSLK"
FT   gene            complement(131417..132403)
FT                   /locus_tag="Balac_0116"
FT   CDS_pept        complement(131417..132403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0116"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45510"
FT                   /protein_id="ACS45510.1"
FT                   /translation="MTALELTPVWDKTFPQSDKVEHGKITFHNRYGIELAADVYKPKRV
FT                   PANGRFKAIAVSGPFGAVKEQASGLYAQTLAERGFLTIAFDPSFTGESGGSPRAVASPD
FT                   INTEDFSAAVDYLANRTDVDPEGIGIVGICGFGGLALNAAANDPRIKATVASTMYDMSR
FT                   VTANGYFDADDSAAKRNEMRTQLAKQRTEDYANGDYARAGGVIDPLPDDAPQFVRDYHA
FT                   YYKTPRGYHARSVNSNAGWNVTSSLPFMNMPLMTYIGEIENPALLIHGEKAHSLYFSKA
FT                   AYEKLEHGVNPANKELLIIPGANHTDLYDNLNAIPFDTIAGFFTRNL"
FT   gene            132538..133407
FT                   /locus_tag="Balac_0117"
FT   CDS_pept        132538..133407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0117"
FT                   /product="LysR-type transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45511"
FT                   /protein_id="ACS45511.1"
FT                   /translation="MEIRELRAFLEVAREENMTRAAGNLHMSQPSLSKLIKSLEHELGA
FT                   KLFVRRSFGLTLTKEGRVLRERARDLVGMANRIEDEFASLGNITGGTLYFGLAESYQIQ
FT                   YLARQIKILREQAPDLRYHVESGVSAQVLEHLDQGSLDFAVLAQDPDLTKYEALTFPGV
FT                   DRWGIIVPADHRLASRSYVELDDLVGEPLFCSQQGWKHEIARWAGSRMPDLRLEATFGL
FT                   AYNAAVFAREGLGVLLTFDRIVDTSADSGIVFRPLKPALETKLHLVWRRNRPLSPIAER
FT                   FLDQLRRA"
FT   gene            complement(133448..134473)
FT                   /locus_tag="Balac_0118"
FT   CDS_pept        complement(133448..134473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0118"
FT                   /product="Tas protein"
FT                   /note="COG0667 Predicted oxidoreductases (related
FT                   toaryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45512"
FT                   /protein_id="ACS45512.1"
FT                   /translation="MQYTTLGPSDLEVSRICLGCMSFGDAGNGQHSWTLDEESSRAIVQ
FT                   QALDAGINFLDTAIVYQNGTSEEYLGRALSSMAARDDVVVATKFLPRTDEEIENGVSGQ
FT                   QHVRDNLDMSLRHLGMDHVDLYIYHMWDWRTPIEEIMEGFANAVAAGKTRYIGAANIAA
FT                   WQLEKANAIAREHGWPQFISVQNHMNLLFREDEREMLPCAQEEGIALTPYSSLASGRLS
FT                   RRPGETSRRLREDSFAHGKYDAAAAMDADIIDEVRRIAEARGVTMTTVSLAWLLTKVTA
FT                   PIIGATKPHHLDGAVAAVDFELSDSEIAALERPYQPHPIVGVMAQNTKENAAVAKSWER
FT                   K"
FT   gene            complement(134530..134712)
FT                   /locus_tag="Balac_0119"
FT   CDS_pept        complement(134530..134712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45513"
FT                   /protein_id="ACS45513.1"
FT                   /translation="MRIRHGHLFTRLAIAAIAALRDAGVSVETHEMNGWPHGFGADGGW
FT                   IDQYFAPWLTTVFAR"
FT   gene            complement(134766..136061)
FT                   /locus_tag="Balac_0120"
FT   CDS_pept        complement(134766..136061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0120"
FT                   /product="ferric reductase"
FT                   /note="COG4097 Predicted ferric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45514"
FT                   /protein_id="ACS45514.1"
FT                   /translation="MKRIAIRRFPIQAVLVWAAALVVVPMPFTAIPWATLGPMYRSMLT
FT                   PITAGIYAYIWMLECVWLGCRPRWLDRIIGLPGIYVLHGVLGTGALALVVYHQYVLPSF
FT                   GPAKTTGEIAFWTLVGIVALALVMMAGWLDTLVPPLATVRSWLERVFRHEFTVWLHRIV
FT                   LVAVVLACLHFNLVFYIKDLTAFIVTMDVTTGLVLAWYAWVKLRDRMFAARGKVVSARR
FT                   VSNDIVEILVDCPAMHSWEYGDFVFLRLPRERGMHGSHPFSIANLPGEHGDAMRFAVRI
FT                   NGDFTERLYRTARAGMRVDVIGPFGMYERFIARHDAHAPIVVYAGGVGITPIIPTIMAL
FT                   SGTNRPVTVMYTAKRADDLLYADELRKWSASEAHTPHMQVGRWSKTELAEQITDGAIYL
FT                   IAGPSGMIRDVRRMLLRHGVPGSRMFYEPFTR"
FT   gene            complement(136098..136754)
FT                   /locus_tag="Balac_0121"
FT   CDS_pept        complement(136098..136754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0121"
FT                   /product="hypothetical protein"
FT                   /note="COG0716 Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45515"
FT                   /protein_id="ACS45515.1"
FT                   /translation="MNTTSTRSRGLLALLLALAMVLGFSACGSTSGSSSNSSGSSTASN
FT                   DSGNNTGTSGDTPTVTKGSNGKALIAYFSKTGTTQRAAEEIQKLTGADMFRIEPVQAYP
FT                   EEYQRTTEIARDELNQNARTQVKGKVDDMAQYDTIFVGYPIWWMEPPMPVLTFLESYDL
FT                   NGKTVIPFATSASSGIDGTLDMLRSSAKGANVTEGLRVTSNDEIQPWLQKIGVLK"
FT   gene            136744..137493
FT                   /locus_tag="Balac_0122"
FT   CDS_pept        136744..137493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0122"
FT                   /product="transcriptional regulator"
FT                   /note="COG0789 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45516"
FT                   /protein_id="ACS45516.1"
FT                   /translation="MVFMVFLSGCSRGLDALWNWSRLDVLGPERRGVIDPAFGGGSHAE
FT                   PEAVAELWIVVEFGVDAGGFGANKSSGRERYRRELVFSRLCAGSGTGQHRAYCLMIVNA
FT                   VAYGTRRDRMGATMYTMKQACELTGLSYETLKFYCRSELVPRVHRDARNHRVFDDHNIA
FT                   WIRSLVCLRRCGLGIAEMKRCVALCLEGEASIPQRREILAEKREELQHRLQDIEDSIAY
FT                   IDAKEQFYEAVLDGTTPYVSNVLGLEE"
FT   gene            complement(137546..138019)
FT                   /locus_tag="Balac_0123"
FT   CDS_pept        complement(137546..138019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0123"
FT                   /product="flavodoxin"
FT                   /note="COG0716 Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45517"
FT                   /protein_id="ACS45517.1"
FT                   /translation="MSKQLVVYISATGTTRRVAQNLAKAIDADLAEIVPVPPFTAQDID
FT                   WTDPTSRASRQHADRAMRPPISASPSADGYDEIFVGYPLWWDTAPREVRTWLESHDFTG
FT                   KTITTFATSSSSTRGALGEQLHDSAPDAHWVNGRRFAANASEAELKTWADSIA"
FT   gene            complement(138087..138875)
FT                   /locus_tag="Balac_0124"
FT   CDS_pept        complement(138087..138875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0124"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugare
FT                   pimerases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45518"
FT                   /protein_id="ACS45518.1"
FT                   /translation="MKPTHVLVVGASGSIGRHAVEKARAAGYRVRALVRDPSRIHFGCG
FT                   VEVVQGDLTSVESMRQALDGIDGIVFTHGSNGGPTLTETVDYGAVRNALEALDGRPARI
FT                   ALMTSIGVTNMDNDYNRSTEAHDWKRHSERLVRASGNEYTIVRPGWFDMEGADEHQLKF
FT                   EQGDRRDPMGPQDGSAARRQVAQTLVDALGCKEADHKTLELIDVAGTAQTDAELASMFA
FT                   ALQPDTGLDGVLDRDNFPECTQPKRVREQIARIETMRAEQ"
FT   gene            complement(138893..139951)
FT                   /locus_tag="Balac_0125"
FT   CDS_pept        complement(138893..139951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0125"
FT                   /product="alcohol dehydrogenase"
FT                   /note="COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45519"
FT                   /protein_id="ACS45519.1"
FT                   /translation="MAENMMKAAVFVEPEHVGVREVERPRIEKPTDAIVRVLKACVCGS
FT                   DLWWFRGISERPHNTLVGHEAIGIIDEVGADVHDMKPGDFVIVPFTHCCGHCEACEKGY
FT                   DGNCFNMEPGGNAGYQAEYMRATWAGTALIKIPGTPADYTDEQIASLLALSDVMATGYH
FT                   AAWSSRIEPGDTVVIYGDGAVGLCAVIGAKLLGAGRIIMMSRHEDRAALAREFGATDIV
FT                   PERGDEAVARIMEMTNGAGADRVLECVGSEQSIESAVRSGRPGAYVSRVGVPHDNSIDV
FT                   NALFWRNVSLTGGIASVATHDKSTLLKAVLDGEINPGKVFTASFDLDHVQQAYEAMDGR
FT                   RAIKSMIDIAEA"
FT   gene            140142..141041
FT                   /locus_tag="Balac_0126"
FT   CDS_pept        140142..141041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0126"
FT                   /product="LysR-type transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45520"
FT                   /protein_id="ACS45520.1"
FT                   /translation="MDIRTLRHFVAVVQEEGISAAADVLRMSQPALSRQMKELENELGV
FT                   TLFERGNRGRSISLTKEGRVFYRRARQIIELADRARAEVHMHDEIAGTIHITAAESNLM
FT                   NIVALAIAQTRLLYPRITFDIHDDNGPNNVERLNNGIADFAVIMQPIDMTRFDHLSLPG
FT                   ANPLGIGMRADDPIAANETITNELIRDMPLITSTGANQRRDLSGWLTQGTTLNIVSHVN
FT                   LAYNAACLVRNGVGYMLTVNDLTEFSDPEHDLVWRPLDPPLDIRLSVIWRKDRDLSRVC
FT                   QLFLQQLRTVITQIRTAQ"
FT   gene            complement(141044..142354)
FT                   /locus_tag="Balac_0127"
FT   CDS_pept        complement(141044..142354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0127"
FT                   /product="polysaccharide deacetylase"
FT                   /note="COG0726 Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45521"
FT                   /protein_id="ACS45521.1"
FT                   /translation="MDREDHVAGKDAERIPDYENEEAGRAEFEHEVEDLSFGDNVHAPK
FT                   PKHRHPALFSAVTTLIVLLVLALGAGAWYMWQYHWRTLSIEVDGTAYSAKADTTVAAFM
FT                   RDHRDFERKPGRLLSVEGKVLEPSGGNTVSVKFDGKQIEPADWDHTRFEKNGTLTVTPG
FT                   TDLTEEHTVEQRKVPFKTDINLNGGPVQIVTQQGEDGLQEFWVGRQSKKTAAKTVIRKQ
FT                   EPLIVKSFAPRPEGKKVIALTFDDGPSIYSDKILDILKQNKVKATFFELGEQSLEFPKV
FT                   EQRIVREGHQIASHSVSHPYFPNMSAQEQRQEIESSLSDIKKASDVSTRTFRAPYGAFG
FT                   VDEWKNNATLIDRNVLWDVDTLDWKRPGEKQITKEVVDYVHNGAVVLMHSGGGDRSQTV
FT                   KALPEIIKQLKKKGYSFVTIDELCKMAGLPEAAEPSR"
FT   gene            142498..143562
FT                   /locus_tag="Balac_0128"
FT   CDS_pept        142498..143562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0128"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="COG0191 Fructose/tagatose bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45522"
FT                   /protein_id="ACS45522.1"
FT                   /translation="MSIATPEQYAHMLDAARAGGYAYPAINVTSSQTLNAALQGLADAE
FT                   SDGIIQVSVGGAAYFSGQRVNNRVTGSLAFAAFAHEVAKQYPNITVALHTDHCAKQYLD
FT                   EWVNPLLDIEIDEVKHGREPMFQSHMWDGSTVPLKENLDIAEKLLEKSRLAHTVLEIEI
FT                   GAVGGEEDGHSAEINEKLYSSVADGMAVADRLGLGERGKYMAAFTFGNVHGAYKPGVVK
FT                   LRPELLHEIQQGVWNAAKSGELNAVLNSDMPDGKPFELVFHGGSGSTAQEIAEAVSYGV
FT                   IKMNIDTDTQYAFTRAVAGHMFRDYDGVLKIDGEVGNKKQYDPRSWGREAEDSMAARVV
FT                   EACEELGSAGRALK"
FT   gene            144115..145401
FT                   /locus_tag="Balac_0129"
FT   CDS_pept        144115..145401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0129"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="COG0104 Adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45523"
FT                   /protein_id="ACS45523.1"
FT                   /translation="MPGIVLIGAQWGDEGKGKATDLIGTKVDYVARFNGGNNAGHTVVV
FT                   GDESYALHLLPSGIISPTATPVIGNGVVVDPEVLLEEIEGLESRGIDCSRLLVSESAHV
FT                   IAPYHRMIDKVTERFAGKKKIGTTGRGIGPAYADKINRVGIRIADLFHEDVLRDKVSNA
FT                   LHQKNQMLVKLYNRRAFDVEATVQELLEVGVKLKPYVANTSLILNNALDDGKTVLFEGG
FT                   QATMLDIDHGTYPFVTSSNPTAGGACTGTGVGPTKIDRVIGVSKAYVTRVGEGPFPTEL
FT                   FDENGEWLRAQGHEYGVTTGRPRRCGWFDAVVNRYATQVNGLTDIVLTKLDVLTGLDEI
FT                   PVCVAYDVNGVRYDDMPTDQSAFAAAKPIYGMMPGWSEDISQVHAFEDLPQTCQDYVKR
FT                   LEELSGCRISAIGTGPQRDHIIEVHSLLD"
FT   gene            145542..146474
FT                   /locus_tag="Balac_0130"
FT   CDS_pept        145542..146474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0130"
FT                   /product="hypothetical protein"
FT                   /note="COG0239 Integral membrane protein possibly involved
FT                   in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45524"
FT                   /protein_id="ACS45524.1"
FT                   /translation="MTTRPEHLTHADATSPGDVDASSAAAEPGDSDAHLHLYDSQSFSP
FT                   ATGAPHEPVTPDFRKEMLQPHPTGAAAARRPPSIPLSPRKRMQAKFNPLADGMMYLVIF
FT                   IGGMLGTVLRYSLWLLWPQPLSKGGLLMAFHPATLIANLCACFIFAVLVSYMSQAVWVK
FT                   KRTRQLANGGFGMGMCGGFSTLSAMMVEDITSLHSHSYLGFFLYTLFTFVAAFAIAWFG
FT                   SWLGLRLARKRTGMHVRERMETVRKPAIGVRVPTANGVQMTPSAGDDPNPSTDELPIIS
FT                   EEEHLDLLADPHMVEPLQRTAGKRDGGAR"
FT   gene            146474..146848
FT                   /locus_tag="Balac_0131"
FT   CDS_pept        146474..146848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0131"
FT                   /product="hypothetical protein"
FT                   /note="COG0239 Integral membrane protein possibly involved
FT                   in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45525"
FT                   /protein_id="ACS45525.1"
FT                   /translation="MGTFLLVCICGGLGAVARFMLNTSIQRWWHRAYPLSTFIINIIAA
FT                   LCAGTAAAAYFYQTVNYSTYLLFVAGFLGGFSTFSTAINEMVSLTRTRQLAVAAFYFLT
FT                   TLVVPFCAVVLGWFFGSIGH"
FT   gene            147437..148873
FT                   /locus_tag="Balac_0132"
FT   CDS_pept        147437..148873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0132"
FT                   /product="branched-chain amino acid ABC-type transport
FT                   system permease component"
FT                   /note="COG0559 Branched-chain amino acid ABC-typetransport
FT                   system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45526"
FT                   /protein_id="ACS45526.1"
FT                   /translation="MASMVSQPQRRAERGRRRKGLAIVCAGIAGLLLAMLASMIGVPNA
FT                   VAAEAVDKCVPNAEHGCVSGILQTQDKTPIPDVTVTLGGEEEATATTAEDGAWAFEVNA
FT                   DGEYTVSIDKAVAEKYKLGESGATVEIAKKSFSKQRAVVRFDKAAAGSAAETESGNADS
FT                   AKSGEQTAANTAQAGDDGKGSGFWSRFWQQLYSGCIFGLMLGLMAVGMNLVYGTTGLSS
FT                   FSHGEQVTLGGLMAYVGTQMLHMPVVLSAIFAVAIGALAGWVQNQLVWAPLRHKRVGVM
FT                   QQMIVTIGLSMALQYIYQFFFGGDIKGIVKSVPEGIQLGPIVTNAPTLIAAAIALVTIV
FT                   SVTVFLYCTRLGRATRAVSDNAALAAASGINVDSVVRIVWILSCGLAALSGVLIGIHLN
FT                   GIAWNTGVTLLMLMFAAVTLGGLGTANGALVGALIVGIVADMSTLVIPSDMRYASALAI
FT                   LILVLLIRPQGIFGKQKRVG"
FT   gene            148877..149860
FT                   /locus_tag="Balac_0133"
FT   CDS_pept        148877..149860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0133"
FT                   /product="branched-chain amino acid transport system
FT                   permease protein"
FT                   /note="COG4177 ABC-type branched-chain amino acid transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45527"
FT                   /protein_id="ACS45527.1"
FT                   /translation="MDFMTILSNILGELFAPTTAAYALAAIGLNIHFGMSGLMNMGQAG
FT                   FMLLGAYGFAITQMNGCDLFTSVLTALVLAAIYGILLGIPTLKLGPDYLAMVTLAAAEI
FT                   IRIVGRSTSLTWLTGGSAGIAPQNFTEKFENASPLPNGSTKFLLWTYNNNIANSWWLRI
FT                   VAWVLVAIALLLCWRWFHSPWGRVLKGIREDENAIRSLGKSVTKYKMQALILGGLFGAI
FT                   AGIVFILPRSLNPDSLGRTVTFYTWTILLLGGAATIMGPVLGSCVLWVLLTAVKETMRV
FT                   TIPTTVVSSNQIEALGWVIVGVALMLLVIFRPQGILGNKKELAFNG"
FT   gene            149853..150860
FT                   /locus_tag="Balac_0134"
FT   CDS_pept        149853..150860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0134"
FT                   /product="branched-chain amino acid transport
FT                   systemATP-binding protein"
FT                   /note="COG0411 ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45528"
FT                   /protein_id="ACS45528.1"
FT                   /translation="MADTTDKTSETTAAGSTATVKEPFYDIAKWATKAPEGEKLISTAY
FT                   GDKVTEDLRYVKNEPGVHKPDPILVADNVTRRFGGMTAVDVRHFEIERHGITALIGPNG
FT                   AGKTTFFNLMTGFDTPNTGTWQFDGKDMAHVNPEKVARGGMVRTFQLTKVMSRLTVLDN
FT                   MMLGAQSHPGEGMFRSLFPGAWKKQEKENREKAEALLDRFLLYKKKDDYAGALSGGQRK
FT                   LLEMARALMCDPKLVMLDEPMAGVNPALKQSLLDHIISLREDGTTVLFVEHDINMVRHI
FT                   ADWVTVMAEGKIVAEGQPKTVMDDPAVVDAYLGAHANIDLGDDSVLEGLEGGNA"
FT   gene            150853..151668
FT                   /locus_tag="Balac_0135"
FT   CDS_pept        150853..151668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0135"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /note="COG0410 ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45529"
FT                   /protein_id="ACS45529.1"
FT                   /translation="MPDTATLTPTEAPDVSTLDRSHIHAGEPLLDADNLVAGYLPGVNI
FT                   LNGASLTLHDGEIVGIIGPNGAGKSTLLKSLFGLVHIHSGKLTLKGQDITNLRADKLVS
FT                   RGVGFVPQTENVFPSLTIAENMHMGAYQAPKLFNERFDYVCSIFPKLGDRRNQLAGQLS
FT                   GGERQMVAMGRALMMQPSVLLLDEPSAGLSPMMQDETFIRVRQVNKAGVSVVIVEQNAR
FT                   RCLQICDRGYVLDQGRNAYSCRGRDLMNDPKVISLYLGNLEEEVEKENK"
FT   gene            151811..153076
FT                   /locus_tag="Balac_0136"
FT   CDS_pept        151811..153076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0136"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683 ABC-type branched-chain amino acidtransport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45530"
FT                   /protein_id="ACS45530.1"
FT                   /translation="MRLANKMKMLTAMTAAALLALSGCGSSGGASGGSSNSVASSGDGM
FT                   VIGALLPLTGTLAYLAPPEVAAIKLAISDINKAGGVLGKDVTEVEADTSDGEHADQNTS
FT                   AAQSVLSKHPSVVIGPAASGVVKNVYKSIVAEKIPVISMASTSMTLSGMDPYFFRTVAP
FT                   DAVQGAVMGDLIAQDGVKKLAIACFNDEYGTGMRDIILQKLKDAGVDVVYGEKDAFDPA
FT                   ETNYSSIATAIKNSGADATLIISYDQATPLIKALASAGVDTHKLYLVDGNTVDYSKTYD
FT                   AGLLKGSKGTIPGTHVDDKFKSDLKGTGTDISDTTYAAETYDAVILAALAAEQGGSTSG
FT                   ETVAKNLSSVSGADGGEKCESFEACKALIKDKKKIQYFGKTGIGPFNKNNDPSSANIGI
FT                   FEYDGNNVNVFQDMQSGDVPTE"
FT   gene            complement(153154..154182)
FT                   /locus_tag="Balac_0137"
FT   CDS_pept        complement(153154..154182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0137"
FT                   /product="LacI-type transcriptional regulator"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45531"
FT                   /protein_id="ACS45531.1"
FT                   /translation="MVGMRDVAKRAGVSVSSVSLVINGTGYVSRDMREKVEQAMRELDY
FT                   VPNELARNFYHGKTDIIGVIVPTIQHPFFATLTAHLQHEFADRGLQTMLCSTADSANGE
FT                   AQYVDMLRRHSLDALVVAAHTTHDPQYWRAIDRPVVAFDRNLGAGITQVSSDHVHGGEL
FT                   IAELLVRTGAHHVVMVGGPRAQFTDLGDHSTFPTVRYVQTLEDRLSQARIAHTYIESGE
FT                   VFDIAGVRRAVREAFDTYPDMDAFVGADLAAAFAVQEAVSRSIAVPGDVQIIAYDGTLA
FT                   ADCAGMPLTTVAQDFRQIAHTIAACVEHGIESSPQRPDATDGDANMTIIPVTLHERATT
FT                   RR"
FT   gene            154489..156009
FT                   /locus_tag="Balac_0138"
FT   CDS_pept        154489..156009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0138"
FT                   /product="Maltooligosyl trehalose synthase"
FT                   /note="COG0366 Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45532"
FT                   /protein_id="ACS45532.1"
FT                   /translation="MKNKVQLITYADRLGDGNLASMTDILRTRFDGVYEGVHILPFFTP
FT                   FDGADAGFDPIDHTKVDARLGDWDDIAELAKTHDIMVDAIVNHMSWQSKQFQDVLANGE
FT                   DSEYYPMFLTMSSVFPDGATEEELAGIYRPRPGLPFTHYSFAGKTRLVWVTFTPQQVDI
FT                   DTDSAKGWEYLMSIFDQMSKSHVKYIRLDAVGYGAKEAGTSCFMTPKTFELISRLREEG
FT                   AKRGLEILIEVHSYYKKQVEIAAKVDRVYDFALPPLLLHSLFTGKVDALAHWTEIRPNN
FT                   AVTVLDTHDGIGVIDIGSDQLDRSLKGLVPDADVDNMVETIAKNTHGESKAATGAAASN
FT                   LDLYQVNSTYYSALGCNDQHYIAARAVQFFLPGVPQVYYVGALAGENDMELLKRTNVGR
FT                   DINRHYYTTSEIDKNLERPVVKALNALARFRNELPAFDGDFSYSVGDDESIAFSWNGFG
FT                   SSATLTFTPSKGMGVENPQSVATLVWTDSTGEHRTDDLIANPPVMQAS"
FT   gene            156066..157679
FT                   /locus_tag="Balac_0139"
FT   CDS_pept        156066..157679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0139"
FT                   /product="membrane protein with transport function"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45533"
FT                   /protein_id="ACS45533.1"
FT                   /translation="MVDEQDTHGGSAPSTGSNGYIRPGIDDRPDFDKVLSQEDKENISR
FT                   LTAPMPKKRAADSSVGDEQVQGTKLATDSQAVGSGMAALAAVDTAVPDEASAFMDMRDP
FT                   MVSADGHRPTKAELVRLGIGFTVSAVACAIPWVALSTVILPRVFELIDNSSKEAMLGLV
FT                   NSIGAIVALLANIIFGTLSDMTRSRFGKRTPWIVGGGIITGLAIGAIAFTRNEALIIFL
FT                   WCVAQMGYNMMLAPYVAVMSDRVPDKVRGTISGFYGAGIAVGQTLGSVVGAAFLRQGQS
FT                   GLFSAWMMGLGIFSLTGIFVVAMWPREKSSRFEEQSEHVTVKSVLLNFRPPRHAPDFYY
FT                   ALVGRTLMMGGYWMITTYQLYIAQDYIYAGDPNAKDKAATIIATMGVITLVVSLIAAVT
FT                   AGPITDRLGRRKLPVALASCLFAVGAAMPLFFRSPMGMYLFAAVAGLGYGVYNAIDQAL
FT                   NVAVLPNPKEAGKDLGILNLANTLSTVIGTAMTSLVVSIVKSSMHVSTTPAVAYAWVFG
FT                   VAIVIVLAAAALIMRIRNVK"
FT   gene            157945..158664
FT                   /locus_tag="Balac_0140"
FT   CDS_pept        157945..158664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0140"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683 ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45534"
FT                   /protein_id="ACS45534.1"
FT                   /translation="MNNAKIKSWMVTATAMAAAAMLTLSGCGSGAESKADADEATFTAA
FT                   GLLPLTGSMAYLGPANIATMKLAQNDINAAGGVLGKDIDIVSADTSDADHADQNTSSAQ
FT                   SVLAREPSVVVGPPSSSVVKNTFKQVTSSQVPMISSGATSTAFSGLNDYFFRTIPPDTV
FT                   QGVVLGQIIVQDGVKNLAIAVFNDEYGTSLRDVVAKTVGDAGVNVVYGEKETFDPTETS
FT                   FSSMVTNIKSTKPDALR"
FT   gene            158700..159998
FT                   /locus_tag="Balac_0141"
FT   CDS_pept        158700..159998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0141"
FT                   /product="biotin carboxylase/biotin carboxyl carrier
FT                   protein"
FT                   /note="COG4770 Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45535"
FT                   /protein_id="ACS45535.1"
FT                   /translation="MRLADEAYALGAAETADTYLNIDAMASAAVRAHADAVHPGHGFLA
FT                   ENADFAQAVIDAGMVWVGPKPETIRVLGSKVAARRIAAEVVEFAREHGLPIAIKAVYGG
FT                   GGRGLKVVHEPDEVAAAFESAMHEAEVAFGNGDCFVERFLARLWHVEVQVLGDQFGTVL
FT                   AVGTRDCSLQRRNQKLIEEAPAPFLAAETVRELERAAVAICSRAHYESAGTVGFLVDDG
FT                   TMSFMEVNTHIQVEHPVTEAVTGVDLVAAQLAIAEGAPVEAVPGLESGVTPEPRGGHAM
FT                   EFRINAEDPSLGFVPFPGVVESLQVPTGPGIRFDSGVAAGDSISSRYDSMIAELIVKAS
FT                   TRAECLRRAERALAELHIHGVPTVVPFDKAVLESADFGAGADWRADDDVSNANFRVYTR
FT                   WIEEELLPNLPSETLEDWRRAGERAMGERRRAG"
FT   gene            160347..161306
FT                   /locus_tag="Balac_0142"
FT   CDS_pept        160347..161306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45536"
FT                   /protein_id="ACS45536.1"
FT                   /translation="MGSITDWSKYPRISRIATAAAADVGRGSETLMTYVRGDLFRSARH
FT                   LALGTEQPRRARRENRRKTKRPARALVVTGFYIPQAQQPAAETDGPLGALEVCMALRAV
FT                   GGDAWLISDEHCAPVICAAAGDLLPEDRVLIAPHAKPEFDAWFNMVIDLVKRHGIDTLV
FT                   FIERVGPARDGRPRNMRGVDIAEWTAPLSQLALLELHTIGVGDGGNEIGMGRVADYAIS
FT                   GVVAHGESIACTVAADQLVVAGTSNWGAHALVCAMRALGCPQVEPYLEPDWHRAVLDAI
FT                   VAAGGLDGVHMTNVPTVDGLDPARYFGTVAQLSAFARH"
FT   gene            161412..163001
FT                   /locus_tag="Balac_0143"
FT   CDS_pept        161412..163001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0143"
FT                   /product="Na+/sugar symporter"
FT                   /note="COG2211 Na+/melibiose symporter and related
FT                   transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45537"
FT                   /protein_id="ACS45537.1"
FT                   /translation="MSNESKNSNDSAVPQSQQSEPQTPRTFPKSNYIRPGIDDRPDLDK
FT                   ALSAEDKSAVARLAVRQKPVTAPPAATHPEVQAAALADAAGLSHPASDEPIPDVESAFF
FT                   DLRDPMVDSTGYRPTHTQVLRMKSGFAAASLLLSFAMVALTVVLVPLRLDEFGGAFDGT
FT                   VNLAVLIGVGIVVAMFMTAFASAMSDRTRASLGRRTPWLIGGTVVATLFAFALSACHTN
FT                   VAMILVWVFMQLGYAVMAMACSAMVGEMVPDKFRNAVATWRNVAMFAGSLAGAAFAAGM
FT                   ADHVEAAMDICAGAILAAGVVVLFVPPREHSSEYLHVTPLDEDKLLVAFRAPQGVRHWG
FT                   VIAVIRLLVSATLAVSITYVGFLVRYEHGVHAPNSLQYTAVTIAAMAVVAYVLAAISSV
FT                   LLDPITSRFSSARAPLALASTVMLLASICGIAMPNRAGLILFAAFGGCALAMLDSLAQT
FT                   QALHAIEDLQHTGHVLAVLHSLDSVGRLLGVVVGAIVVVAADAFAPLFIVAGVLALALL
FT                   VVVLCTSSRLAD"
FT   gene            complement(163021..163527)
FT                   /locus_tag="Balac_0144"
FT   CDS_pept        complement(163021..163527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0144"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45538"
FT                   /protein_id="ACS45538.1"
FT                   /translation="MTAMPFTRPERAQCPVDFTGFDCGEQQINDWLKHHANASNKNGSA
FT                   ALYLSYDHETNELAGVYTLSSTTVARDETYAPWMRRNSPILVPAALLGQLAVANHFQHR
FT                   GLAKALIRDAVDRTLQLSLTIGIRALVVDPLNSNLTMFYDSLGFEGFNGETRMYFRMPN
FT                   YPRTL"
FT   gene            complement(163524..163808)
FT                   /locus_tag="Balac_0145"
FT   CDS_pept        complement(163524..163808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0145"
FT                   /product="hypothetical protein"
FT                   /note="COG4453 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45539"
FT                   /protein_id="ACS45539.1"
FT                   /translation="MPYNIVMATMTRTARIDMRLTEEEKRLIEQASAATGSRLTTWCIN
FT                   NLINDAKRDLHANAIIRLSDEAFDRFVENLDRPLTEKQQQFLAYQPEWA"
FT   gene            163938..164066
FT                   /locus_tag="Balac_0146"
FT   CDS_pept        163938..164066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45540"
FT                   /protein_id="ACS45540.1"
FT                   /translation="MGEGKPDCEKYGDARGDSAGAGERGLIALEAGGKRRERENDA"
FT   gene            164817..166208
FT                   /locus_tag="Balac_0147"
FT   CDS_pept        164817..166208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0147"
FT                   /product="transmembrane transport protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45541"
FT                   /protein_id="ACS45541.1"
FT                   /translation="MTAVETETEAGRRAPALAGERAHALRRAGKSSVGTIIAASMVGTT
FT                   IEFYDFYAYGTAAANYFPRVFFSDATNPTVALLLSLVTFAVAFLARPVGSLIFGHFGDS
FT                   IGRKATLVVSLMTMGVATFLIGCLPGYDMWGVWAVLALCVCRFVQGIGLGGEWSGAALV
FT                   ATENAPANKRALYGSFPELGAPIGFFLCNGTYVLLELFNDDAAMLAWGWRVPFLLSSLL
FT                   VVVGLLVRVHMEETPAFRAAKQDQRVVKAPALEVFRTSWRQVLQATFLVAVTYTLFYTL
FT                   ATWSLAWATKSDAQGGGGLGFSTKEYMTMLMVSVCVFALFIVLSCVFADRIGRRRVIIG
FT                   SSVALLAFAALFPLLMNRAVVGVHNTAAAMLFLCLGFALMGIAFGPIGALLPELFSVNV
FT                   RYTGSGIGYNIAAIVGAAFVPSVATWLSSHWGVGSVGLYLGVMALCCLVAILTCRETKN
FT                   VDYMQ"
FT   gene            166619..167671
FT                   /locus_tag="Balac_0148"
FT   CDS_pept        166619..167671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0148"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="COG0059 Ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45542"
FT                   /protein_id="ACS45542.1"
FT                   /translation="MAAQIWYEDDGDLSVLDGKKVAIIGYGSQGHAHALNLRDSGVDVV
FT                   VGLRPNSKSVEFAKEQGLEVKSVPEAAAEADVIMILAPDQYQKGIWENDIEPNIKPGAA
FT                   LAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYVAGRGVPVVTAVEQDPRGDGW
FT                   DLALAYAKALGALRAGAIKTTFKEETETDLFGEQNVLLGGVNKLVEMGFEVLTDAGYQP
FT                   EIAYFEVCHELKMIVDLMNEGGLNKDRWSCSDTAQYGDYVSTVIDEHTRERMQYHLQRI
FT                   QDGSFAKEFMDDQAAGAPKFKQLQEEYSNVRIEEVGPKLRAMFSWNNDAAKDADEANSF
FT                   TGKIARAQVQ"
FT   gene            complement(168306..170003)
FT                   /locus_tag="Balac_0149"
FT   CDS_pept        complement(168306..170003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0149"
FT                   /product="sialic acid-specific 9-O-acetylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45543"
FT                   /protein_id="ACS45543.1"
FT                   /translation="MTTVTGIAPGASGMAEPTSDNDGAHDRTRSGNLRVDAIFSDHMVL
FT                   QRGKPIAVFGEAPAGEVVAAFLTDARGQEIAQSENHANGDGTFMLTLPALPAGGPLALR
FT                   VRCGADELVFHDVMVGEVWLAGGQSNIEFELHNSEFGKEAVADAHDPLLRFYNTPKSAR
FT                   VNLATESASGWQTAEAPQVAHMSAIGYYFGKQLRDALANGIAVGVVDCYIGGTSISAWM
FT                   SEHLLEQTGLGRKYLQAYRDAIAGKTDEEMLAAQTAWQQVFDKWNADVAAVKEEHPDYS
FT                   QPQIDAMLGPCPWPPPVTPFAERRPYALYEAMIRRVAPYTLAGILWYQGEEDELNAAGY
FT                   GELLRGLIAEWRTTWHDDALPFLVVQLPQWIAAANAEHDPLRWPVLRDEQFTVARETPH
FT                   TNIVCAMDCGEFDNIHPVDKRTLGMRLGDTALHDVYGLQIPCASPELVDLQVSEGGGEM
FT                   VATFNHAQGLHWHGTTPDSMRAIADIAESTERKAGESGFEIAASADSEFVPAHARIEPS
FT                   DDLGSDMRVVHLFSPEVPKPTHARYAWRSWGPAPLFNDDGLPAFPFAK"
FT   gene            complement(170427..171524)
FT                   /locus_tag="Balac_0150"
FT   CDS_pept        complement(170427..171524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0150"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45544"
FT                   /protein_id="ACS45544.1"
FT                   /translation="MQFIDAFNPAFRTMGRIGESKNHLPLWVFPYTQARFRFTGTSLAV
FT                   RLRNFWNYGHTRIGVIIDNTQFSVRVPSPVEPEPDAAVSVGEDGMLTIRIASHLPNIEH
FT                   RAIVFKREDGGMHYMEFAGVEIDDDAQILAPAEPASTRRIEVYGDSVSCGERNEAVLCT
FT                   GKADPDEDLSAYSNSWFAYDAIAARALGADLRIISQGGAPLLDGIGWFNAPDYLGMESI
FT                   WDRVQYNPALGEPTDWDFRDDDPQVVIVALGQNDSHPYDFMAADYTGEQAANWRARYAE
FT                   FLGDLLERYPDAHIICTTTVLQHDRNWDRAIDEVVSELDNPQITHFDYSRAGTGTPGHP
FT                   RIAEDEEMARELVAYIDSFGAELWQ"
FT   gene            172048..173430
FT                   /locus_tag="Balac_0151"
FT   CDS_pept        172048..173430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0151"
FT                   /product="putative beta-glucosidase"
FT                   /note="COG2723Beta-glucosidase/6-phospho-beta-
FT                   glucosidase/beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45545"
FT                   /protein_id="ACS45545.1"
FT                   /translation="MTMTFPKGFQFGTATAAYQIEGAVDEDGRTPSIWDVFSHAPGRVL
FT                   NGDTGDKADDFYHRWQDDLKLVRDLGVNAYRFSIGVPRVIPTPDGKPNEKGLDFYERIV
FT                   DQLLEYGIDPIVTLYHWDLPQYLNEDPYRDGWLNRETAFRMAEYAGIVAKRLGDRVHTY
FT                   TTLNEPWCSAHLSYGGTEHAPGLGAGPLAFRAAHHLNLAHGLMCEAVRAEAGAKPDLSV
FT                   TLNLQVNRGDADAVHRVDLIANRVFLDPMLRGYYPDELFAITKGICDWDFVHDGDLKLI
FT                   NQPIDVLGLNYYSTNLLAMSDRPQFPQSTEASTAPGASDIDWLPTDGPHTQMGWNIDPD
FT                   ALYNTLVRLNDDYDHIPLVVTENGMACPDEVEVGPDGVKMVHDDDRIDYLRRHLEAVHR
FT                   AIEEGANVIGYFVWSLMDNFEWAFGYDRRFGLTYVDYDTEERIRKDSYNWYRNFIAEHS
FT                   AK"
FT   gene            173860..174597
FT                   /locus_tag="Balac_0152"
FT   CDS_pept        173860..174597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0152"
FT                   /product="beta-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45546"
FT                   /protein_id="ACS45546.1"
FT                   /translation="MKVKKIAAIALASACAFSMAAVDFNGHRKPVWYASRDFFAPRLAT
FT                   IQPRTSEEYRETHSWEGVKVDADHLELIVLNDTNEPYKGSWAVNRVDFDGNVLATQQID
FT                   DVELDAASHKGFPLNEEIVDFGDANNELIVAVPSDDSFARVIYNPAEILTQELDAPADA
FT                   FTTKAKRTADGVELTVTANDYVRDLFCMVGKVDDKATVEEGLVSLLPGESVTFHIGTDY
FT                   AGDPADFAAANVLRSANDLKRDF"
FT   gene            174854..175882
FT                   /locus_tag="Balac_0153"
FT   CDS_pept        174854..175882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0153"
FT                   /product="LacI family transcription regulator"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45547"
FT                   /protein_id="ACS45547.1"
FT                   /translation="MVAQKAKVTIFDVAKASGVSSSAVSYALNGKPGVSDATREKVLQV
FT                   ARKLGWRPNGAAQSLAQSRTRRIGLVLGYDPQLLSAEPYIMRLISGLGSALEERDYSLL
FT                   VRMSMDDDDEVSILEDWIATGNVDALLLLNLEIGDPRIELMKNNPQMPCLALADSSLTS
FT                   GLPTLMSDDAAASGTMIRHLALFGHKNIARVAGPEELGHSYIRDAAFSEITTELGMRYR
FT                   CLHTDYTPESGAEATKRLLSVEPRPTAIIYDNDVMALAGESVASVKGVRVPEDLSIISW
FT                   GDSFMNVAAHPPITALSRNILESGRLAAQLMLKLIDGEDVENVEEPPYELIERASTAPA
FT                   AQ"
FT   gene            complement(176166..176801)
FT                   /locus_tag="Balac_0154"
FT   CDS_pept        complement(176166..176801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45548"
FT                   /protein_id="ACS45548.1"
FT                   /translation="MIAGGIFRQDNPYNTVMNRIGDIAMLSVAWFVCCLPVVTIGVSTA
FT                   AACEVAREMQEDRDNGIFKGFWRAIKRRFGTGMLLTLFLGVLIALGAFDLWWISRSMAG
FT                   DMASVLYGVTLAVFIIVAMLFAFLLPLSGRSKLSAGEQIKQSAKLATMKPFIALVVAAI
FT                   YALPIVLLATLPSAVMWVPLVWCIFGGGASAWAQMWLIRRAFDLQPQD"
FT   gene            complement(176885..177616)
FT                   /locus_tag="Balac_0155"
FT   CDS_pept        complement(176885..177616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45549"
FT                   /protein_id="ACS45549.1"
FT                   /translation="MEGKQPKLTPEQREAIDTLSSTPQYQGESKIKIFMKIPAKDKAAY
FT                   SRTHFLVPLLAAVIVIALGTFVIVRLVSPVPRPALYAAAVSGSTPMGEADKLKDDYAKK
FT                   LGKDVIIDDYFDMNKDGLSKLQTMIGNEQIDVVIAPHDVFAKLASFGYFDNLKTTLPAA
FT                   EYAKVGKYAMAFHGFDDSRVTDAIDESGSGQGKSEPYGLLLEHAPRWDRIEGADDDALV
FT                   GIAANTQQLDTAKNFIQYLYN"
FT   gene            177915..178076
FT                   /locus_tag="Balac_0156"
FT   CDS_pept        177915..178076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45550"
FT                   /protein_id="ACS45550.1"
FT                   /translation="MYDEGPHIVLRRDGVCIVAKTPDGDMPQIEYWGRDFAFDTAGDAL
FT                   RQLDMRAI"
FT   gene            178390..179655
FT                   /locus_tag="Balac_0157"
FT   CDS_pept        178390..179655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0157"
FT                   /product="hypothetical protein"
FT                   /note="COG2942 N-acyl-D-glucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45551"
FT                   /protein_id="ACS45551.1"
FT                   /translation="MANTDPKYQIGTPENKKFLDISRDNLIAFGRRFPAVDGSSYWLGD
FT                   DGTPWKDRNRATWITCRMTHVYSLATLLGVDGAAELVDDGIRGLRGVLHDEEHDGWYAE
FT                   ITPDICHMPTKQAYAHAFVLLAASSALLAGRPGAKELLEQAENVYLTKFWDDKIGLSVD
FT                   TWDTDFAELDTYRGLNANMHSVEACLAVADVTGDESWRTRAGRIIEHVLKWAEENNWRI
FT                   PEHFNSDWEPELEFNADKPDDQFKPYGATPGHGIEWARLITQYALSVYGKDGVLNGDGK
FT                   KYLDAAEHLFNRAVEDAWNADGAPGIVYTTDWDGKPVVHDRMHWTLAEGVNTAATLYHV
FT                   TGKKEYADWYATFLEYIDTYLMDHKNGSWFHQLNRENEVIDTVWPGKSDLYHATQAMMI
FT                   PLRDPALSIAPATKKGVEEGLN"
FT   gene            180183..180923
FT                   /locus_tag="Balac_0158"
FT   CDS_pept        180183..180923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0158"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG4619 ABC-type uncharacterized transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45552"
FT                   /protein_id="ACS45552.1"
FT                   /translation="MGSMSSAHDFHATGVTAVVNNDAGGTRTIFKDLSFAVHGGEIVDI
FT                   TGPSGSGKSTLLTSFARLNVNTTGKFVLDGVDSDTLSPQQWRERVAYLPQTSVLIGDNV
FT                   ADAIRLPWSLKIRVSQDHEAAEQKLPDSLIRSTLDSLGCDDIDLARAVQDLSGGQAARV
FT                   SLTRTLLTHPGVLLADEVDAGLDEENADKVADILRKAADNGTAVVRIRHRKPDGRANRI
FT                   MVLANGTISPLKTAQSAPSTHTEV"
FT   gene            180925..181791
FT                   /locus_tag="Balac_0159"
FT   CDS_pept        180925..181791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0159"
FT                   /product="hypothetical protein"
FT                   /note="COG0390 ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45553"
FT                   /protein_id="ACS45553.1"
FT                   /translation="MQQYFAIDNWGLLIAVLMVCIAAGVSALMKLGVAKSLLWATARSL
FT                   VQLLAMGFILEYVIRAQNVWLVIGLIVVMLVAAAQITMSRAKGIPKGLVPLVLLSLAVT
FT                   MLLMLALVGELVIRPNPWYSPQLIIPLTGMLLGNTVSALALGLSRFFNSMRERYEEVNT
FT                   LLALGATPWEAAKPSITSSITLGLLPSIAMLASSGIVTIPGMMSGQIIAGQNPVNAAKY
FT                   QFVILAAVSALTLLADSIILALVYKRCFISYDRYFVPPARDSVSTLDRIRRQAAERANR
FT                   GPESAGE"
FT   gene            181944..183440
FT                   /locus_tag="Balac_0160"
FT   CDS_pept        181944..183440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0160"
FT                   /product="aromatic amino acid transport protein AroP"
FT                   /note="COG1113 Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45554"
FT                   /protein_id="ACS45554.1"
FT                   /translation="MSASHGAGERNADPQQLHKSLKNRHIQLIALGGAIGTGLFYGSSE
FT                   SIALAGPSILLAYVIGGAAIFVIVRAMSEMSVEEPKAGAFSYYASRYWSKRAGFISGWN
FT                   YWFNYVLVSMVELAVVGSFVNYWFPNIPQWASAAFFLVLITLLNLFGVSEFGEFEFWFA
FT                   LIKIVAVIAMIAGGLWVIVANLPTDSGVRASFANWFTVDGGFFPHGAMSRAADGHWDGL
FT                   LMALVVVMFSFGGTELIGVTAGEVENPSKTIPRATNGIIWRILVFYVAALGIIMAVVPW
FT                   DRIDGKMSPFVQIFDSVGVPVAAGILNFVCLTAVMSVYNSALYSNSRMLFSLARQGNAP
FT                   AYLGRVNKRGVPVAGVLTSAAVTVVAVVVVFLWPQFAFNYLMSIATIAAIINWTMIMIT
FT                   EMLFRRRVAAGDGPGELNGLRGAEALAKIRFKLPGWNWTPYVIIAFLAMVAVLMCFSPS
FT                   YRIALIAGVIWLAVLFAAYAITSRASAKRDAKTVLDSTRK"
FT   gene            184022..184723
FT                   /locus_tag="Balac_0161"
FT   CDS_pept        184022..184723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0161"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45555"
FT                   /protein_id="ACS45555.1"
FT                   /translation="MAYIEFNDVVKEYPAGSSSIRALDGASFAADEGELSVILGQSGAG
FT                   KTTALNILGGMDTATSGRVIVGGRDITDLNHHDLVTYRRNDIGFVFQFYNLIPNLTALE
FT                   NVELASQICTDHFDPAQTLAKVGLADRLGNFPAQLSGGEQQRVSIARALAKKPKLLLCD
FT                   EPTGALDYETGKEVLQLLQDICRTERMTVLIVTHNSALAPMAHKVIRFRSGKVTSQETN
FT                   EHPVPISQIEW"
FT   gene            184734..187688
FT                   /locus_tag="Balac_0162"
FT   CDS_pept        184734..187688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0162"
FT                   /product="hypothetical protein"
FT                   /note="COG0577 ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45556"
FT                   /protein_id="ACS45556.1"
FT                   /translation="MARRKGVPVGDADVHAQIADSGSLHAEHGHARAVGSAFLLDTMRS
FT                   GLHAWKPFLSILIITMLGVAVLTGIYAGCRDTFAAANRFYRAQGLHDVQVISTMGLTDA
FT                   DVDALRQVEGVEQAQGMRMIRVKVADGDGKQLNATLEEPASGSPAALDRPYVNEGWLPS
FT                   KPGEVAVTAQFTHDTHKKLGDTVEVAADGEDDGTHGLKIVGIVTDPSDLTNPGGYSGSA
FT                   FRSSVTNDYTFYTAPDGIQRTFVKADGTPIAAADPKVYGSIVLRLDDAENEDAFTASYD
FT                   DLVSGTVKRIENGVQAKREQARRNALVEEAQNKLDAEKKKAFDQIDAAQAKLDAQRRQL
FT                   DDQLKQLDAQTAQIPVGVPEPAQLAEAQRQWAAADTKLREAQQAIDTQRNEAFSAFAAE
FT                   QQKVDGIATPRWYVQSRSALAGFSSLKSDISSIESLGKAFPIVFLVVAVMMSLTTMSRL
FT                   VEEDRGLVGTYLGLGYGRIAITLRYALFALLACLIGGGLGLLIGFLGIPAFLLVVIRGL
FT                   YAIPDLRLEYDWLYGSLGVLLFVVGVLGAALIASVREMRQMPAALMRPKAPKAGSRILL
FT                   ERVRPLWSRMSFLNKVTARNIFRFKARLIMTVGGVAGCTALILCGLAINDTVAALGPNQ
FT                   YRGVDQYDMLAVANDGDEQALRKKLVSDGTTTAIMETRIENGEITNANDRGTNVQLTVV
FT                   PQRQLGELNTMFDLQPAQGDSLLGWVHGGNRNQPVRLDNSGIIVAQSAAQSLGIKAGSE
FT                   VTLRGDGTQPHKVKVAQVTRSLIGAEAFISEDLYHQLFPAQQAGDGGTEPAITWNAVYA
FT                   KLKGSDSEQSEYVQHLKNEATVMSATSCAQQAEDFKFDLMGAVVALIVALAGSLALVVL
FT                   FTLAHTNVSERLREMATLKVLGFYGREVHHYVNREMMVLTVMGIVIGLPLGRWVSGLLT
FT                   NALNMPGIYFEVHISWWSYIITVVATLAFAWLVQLFVNPVLDRIDPVSSLKSVE"
FT   gene            187743..189287
FT                   /locus_tag="Balac_0163"
FT   CDS_pept        187743..189287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0163"
FT                   /product="amino acid permease"
FT                   /note="COG1113 Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45557"
FT                   /protein_id="ACS45557.1"
FT                   /translation="MSDVQQPAEPHETPHEEEVNASLETLDKDNEMERGLSNRHVQFIA
FT                   IGGAIGTGLFLGSGKSINLAGPNIIFVYILVGGIMFLMMRAIGELMYRDPSQHTFINFI
FT                   RFYLGDGWGKFALWSYWIVLILIGMTEITAVGQYCVTFFRTLGYDVSAWKGLIELGFLL
FT                   LLVMINLIAVKAFGEAEFWFSMIKITLIVAMIATAVIMLVCGFKYNAVQVPGQDHVSPA
FT                   GSVTLDNLTRGFSLAPNGWLAFLMSFQMVFFAYEMIEFMGVTVSETKNPRKVLPKAING
FT                   IIVRVLIFYVGALLAIMTIVPWRNFRPNKDGSFASPFIMVFEYAGANWAAALVFFVVVT
FT                   AAASSLNSLLYSAGRHLYEIAEDSPSPAIAKLGVVSKTKVPARAIIASAILVLLSPVIE
FT                   MIPRVSGAFVMFSSASSAVIIFIYILTMIAHYRYRNSPQFMANGFRMPAYRVLNPLTTA
FT                   FFVFIYCTLFIGADTRGPAIAGLVWLVVFGGYCVLHERFQNRDLKQSIDSAGDAHA"
FT   gene            complement(189299..189544)
FT                   /locus_tag="Balac_0164"
FT   CDS_pept        complement(189299..189544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0164"
FT                   /product="putative ABC transport system integral membrane
FT                   protein"
FT                   /note="COG0577 ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45558"
FT                   /protein_id="ACS45558.1"
FT                   /translation="MIAIESVILSVFGTVLGILVGLGAGVVVRQAYRDNGLSTMSIPWL
FT                   QLLGFLGAAILVGLIASISPASRALKKPVLEAVASD"
FT   gene            complement(189541..189978)
FT                   /locus_tag="Balac_0165"
FT   CDS_pept        complement(189541..189978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0165"
FT                   /product="putative ABC transport system integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45559"
FT                   /protein_id="ACS45559.1"
FT                   /translation="MIDDNLHADYVLVSAALSQSVSPKAVNDVKHTAGVGATTAVRTLP
FT                   TVKLMQANEQFTAMAVDRELLDAMYPATHQEGDAAQAIEHGEIAVGRKVADSNGYAIGS
FT                   TVEMESKNIGIDEAATKQAIAAYEQQVGEQVSVHRTGRYVA"
FT   gene            complement(189896..191617)
FT                   /locus_tag="Balac_0166"
FT   CDS_pept        complement(189896..191617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0166"
FT                   /product="putative ABC transport system integral membrane
FT                   protein"
FT                   /note="COG0577 ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45560"
FT                   /protein_id="ACS45560.1"
FT                   /translation="MIRIGLRDAKAHFHRLVMSIIAIALGVSFVVGSFCFRSMLNDQVT
FT                   QLMGTNSDHDVYVRGTTEEQNDSSFATSGPISSGTSYNKIDTSLVTQIEQVKGIDNVSP
FT                   PERTIGATLLDHDGNAVVTTGAPTLMISASSEHPWRAANFIAGTYATGEHEIALSQDAA
FT                   KKAGLQVGDTTRLIVNGEPHTMKVSGVFTTQTAELGVLIILAQPALVNQLMQLQGEDTS
FT                   KVDKIGVYGNRTTPLTVQKQHQLADRINKALPKDSKAHAVTGQSVRDEATKSTQESLGF
FT                   VQPLILIFAVIALFVGAFIIANTFTMIVRDSMRGYALLRSVGASPAQVFFSVVIQALIL
FT                   GVIGSVLGVLLGWGLIELIDWGLSKGGFPLSGSPTPSPTAVAVGFMVGVVVTVIGSAIP
FT                   ARTAATAPPIQAMNETMNPEKPVTARGWIGAGMVAFGALCWLLCWLLAAKKVSWAWLTT
FT                   VGTGWLLGLGGVCTAGGVIVLAPALVTGAAKVLGWLPSRIPGDRHAGHPQHRPHETSHR
FT                   QHGRRPVRGRGNRQLPERARLVNARLGERYDRRQSSCRLCARLRRALAIRLAEGRQ"
FT   gene            complement(191614..192036)
FT                   /locus_tag="Balac_0167"
FT   CDS_pept        complement(191614..192036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0167"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45561"
FT                   /protein_id="ACS45561.1"
FT                   /translation="MDWFDKVVSVVKLQNRLDHRPSQLSGGQQQRVACARAIMERPSVI
FT                   FADEPTGNLDSRSSHEVFEFLRMCVREYGQTIVMVTHDPRAASFADRVLVLSDGSIVQD
FT                   LDHPSYDDILAVFAQDDDPQNGPVEVESATARSAEQ"
FT   gene            192731..193324
FT                   /locus_tag="Balac_0168"
FT   CDS_pept        192731..193324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0168"
FT                   /product="MarR-type transcriptional regulator"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45562"
FT                   /protein_id="ACS45562.1"
FT                   /translation="MDYQLEAVHELMFAMWASRSKATRSFERGAQGEMFVLRELSFQGA
FT                   RTPSQLAQAMGATSGRISSILASLTKKGWIVRTGDPQDRRSVVVELSDEGRRAVRQRSD
FT                   RLIENLSWVFSQMGERRTREFVGLLSEFMTYLSICEPDGSYPTVEQVEEAFERRARLHE
FT                   RMREMVRNGEQWHGSCRPHDAPSSNDADVDRPVQ"
FT   gene            193396..195315
FT                   /locus_tag="Balac_0169"
FT   CDS_pept        193396..195315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0169"
FT                   /product="ABC-type multidrug transport system ATPase and
FT                   permease component"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45563"
FT                   /protein_id="ACS45563.1"
FT                   /translation="MIRIMKYLSKTEIGQLVLSLVTIVGQVYFDLELPSYMSQITRLVE
FT                   TPGSQMRDIWIAGGKMLLVSLGSLACAVITGYFAARVAASFGQRLRSLEFRKVESFGPS
FT                   EMHRFSTASLITRSTNDITQIQMFITMGLQMLIKAPIMAVWAVCKIAGEGFEWTLATGI
FT                   AVAILIISIAVLMVLVMPKFKAMQQLTDDINLVTRENLTGMRVVRAYNAQDYQEGKFER
FT                   ANSNLTNTQLFTNRAMSVMMPLMGTIMNGLSLAIYWIGAYLIQDAGLTDKLTLFSNMVV
FT                   FSSYAMQVVMSFLLMSMVFVLWPRADVSAHRVLEVLDTDPLVKSGTAERGLTVQEAKQR
FT                   GIITPAERARYADDLELAGEIEFRDVSFTYPDSREAMLEHISFTANRGDTVAIIGSTGS
FT                   GKSSLINLVPRFYDATDGEVLVDGVNVREYDLKTLRDKIGYVPQRSFLFKGTVESNVSY
FT                   GDRPDEPEDVPVIDVSRMSGRKAEREFLKAGEARELTAQEANRVREASDIAQATEFVSK
FT                   MPKGFQSPIAQGGTNVSGGQKQRLSIARAVYRDPEILIFDDSFSALDFKTDREVRDALK
FT                   ETAKDATKLIVAQRVGTIMDADCILVLEDGKVVGQGTHRELLETCEVYQEIAKSQLSEE
FT                   ELSA"
FT   gene            195387..197222
FT                   /locus_tag="Balac_0170"
FT   CDS_pept        195387..197222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0170"
FT                   /product="ABC transporter permease"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45564"
FT                   /protein_id="ACS45564.1"
FT                   /translation="MGHGRAGAPVEKADDFGGALKELMRFSKRYIPAIVIALILGVGGA
FT                   ICQIIGPDYLGDMTDEITKGLPALVHGKPVLRSIDMTAVTRIGWTLVALYVGYALLSYV
FT                   QSWMMATVTQRTAQRLRAAIDVKMNKLPLKYFDEHSTGDVMSRITNDVDAVGQTLGQSL
FT                   GTLISSVTLFVGSLVMMFANNWILALCAVGATLLGMVLMLVVMRFSQKYFVKQQMALGD
FT                   VNGHVEEMYSGHTVVKAFGGEADAIRRFERYNNDLYDSGWKSQFISGLMMPMMNLVGNL
FT                   GYVVVCVVGAALAMNGSIEFGVIVAFMLYIRLFTQPLSQFAQAFQNLQRCAAGSERVFT
FT                   FLDEPELADESDKQPLLGYGSNGEITPVEGRVSFEHVKFGYEPNKLVIHDFSADVEPGQ
FT                   KVAIVGPTGAGKTTMVNLLMRFYEIAGGKISIDGIDTKSVPRWNVHDQFSMVLQDTWVF
FT                   NGTVRENVAYAKEDVTDEQVVAACRAVGLDRYIRSLPNGYDTVLDESATLSQGQKQLLT
FT                   IARAMVQDSPILILDEATSSVDTRTEELIQTAMDKLTEGRTSFVIAHRLSTIRDADMIL
FT                   VMRDGDIVERGTHEELLAKHGFYADIYNAQFTLAQ"
FT   gene            complement(197236..198762)
FT                   /locus_tag="Balac_0171"
FT   CDS_pept        complement(197236..198762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0171"
FT                   /product="putative secreted polysaccharide deacetylase"
FT                   /note="COG0726 Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45565"
FT                   /protein_id="ACS45565.1"
FT                   /translation="MGGKSSGQGNDTPHDAAQHGTTQHSTAHADDFDTMHAEFADTATG
FT                   SAADSAAYEPTAPRKRRNAVIAIAVTALIIVGVLAAIIIPISRANHRHAEEEHSAALAD
FT                   CESAQREFATLNTTYTVTLANAGKLAKGDGKTISEDHATALASKIEHIDDTHTVSSLVK
FT                   SECDTRQSTDDLNELTRRFGAASTSMVNRMRDVQTDADTLRRLVEGARNSNRRGELQKQ
FT                   LTIAKAAYERSANKAAENLRAALQAQIANAGALLEPGSTATNPQVNDALGSLTDATNAV
FT                   INAMPLDCEFAACVALTFDDGPNKQITPQLLAALKQADAPATFFVQGQFVSGSNTQLLA
FT                   NMAAQGNEIGSMSWRHKQLHTLSPAELTKWFNDTDDVIESAGAGKPTLFRPPDGAWSED
FT                   VVDAAKRSGQSVILWNVDSRDWDAQASAADIAKTVLDGASSGAIIALHDGNERTVEAIP
FT                   QIVSGLRERGFTPVTVSTLLDGELEPGTVFYARGDTAQDSAPSDGVEVTQ"
FT   gene            complement(199137..199826)
FT                   /locus_tag="Balac_0172"
FT   CDS_pept        complement(199137..199826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0172"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="COG0671 Membrane-associated phospholipidphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45566"
FT                   /protein_id="ACS45566.1"
FT                   /translation="MDSLFVRKHCWQIIGALSLIGALWFTIAVCRFHILGMDTAVYGWI
FT                   TAHVMTPGMTSVMRMLTQLSGSITVIVVAAVALAVLAVVKRWKIGVAVAVNLAGIYVLN
FT                   EIIKHIVRRPRPDFPHLVFEQGYSFPSGHAMVSTAFYGFIVYLLYRYWHTARDSGARVG
FT                   KIVAIVLLCLIPPVVMFTRVYLGVHYASDVCAGLLFAIAWLTLFYVPAMKRTLLKRASP
FT                   AASPTKR"
FT   gene            199902..200537
FT                   /locus_tag="Balac_0173"
FT   CDS_pept        199902..200537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0173"
FT                   /product="galactoside O-acetyltransferase"
FT                   /note="COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45567"
FT                   /protein_id="ACS45567.1"
FT                   /translation="MSDMEDRMHTGEMYLPHDEQILARQFDCLERLYDFNQTRPHELDR
FT                   RAELLHDMFAEIGDACYIEPPFHANFGGAHVHFGSDIYVNFNLTCVDDTHIYVGSHTMI
FT                   GPNVTLATAGHPILPELRERGYQYNMPVRIGENCWIGAGVVVLPGVTIGDNVVVGAGSI
FT                   VTRDLPSNVVAVGNPCHVLREVGERDREYYFKDRRIDWNEMRADEAAH"
FT   gene            200628..201047
FT                   /locus_tag="Balac_0174"
FT   CDS_pept        200628..201047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45568"
FT                   /protein_id="ACS45568.1"
FT                   /translation="MRALRRFYRRNRTLVTWAVLCAASMALVGHVTWLPGADSLFTPVS
FT                   GVSSFVLSPAAGGALLWRQRSRRAIRWYVVAVLLGASMPMLWGYFRNEWANLQMPTTLD
FT                   GVVATVSSLAPAILFALGAFCVYRYALGGRRRRRW"
FT   gene            complement(202038..203297)
FT                   /locus_tag="Balac_0175"
FT   CDS_pept        complement(202038..203297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0175"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683 ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45569"
FT                   /protein_id="ACS45569.1"
FT                   /translation="MNKPNRKTWRTTATAMAATAVLTLSGCGTGTADSSANAAEDTFVA
FT                   GGLFPLTGTAAYLGPSNVSTMKLAEQDIDEAGGVLGNKISTITADTSDAEHADQNATAV
FT                   QSVLSKNPSVVIGPPLSSVVKNTYKQVTTSKIPMISPGATSTAFSGLDDYFFRTIPPDT
FT                   VQGVVMGDLIAQDGIKNLAIAVFNDEYGISLRAEVLKTLKEGGVNVVYGETETFDPAEN
FT                   NFSSIATNIKATNPDAVLVIAADQTIPLVKELAAKGIDTHKLYMPDSNMVDHSKDFTSG
FT                   LLKGSKGTIPGAHPTSEFQNALKTIAPDTTIYTYNTETYDAMVLAALAAEKGGAADSET
FT                   VQKNLMAVSGTTKGEKCESYEDCVALMKSGKEIQYVGKTSIGVFNNAHDPSTASIGIYE
FT                   YDDSNVPVFLDSQEGAVPQN"
FT   gene            complement(203888..204541)
FT                   /locus_tag="Balac_0176"
FT   CDS_pept        complement(203888..204541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0176"
FT                   /product="TetR-type transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45570"
FT                   /protein_id="ACS45570.1"
FT                   /translation="MHSISSASSASASAARAASSARARAPRPALGIPRHGLRRERTDGK
FT                   ITRAVLELILAKGIGAVSIEAVAKRSGVAKTTIYRRYANTDDLLRHLSVAVGEPLDFSG
FT                   FDTTFDGLRGVLKCIVDCFDEELGLKAIGVVLSSSNDYLANLAERVVTPAQQRFADFIG
FT                   RGVSSGAFRGDVSVPFLFQTVIGSMMAAKALSDSSHDTWAHDMASLLWPTLAAR"
FT   gene            complement(204551..206749)
FT                   /locus_tag="Balac_0177"
FT   CDS_pept        complement(204551..206749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0177"
FT                   /product="putative phage infection protein"
FT                   /note="COG1511 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45571"
FT                   /protein_id="ACS45571.1"
FT                   /translation="MSMLAKIFADDVRHLTSNIVSIIITIGLIVIPGLFTWFNVAACWD
FT                   PFANTKNLQFAIANDDEGYKGDLLPMRINIGEQVVDTLRANSQLDWTFTKSSAEAIDGT
FT                   KSGKYYAAVVIPKNFSKNMMTFFTDDAYHATLDYYNNEKLNALAPKVTGQGADTIAATI
FT                   NQTFSKTLTDTALNLASSMLDMLDKPEYQQRLKSFNGNIADLAGMLNDSAAVLRTYSSL
FT                   TDSAKTLLASSNKLIADARASAKTGVDDLSAAKTGVSDLSGALGTSVNALGTAIDTSKT
FT                   SLGSLNDRVDELFSAVDKQAGDTSAAINNLAGNVRTEATAYATTRGRLQELLDKSDNLG
FT                   PVAKSAVQAFINRIGAVADDLNQTADRLTTAANDVDSKVGSSKETRQEIKDLAGKAQSS
FT                   VSSISKDFDETIKPDLTAMTNAFSDAANSLNGTVSTLDSSLDSLSGTASDANKQLDSVH
FT                   ELIDNAATQLTDAAKELTNFNTQFAKALDTGNMGTIKKLLSGNTATLSTALSTPVELKR
FT                   VALFPVDTFGAALTPFYTFLPLWVGALLLVVTLKIGISRKRQRELGNPKPWQIFLGHYG
FT                   VFVSIALLQSTFSCAGTLLFLRVQVVHPWLFMLVGWFSSIVYSFFTYTLVSTFANVGKA
FT                   IGVLFLVMQISGSNAAYPLSILPHFISDISPWLPVSYSVTAMRGAIAGIYENDYWIAMG
FT                   KLALFLVPLLFIGLVLRHALLGFNHWYEARVERTKLLG"
FT   gene            complement(206746..209514)
FT                   /locus_tag="Balac_0178"
FT   CDS_pept        complement(206746..209514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0178"
FT                   /product="putative phage infection protein"
FT                   /note="COG1511 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45572"
FT                   /protein_id="ACS45572.1"
FT                   /translation="MRNIWFILRRDLKRLIINPAAWVIIFGLTFIPALYAWFNIIGFWN
FT                   PYGNTKGITVAVANEDAGADNAMMGKLELGDQIESTLKENHELGWTFLGKAKAMECVES
FT                   GHCYAAIVIPRNFSENMAAVITGSGQRPTLEYYVNEKVNAVAPKMTDVGANTVDRQVNS
FT                   AFVSTVSKAVTDTINTTNVQITQEGNATVAQTVAKLDATKANLSKSRTMIADLRKTLDG
FT                   VDEKTTAAKQALAGVDSAATSASQGLTSASGLLTKTQGGITSFSNDLSTELDQGGNLFL
FT                   QASGKASTSATRVANGVLTASGATGSALNELTSVNKTNAQILADLKALPDNPLSEQINE
FT                   IVTDLSAENEKVAQTLQTLTTLNDSTTAAANSTLGTVDQFSATSTTTVDALSGARNTIN
FT                   SSAIPQLNSGLATLSGTAGTLSGFLTGTQSLTGQTNLILDQLTQICQSTSSSLNSTDDL
FT                   LGKFITRIDTVTTDLKTLENTNVLSDLLGSKNGTLDASRIASFMLSPTVLDTHTLYPID
FT                   TYGSGMAPLFTSLALWVGVFMLMVLFKLEVDNEGLEGRHVTTNQTYMARYLLLAIVAGL
FT                   QGIVCAVGDLIIRVQCANRFVFILTAWLTSLAYLAIAYALSATFMHVGKALVVALVMLQ
FT                   IPGASGLYPIEMMPDFYRALYPFFPFTYSINAFRETIAGFYDGDWLTKMLMLALFTAIA
FT                   FFVGLVVRPWLGNFNHLFAREVHEGDMIVGERVYMPANRFDLAQALHVLADHGEYRRRI
FT                   ERRAKRFATLYPRLMRGALVAGFAVPIVLFIVFSFVGASDGSKLVALATWIAWILIIII
FT                   FLMTVESIRESLRRQTELGSLSEDSLRDMIMAQGVFGNNRHHITVPADELRPDAASNSR
FT                   ERAEKRREERDLNHREDTLDLNLNELRKPERQRKHRGSTSRRNHHDGRHSA"
FT   gene            209808..210449
FT                   /locus_tag="Balac_0179"
FT   CDS_pept        209808..210449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0179"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45573"
FT                   /protein_id="ACS45573.1"
FT                   /translation="MSDMERDARRREVRAAGGTRLTVADLINVGVFGAVYFALVGVAAL
FT                   ASMAVFGVAGNILLPAIAAVLAGPVFMLMVARVRRFGAITLMGLMLGLFLFVSGHFATS
FT                   LVTAIVFPLAADCIARFGAWRRPWALMLSYVVFSFGCTGPILPLWMMKDAYIASLERKG
FT                   KDAAYIDALFGAVNGTTFVVAMVAIVIGALVGGLFGMRLMRRHFLKAAVA"
FT   gene            210446..211186
FT                   /locus_tag="Balac_0180"
FT   CDS_pept        210446..211186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0180"
FT                   /product="ABC-type cobalt transport system permease
FT                   component"
FT                   /note="COG0619 ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45574"
FT                   /protein_id="ACS45574.1"
FT                   /translation="MTEVVVPRETRVPIRATRGVLHFDPRVKLAMLVVANMMMFLHVGP
FT                   YAGMMGVLLFSLPMLCGGKIALGMGMLACYAMCLGVDWLAAAVADAAPWLHVPGALAAG
FT                   GAMMLPCLIAGMSAFATTPPGELVAALRRLHLPDAVVIPAIVLLRFFPTIARDYRMIRC
FT                   SMRLRGINVGGWAMLCHPMRSLEYVLVPLLMNAANAAHDLTVSALTKGLGRRRATSSSA
FT                   MLHMQAIDWAMLALCCLPLIPWQA"
FT   gene            211239..212726
FT                   /locus_tag="Balac_0181"
FT   CDS_pept        211239..212726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0181"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45575"
FT                   /protein_id="ACS45575.1"
FT                   /translation="MNGTRCALDGCSFRYASDESADGVERGVHAIDHVSLQARAGEVVM
FT                   LVGRSGCGKTTVTRLLNGLAPEYFRGSLHGEARVGGLHAGVAAVEDYATEVGSVFQNPK
FT                   TQYFHANSTDELAFPCENAGMEPSEIRRRIRERLRAFDVEHLHDRNIVDCSGGQQQQLA
FT                   VVAATMLDPGVLVLDEPTSNLDAEAMERLRNMVKRLKRDGIAIVIAEHRLAWVADLADR
FT                   YVVFDAGRVVGEYTAEQFHALPESQRRAWGLRALELSGPRGQVERIAQRAEPSGEKPVI
FT                   ATRGLKVGYERRRLFGRTKRGFVREVGDVNLFAGQIVGLIGRNGAGKSTFVKTVCGLVE
FT                   PVAGEILVDGRAAKPGRLSALCAMVMQDVNYQLFASSVREEMLLEAMQHVRTAEDAQRV
FT                   RERADGILRQLGLLDFAERHPMTLSGGQKQRLAIGVALMGEKRVVVLDEPTSGLDRHHM
FT                   LQVGALMRDLADRGVCVLVVTHDDELAAEVCDRIVRF"
FT   gene            complement(212776..214359)
FT                   /locus_tag="Balac_0182"
FT   CDS_pept        complement(212776..214359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0182"
FT                   /product="hypothetical protein"
FT                   /note="COG0803 ABC-type metal ion transport system,
FT                   periplasmic component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45576"
FT                   /protein_id="ACS45576.1"
FT                   /translation="MTEQSTNQRSATHDEPRRRPITRTAIAFLAGLAVCGLAASTLSGC
FT                   GNNAGENRTSAAAARQTTDSCDTTINVVASVNQWGSLAQQLGGSCVNVTSIINSTAADP
FT                   HDHEATPADLTKLARADVVVLNGAGYDGWAQKAQLDEGRQRIVKASSLMGIADSQDDHD
FT                   HEEGEGHHHHHGTVNPHLWFSPAAVLKMSEAITSAYVTKSGEASETAATARRHSNTWNA
FT                   EYAEYTALVNRARAKNLQRRYVATESIIGHLLDYIGATDKTPDSYTNAMNNDAEPSASD
FT                   LKNALDTVGSSNVDMLIVNPQEMGGFAKKLDAAARESGKTIISVTEQLPENHKTLLGWL
FT                   TTITNQALADDPQHGWFLTQQVKDRTIADYAGQWRSVYPLLKNGKLRGVMEHKAATGDK
FT                   TADEYTAYYDAGYKTDTETITIEGDRMAFTTNGRKVTATYRYDGHRILDYAKGNRGVRY
FT                   LFTATGDVPQGAPKAVQFSDHGIAPGKAAHFHIFTGDSHDEVIKQMEHWPTYYPASMSD
FT                   DEIVKEMLAH"
FT   gene            complement(214555..215436)
FT                   /locus_tag="Balac_0183"
FT   CDS_pept        complement(214555..215436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0183"
FT                   /product="hypothetical protein"
FT                   /note="COG4667 Predicted esterase of the alpha-beta
FT                   hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45577"
FT                   /protein_id="ACS45577.1"
FT                   /translation="MAVQQTTQPTRPTRREKVGVIDVGGGLRSAYSTGVLDYCLDNGIH
FT                   FDYGLGVSAGAANITSYLAGQRGRPLRFYTKYCPRPEYMSLGNFLRDGSYLGLDYIYGT
FT                   LMNEDGEDPLDYDALVAGGVPYRITVTDALSGMPKYLGPESMSRNHYDALKATACLPVL
FT                   DKPYPLDGRPYFDGTISDPIPFRQAFADGCTKLVVILTRPRDFYRNPDKDIASSMMLAV
FT                   RYPEAARALANRAHTYNVELNMCKRLEAQGKVRIIAPKSIDGVSTLTKDPDKIQNLYNR
FT                   AYNDATALRNFL"
FT   gene            215572..216339
FT                   /locus_tag="Balac_0184"
FT   CDS_pept        215572..216339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0184"
FT                   /product="hypothetical protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45578"
FT                   /protein_id="ACS45578.1"
FT                   /translation="MLVPMNDVNPYAAAAHIEVLPLTPTRQSIERALVEWMTQTGRPAS
FT                   DLSVSALCKKAFVARSTFYANYRHMGQVYESVENRLLRQLFECAVPMRVRADGTDETMR
FT                   SFNAFVKVLHAHENEFRLVLVRQPSSRFVALWKQSLEYHVWHRLFETERGGAAAVDAVA
FT                   EWGDGAAPGTSNGGSATSQEGLPAGTDADATNRNELPVRQGPATVNRALVFDMAATAFI
FT                   AGVTFWLRTPQAVSLPEIRASVVKLVNNIDEIW"
FT   gene            complement(216519..217229)
FT                   /locus_tag="Balac_0185"
FT   CDS_pept        complement(216519..217229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45579"
FT                   /protein_id="ACS45579.1"
FT                   /translation="MAQHDNTNTEIIRPQGGSQTQAAADTAQIAHTQADAPTQPQGYAF
FT                   DFAQQQGEQIPPSQGYAPQNGEQPFTTAANTAQPNMGGNGVPNNPQGGQMPMNGGAPGN
FT                   RGTATLRGKPGGKTIGIIAAISLGCGLVAGIAGTAVTNAIYRSNEPSHSNMMMRGIGDR
FT                   GFGEGDGDGESMPDFGSGNGSRNRRSYRADGQMPGMQDSDGANGESNGDARNRSQSNDS
FT                   DSNADSGSSDSSKN"
FT   gene            complement(217391..217463)
FT                   /locus_tag="Balac_0186"
FT   tRNA            complement(217391..217463)
FT                   /locus_tag="Balac_0186"
FT                   /product="tRNA-Lys"
FT   gene            217560..219128
FT                   /locus_tag="Balac_0187"
FT   CDS_pept        217560..219128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0187"
FT                   /product="dipeptidase"
FT                   /note="COG4690 Dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45580"
FT                   /protein_id="ACS45580.1"
FT                   /translation="MSCTTLLVGKSASYDGSTIIARNDDSGSGTYDPKKFVAVRPEDQP
FT                   RHYRSVISHMEIDLPGDPCLYSIVPNVRPNRGVLAEAGVNEHNVAMSATETIAVNSRVL
FT                   AADPLVKLVPAHGEPGDADYREEVPGGFGEEDIITLVLPYVRTAREAVARIGELLATYG
FT                   TYESNGIIASDVDEIWYVETIGGHHWIARRVPDDCYAAIPNQLGIDLLDIDDAMSECRN
FT                   NMCSADLADFIEANHLDRAMPDPEFANHTAQHINPRTVFGTATPKDAIYNTPRAWYMQR
FT                   HLNPSDDWDSPAAQYRPDSQDMPWAREPESKVTIEDVAFLMGSHFQGTPFDPYGTTGTA
FT                   ESRHRYRPIGVNRTGQMVCMQIRPYAPAAYRSIMWVSYGSGAFTTPAPFYANVTDTPAY
FT                   LRDTDGENASTNSLYWTNRILAVMADAHYYDTDGEIEQYIEDVQAHGHRLVADTDASIR
FT                   ADADALASDSAHEGLKAVRLELETANKAMADWLQMRTQTLLNQVLYTTSNLMHNAFKMS
FT                   DHWMS"
FT   gene            complement(219314..220027)
FT                   /locus_tag="Balac_0188"
FT   CDS_pept        complement(219314..220027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0188"
FT                   /product="TetR-type transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45581"
FT                   /protein_id="ACS45581.1"
FT                   /translation="MANASRMSSYQRREQLLRIGRSLFAAKGFEAVSVEEIAATAKVSK
FT                   PIVYEHFGGKEGLYAVVVDREMRALNDTLVAALSAQDVHPRQIVERTALALLTYIEENA
FT                   EGFQVLVRDSPSTDPSSSFSSLLGDVSMRVGEILSEWFKKQKLPTKGVPYYAQMLVGMT
FT                   VFTGQYWADQRKVSKEQLAALIVNLAWNGLSRMKAKPELRFEGEKAKKAAQRAAENDGT
FT                   EETRTESPSAPAPSA"
FT   gene            220154..221554
FT                   /locus_tag="Balac_0189"
FT   CDS_pept        220154..221554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0189"
FT                   /product="FtsY signal recognition particle"
FT                   /note="COG0552 Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45582"
FT                   /protein_id="ACS45582.1"
FT                   /translation="MDTNTIYAIVIIAVIAVALIIGSWLIGRSRRNAINKSTEHAKAAA
FT                   DARLAAERAQAEQEEREAHEQAKEPAESGARQSSGGKPAEPTNEEKIEAEEPAISRAEL
FT                   EAQERERLSQTPPKLAAAEEVPGEESAQAESVVEDLAVVDEVPTPPAEQIEKPAGKKSR
FT                   LQRLRERLSKSSNPFGKALFNILAKDQLSEADWEDVEDTLLLADVGAEASEELVDKLRT
FT                   DARVTGESDPRQLRDALRSELLALVGPDMDRTLEAEKPDAKKPSVIIMVGVNGTGKTTT
FT                   AGKLARLFVSEDKTVLLGAADTFRAAAADQLETWGAKVDVPVVRSDREGADPASVAFEA
FT                   SAKAKELGTDVLIIDTAGRLQNKANLMDELGKIRRVAEKNLPVDEVLLVLDATTGQNGM
FT                   AQAKVFAEAIGITGVVLTKLDGSAKGGIVISVQKELGVPVKLVGVGEGPDDLAPFDPES
FT                   FVDGILGE"
FT   gene            221814..223109
FT                   /locus_tag="Balac_0190"
FT   CDS_pept        221814..223109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0190"
FT                   /product="ammonium transporter"
FT                   /note="COG0004 Ammonia permease"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45583"
FT                   /protein_id="ACS45583.1"
FT                   /translation="MSQLDSGNAAWILTSACLVFLMTPGVALFYGGMVRAKAVLNMLIM
FT                   EAAALSVTMIIWGLWGWSIAYAGNSIGGVFGDPATGFLLRDTMVAQDGVFTSASLNSNN
FT                   YPASVDVAFQAAFAMITVALICGAIAERVKYSTWMIFVALWITFDYAPMAHMVWNGGLL
FT                   SADGAISQALGAAAHDFAGGTVVHINAAVAALIIVLIIGKRKGFGVEPMRPHNVPFVML
FT                   GAFLLWFGWFGFNAGSAFAANGVAGYAWVSTSLAAAAAMLTWGFTEKIRTGHYTAMGAA
FT                   SGIVAGLVAITPAADVVSPIWAIVLGAIAGVVTCLACSLKFKLGYDDSLDVVGVHGVGG
FT                   LVGTVLLGFFMEGTGLFYSGKWNQLGVQLIIAIIAIAFSAVITTIIAFALEKTIGWRVT
FT                   QAQEVAGIDLADQGERAYDFAGTASSVIREMK"
FT   gene            223111..223449
FT                   /locus_tag="Balac_0191"
FT   CDS_pept        223111..223449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0191"
FT                   /product="nitrogen regulatory protein N-II"
FT                   /note="COG0347 Nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45584"
FT                   /protein_id="ACS45584.1"
FT                   /translation="MKLITAIIQPHKLDDVKEALASAGVHGLTVSEANGYGRQRGHTEI
FT                   YRGAEYTVDLIPKVRVEVLSDDADAETLVDVIVKSAGSGTIGDGKVWVAPLDMVVRVRT
FT                   GETGSAAI"
FT   gene            223760..225586
FT                   /locus_tag="Balac_0192"
FT   CDS_pept        223760..225586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0192"
FT                   /product="protein-PII uridylyltransferase"
FT                   /note="COG2844 UTP:GlnB (protein PII uridylyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45585"
FT                   /protein_id="ACS45585.1"
FT                   /translation="MAMSTLKQQFLELSEPDADGVYRNGSAKRMARTNLAMRELEALWN
FT                   EAVHSVPFQIPDSGIGLAAVGSLARGQIGPASDLDLVLITADHVALSTTQLNEFANKLW
FT                   YPIWDSGLDLDHSVRTVSRCESVTDHDLPAAMGWLNVNPIAGDRHLIETTATAILERWR
FT                   KAARKRLPELLESANVRNERFDRMSYVNQPDIKESRGGLRDTVLLSALAASWLADRPHG
FT                   RYDDAVERLLDVRDAIHLITRKDADRLLTQYQAEVAAMLGLTDPTLPEGEREAKSIDDL
FT                   QTLLASLSRTIAFALDSTASRAQRTLVHDKPRFSFFQILSPRAGGKREAPKFEMLAPGV
FT                   AKHEQEIVLAPQADPLADPALPLRVAAAAGREGLPINTSTLVNLKRAPIHDKAWSDEMR
FT                   RLFVELLASGERLPQVWEELDFVGIPGRLMPEWDAIRNRPSVSAAHRYTIDRHMLAVTA
FT                   QLGRERPVNGGAFDDVHYTALLLAGILHDIGKRPGVADHAAEGARHAAVIVRRMGFDDQ
FT                   MVDWVRLLVREHLTLSDFASSRNPNDPEVGAELASLVDGDPQLLDMLFALTKADMSSLG
FT                   ATAGETISNTVGWSKWRARLVTQMAALARASM"
FT   gene            225947..226219
FT                   /locus_tag="Balac_0193"
FT   CDS_pept        225947..226219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0193"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1476 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45586"
FT                   /protein_id="ACS45586.1"
FT                   /translation="MRSFNSMLDEQMDDPEFATVFEAEIERLNAAVAVSRAREEARLTQ
FT                   EQLAERSGVSRVTINRIERGKLNPSMKTLSRLARAMGKQVRVSIS"
FT   gene            226278..227657
FT                   /locus_tag="Balac_0194"
FT   CDS_pept        226278..227657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0194"
FT                   /product="replicative DNA helicase"
FT                   /note="COG0305 Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45587"
FT                   /protein_id="ACS45587.1"
FT                   /translation="MADGFHNNTRTDTSANAAGLFDRVPPHDDNAEMATLGGMLMSKDA
FT                   IGEVSQIVSVDDFYEPKHQTIYEAIIGKFSASEPADAVTVANRLSDSGDLDKVGGIDYL
FT                   HSLIASVPTAANASYYAEIVHQRALLRRVIASGTKIAQLGYDAEGSQAQDVINMAQAEV
FT                   YEMSTGRVRQDYAPVQAAVHDALDQIDSIQKGELQAGVPTGFQEIDEVTKGLQPGQMVV
FT                   VAGRPAMGKSTLGVDFARSAAIHHHDTTILFSLEMSKVELAQRIISAETGVPLAALRNA
FT                   DDIDPNRWNTLNNFYARLQDAPLFIDDSPNMSLMEIRAKCRRLKQTNDLKLVVIDYLQL
FT                   MTSGKAVESRQQEVSEFSRALKLLAKELEVPVVALSQLNRGPEMRNDKKPQLSDLRESG
FT                   SIEQDADVVFLVHRPDFYDEEDRPGEADIIMAKHRNGPTRTFGLVFQGQYSRFSDMNRE
FT                   V"
FT   gene            227754..229262
FT                   /locus_tag="Balac_0195"
FT   CDS_pept        227754..229262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0195"
FT                   /product="UDP-N-acetylmuramyl tripeptide synthase"
FT                   /note="COG0769 UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45588"
FT                   /protein_id="ACS45588.1"
FT                   /translation="MADSGTSNANPVRTHAPWYGFATPFVGKSVRWASRLLHHGGSAFP
FT                   GKVVERFDPTFLSRTLSTLPLGVVLVSGTNGKTTTTRMVATMLESLGLKVFTNPTGSNF
FT                   TRGVVSSILTEVPLNGRLDADIAVLELDEAYAVHFVEQVQPRYALLLNVMRDQLDRFGE
FT                   IDNTARLLGHVAAATRGTVVLNREDPRIARLRDVVKDGVRTRYFGLAEGLRHYFPADDD
FT                   MTTTFQVQSADSAQAPEAADAQIVDVAHDVGTAHELHADVMLTKVGDHHAQMVIDGREY
FT                   ESDVKLEGVYNLFNAAAALAVVRAVQADLRKPNAVGYAAAQLGRADSARARAFTARAHT
FT                   FADADTDALFAALADVTPAFGRGEVIDVNGSPVELLLVKNPMGFRLALASFPPESADTM
FT                   IAINDQYADGRDMSWLWDVDFTSLRPTGVAMVSGVRAWDMALRLEYDQVPVARVEPDLN
FT                   AAVREFVNANPGTPKHIYCTYTAMLAIRAELATVADVADAGVGK"
FT   gene            229331..230080
FT                   /locus_tag="Balac_0196"
FT   CDS_pept        229331..230080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0196"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="COG3442 Predicted glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45589"
FT                   /protein_id="ACS45589.1"
FT                   /translation="MSKAIDVVSLYPKDMNIYGDSGNVLAVERRLALYGYEPHVHAVNQ
FT                   NDPWPEHADIILGGGGQDTGQKKIIEDLFRRADRLRDLAEHGVPMLMICGLYQLFGEYF
FT                   ETIDGTKLEGISIIRAYTVGRDVRMIGNLVEHSAQFGDVLGYENHSGQTFLREGVQPLG
FT                   TVDGDGTGNNGEDHTEGARVHNVIGTYMHGSLLPKNPKITDFMIRTAVERRYGAFDPEQ
FT                   TDAQRAELARIDEYAAHAREAAATRPR"
FT   gene            230188..230535
FT                   /locus_tag="Balac_0197"
FT   CDS_pept        230188..230535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0197"
FT                   /product="hypothetical protein"
FT                   /note="COG3937 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45590"
FT                   /protein_id="ACS45590.1"
FT                   /translation="MTDETKNETENKTNSAMPDFGEGLRKVFLAGVGAIAATAEKGQEL
FT                   VNDLVKRGELTVEQGKKLNSELAHKAGEKSDSLKEKLADASNTVRNAAAGLSDQAEQTI
FT                   KKATEKKSDEQ"
FT   gene            230644..232794
FT                   /locus_tag="Balac_0198"
FT   CDS_pept        230644..232794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0198"
FT                   /product="Unusual protein kinase"
FT                   /note="COG0661 Predicted unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45591"
FT                   /protein_id="ACS45591.1"
FT                   /translation="MSDKNSDKSKRETEAHELRRDVRREEAGQRRQQRKDACEARHLEH
FT                   EEKRETSELIDLSNRLENQEAHSDGPAFDNPTDDALRATVETAESEKILHLGDEVDEQG
FT                   ATIEHNLQREEAEQSGGEASETAAQPETPAPQSAQSERPADAHTHDIPASIARRQQPQV
FT                   EETIGLFGMHKRNFSSEYHLTRMSKAKRLKQIGKIALEYDALHGLTPVKMRLMFEALGP
FT                   TFVKVGQILSMRSEILPESFCAELSKLRADADPMPYAIVLGTLENEYQRPIDEIFEHID
FT                   TTPLGSASLAQVHRATLKTGEDVAVKVQRPGVRETMAQDVSIMRSLAKGATKIMHSSQV
FT                   VDFRGVVEELWETFDEETNFLNEARNLAEFKRFCSHYAYMDCPTPFTDLCTEHVLVMQY
FT                   IDGIPISHTRELIDDGYSLNEIGTKLVDNYAAQILDAGFFHADPHPGNIEIRGGKIILL
FT                   DLGMTGRLDARTRVALKQMLFAVAKQNSADLADALLRFAGTDVERADYPSLLGDLDGIV
FT                   EEFGTVDLADLDLAAFITSLTQMARRHGIEIPSSVTTVGRALVTLEGLLDEFIPNVNMI
FT                   EIISQHIESSKTPVEMVKSEVKRLGIESEQALHSGLKGIVDAQTALHMLTRGELKMNLE
FT                   LVGSEEPLSQMSDMVNRLTMALIVVGLFIGSSIVYFAGMKPIIFGIPVVGFLGYVAAFV
FT                   LSVWIVIDILIKRHAAKHKARK"
FT   gene            232905..233942
FT                   /locus_tag="Balac_0199"
FT   CDS_pept        232905..233942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0199"
FT                   /product="phosphodiesterase"
FT                   /note="COG0584 Glycerophosphoryl diesterphosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45592"
FT                   /protein_id="ACS45592.1"
FT                   /translation="MANALKKALIGGAVAAGLGVWAVAPRTFNNKRKNFVPTLPDVLYA
FT                   HRGLHDAGSGLSQQHAGESGEYIALARRMALRAGYGSIDEPGPLAPENSLAAFAAAAEA
FT                   GYGIELDVQLTLDNKAVVCHDPDLLRVAGDPRNIRDLTYDELVRIPLFPTAAPGAEVSP
FT                   LLPGATENPPLVTTPSQAPAGYYQHVPLLEDVLRVVDGRVPIIVEFKFENYRTWDDRDE
FT                   ELMQTAAALLDAYQGLYVVESFNPAAMNWYKREHPDVCRGQLAEDTEFTKNPVLWMAGK
FT                   LMFNEISRPDFVAYDFRNGNGAMLRFVRRMGAMAVAWTVRTSDELAGAQPYFDRFIFEA
FT                   FVPKQ"
FT   gene            complement(234038..234679)
FT                   /gene="upp"
FT                   /locus_tag="Balac_0200"
FT   CDS_pept        complement(234038..234679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="Balac_0200"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="COG0035 Uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45593"
FT                   /protein_id="ACS45593.1"
FT                   /translation="MELHVLNHPLIEHKLTVLRDKNTPSSTFRELVSELVSLEAYEATR
FT                   NLEVVDKPIETPVAPMVGKQIAKPRPIIVPVLRAGLGMLDGMTRMMPSAEVGFLGMKRD
FT                   EEHPTQQITYANRLPDDLSGRQCFLIDPMLATGGTLVTATHYLMDKGAKDVTAICIIAA
FT                   PEGIKFVEENIREDINFRVVVCGVDEGLNGKSYIVPGLGDAGDRLYGVID"
FT   gene            complement(235105..235830)
FT                   /locus_tag="Balac_0201"
FT   CDS_pept        complement(235105..235830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45594"
FT                   /protein_id="ACS45594.1"
FT                   /translation="MHSGSGSIIASRSAFTHTGSPRPARPGQLDQAIAEGLASDVDPER
FT                   LREVAHTTAWALLSKVHKTDDPAIVERVLTLVDREGVDVIAELWSKAEPDSLPGVLWRL
FT                   YLLRSWMRKQRDTIARLWRLGEPIATSASAIAGVDSAPTEDDIARTADSILTGAFRGDF
FT                   AVALTRASVFVGIVALGLRVEARELTQQANLNPVGSAAEQSKRWRTQAAQLLHTAANLN
FT                   ITSKDFKHGAALWRQGKLE"
FT   gene            complement(235835..236878)
FT                   /locus_tag="Balac_0202"
FT   CDS_pept        complement(235835..236878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0202"
FT                   /product="MutT1 protein"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45595"
FT                   /protein_id="ACS45595.1"
FT                   /translation="MEAAGGIVYRIVRSIGSMMAPLSANDVEVCLVHRPKYDDWSWPKG
FT                   KLEINESHRHAAVREIGEETGFPVALGPFLGEVEYPLSSEGKKTRHTGRGDGKDATKHV
FT                   LYWMATQISDDDNWHRREAFGPIHAVDLGEVSEIAWLSLDKARKRLTHSTDRDMLALFV
FT                   DRIEEDALKATPLLLVRHAKAEPRKQWDGTEPHRPITPEGAAAAYALDRELACYNPVEL
FT                   ATSPWTRCEQTIEMLSWQTKRERRALPPLTEEAFERDPQAAWHCFAEQIKRVLETGNTM
FT                   AICMHRPVIGGMFEHLRPLCATKSLAKRLVAKSPYMATANAFALFLVQTEDGPRIIDIQ
FT                   KVTPIVY"
FT   gene            complement(237015..239249)
FT                   /locus_tag="Balac_0203"
FT   CDS_pept        complement(237015..239249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0203"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="COG0855 Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45596"
FT                   /protein_id="ACS45596.1"
FT                   /translation="MSQIFNAPSKAILRSQIAEHIAETDKSDKRENMEGELPLPPDRFF
FT                   DRELSWLKFNKRVLELAQDETIPIIERASFAAIFASNLDEFFMVRVAGLKRRIDTGIAV
FT                   TSASGLSPRQQMRAISEQAHRLQDEHAHYVVDTILPELAKQNIQLLGWDKLTIAEQERL
FT                   SRYFRQQVFPVLTPLAVDPAHPFPYISGGSINLAVLVENPTSGKSHFARVKIPDNLDRL
FT                   VPVDDMTEDEAEDVRYGFITMENLIIAHLETLFPGMIIKEARSFRVTRNEDIEVEEDDA
FT                   ENLLNAIEKELLRRRFGPPIRLEISDETSPFLSQLLADQMGVTPDEVYRLPAPLDATVL
FT                   FELGGIDRPDLKFPPFVPTTNRQIAEVESSRAQDIFAAIRERDILLHHPYDSFSTSVQA
FT                   FLAQAAADPKVLAIKQTLYRTSSNSPIIDALIDAAQAGKQVLALVELKARFDEDANIAW
FT                   ARKLERAGVHVVYGIVGLKTHCKLSLVVRQEADGLTRYCHVGTGNYNPKTARQYTDLGL
FT                   LTCDPVVGQDMTKLFNQLSGYAPKSSFHRLLVAPRTVRSGLIQRIRREEEAARAGKEAW
FT                   IKIKVNSIVDEKTIDALYRASQAGVKIDIVERGICSLKPGVPGLSDNIRVRSILGRFLE
FT                   HSRIYAFANSDGPQIGEGPVSGPEVWIGSADLMHRNLDRRVEALVRITAPEQVQELIDY
FT                   VDLQMADTTSSWHMQPDGTYVRHSKDAEGKPLLDCQEYLIKKHMRKKATN"
FT   gene            240137..241150
FT                   /locus_tag="Balac_0204"
FT   CDS_pept        240137..241150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45597"
FT                   /protein_id="ACS45597.1"
FT                   /translation="MRMRDARARRPWQAESARRVPAYQPVHAMAEPACSPQLSPPARRT
FT                   HAGAQHARMPVCATQAPCENVITLSGASGGAGTTTLAAMLTRELAKRENECAIVDADVR
FT                   AGGGGLDVLLGIEHESGSRWHDIHAPLGELDGEALRRRLPHWDGVGVLAYNCWVQEEPA
FT                   WFEMQAALQSLAQVSDAVVVDAGHGLEIEHVPALVEASHIVVAELTVLGLARAKAHIEW
FT                   LRRNGERNMARAQEPPRPGEEWKPIVGVPGRVIGVLCVEPPAVAKGRGAVSLEEARKYL
FT                   QMEHMECELMGPVRSDARLCGDILEGLGIRRVHRRNARVLGDVAEMVERACGIGGR"
FT   gene            241147..242355
FT                   /locus_tag="Balac_0205"
FT   CDS_pept        241147..242355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0205"
FT                   /product="Flp pilus assembly protein ATPase component"
FT                   /note="COG4962 Flp pilus assembly protein, ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45598"
FT                   /protein_id="ACS45598.1"
FT                   /translation="MMWQIVGPNGVTNTTGGVAVPLPEAPVPPDTAPRHAGVGATVQTA
FT                   AQTTVHPAVRAVTAVDATRPVNFGPLKRLAADPRVTDILVTCDGAVWVERGLGIELEHP
FT                   SIPLDSPAVVRRLAVQLCAQLGERLDDARPIADASGADGTRVHAVIAPVVPYGASISIR
FT                   LPSRMSATMDALQQAGCWPAQWRPILDRLVLARANILITGSTGSGKTTLLKALLLNCRA
FT                   SERIVLVEEVRELQGLGNLNTVSLCARAKNVEGAGEVTMGDLVRSTLRMYPTRVVVGEC
FT                   RGEEVIDLMRVLNSGHCGGMSTLHASGVSRVPGRLISLGLLAHVEPNTMAGLADGAFDV
FT                   VLHMERRPGKRYLAQIGMLCMVEGRLVGRTVCSWDGRGEPVAGEAWRPFAERWGTKRVP
FT                   ERR"
FT   gene            242361..243095
FT                   /locus_tag="Balac_0206"
FT   CDS_pept        242361..243095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0206"
FT                   /product="Flp pilus assembly protein"
FT                   /note="COG4965 Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45599"
FT                   /protein_id="ACS45599.1"
FT                   /translation="MAFVAALAAALSVLLMIWAAPAAVSWRLQTVESGVADHACEPACG
FT                   ISVMLSSIIASLQAGAALEPALERAFDSVFPERRCGGARARHMRDPTTSGDGHAVGVYA
FT                   VCDGEGNVDVTQMARLFAACRLPHERASHCAQVACGVAVASAVSLELGCPAARCLEAVR
FT                   AGYLRARLQDDLRANAFAMPKSTARMLLALPAVVVFLGELLGADPLGMLFGSAQGRAML
FT                   CLGTICYVGGLLWMQRLLAADG"
FT   gene            243193..243729
FT                   /locus_tag="Balac_0207"
FT   CDS_pept        243193..243729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0207"
FT                   /product="Flp pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45600"
FT                   /protein_id="ACS45600.1"
FT                   /translation="MRELDGLARSQIALAGRGNALQRRLLEVCPGWEPSPTLLLQLLEA
FT                   AIAQGVAIPRALECIGACCGGACAQVLGHVSAALLRGVCWDEAWAVLEHDGSSPASSAL
FT                   GLACRTLRAAWEDGVSPLPQIHAAIEQMDGSERARIEQRASRLSVRLLLPMGLCLLPAF
FT                   LLIAVVPTIMSFMRM"
FT   gene            243906..244181
FT                   /locus_tag="Balac_0208"
FT   CDS_pept        243906..244181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45601"
FT                   /protein_id="ACS45601.1"
FT                   /translation="MEHNEVILFEHRRHGVGERINAASDRLLRAQVGLEARWRALMSQP
FT                   EEGAATAEYAVVLVAATGFAAVLVALMKSDTVKTLLTNIVKKALNV"
FT   gene            244186..244569
FT                   /locus_tag="Balac_0209"
FT   CDS_pept        244186..244569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45602"
FT                   /protein_id="ACS45602.1"
FT                   /translation="MGGHAFGQALRRLQCDDEGAATAEFAVVLPVIVMLAALMLYLGRA
FT                   SVVSVGCQDAAANAARALMVQGSGSGSQAMAQAAAGDGARIEVRPAGIGFEVIAHCAVV
FT                   ADPWGIVPRMVTGRAHGIWQERL"
FT   gene            244616..245056
FT                   /locus_tag="Balac_0210"
FT   CDS_pept        244616..245056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45603"
FT                   /protein_id="ACS45603.1"
FT                   /translation="MSAAARRVPTRSAPCIPHGLRAQDAGNASPSAVGIVLVVAVLLCT
FT                   IAAGARIAMARAQARTAADMSALAAADAYWNEAAADPCGIGSAVARNNAGAVESCEVID
FT                   MDVAMEVSTATGVPFVERVSARARAGPRRCDEVDATRGASQP"
FT   gene            245205..247757
FT                   /locus_tag="Balac_0211"
FT   CDS_pept        245205..247757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0211"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG2812 DNA polymerase III, gamma/tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45604"
FT                   /protein_id="ACS45604.1"
FT                   /translation="MALALYRRYRPDTFEGVIGQDQVTVPLMHALDENKLTHAYLFSGP
FT                   RGCGKTSSARILARCINCVKGPTSHPCGECDSCRDLATGGPGSIDVVEIDAASHNSVDD
FT                   ARELRERAGFAPVRDRYKIFILDEAHMVTPQGFNALLKIVEEPPEHLMFIFATTEPDKV
FT                   IGTIRSRTHHYPFRLVPPEIMTPYLEHVCEQEHIETEPGVLRLVTRAGGGSVRDTLSVL
FT                   DQLMGGCVDNDITYDSTVALLGFTPDALLGEAIDAIIEQNGAKLYGIIQKVIVAGFDAR
FT                   RFVEDLLVRTRDLLVLTLGGDEAEHVLSDDAEAEDMSDLHRQADALGLQQLTAMAEIMD
FT                   DTLGHMAGAASPRMRLELLAAKLLAGRASGFAAEAPALAGAGARGSSAAPSATQGSARG
FT                   GFVDAQRPSGFNDGATAPQSGHDTPTQAAAPTATPQAIQAATTEHDAGSQPQAASNVPS
FT                   IPEDIQRNGTVDERWDAIVAALPLDVRAYINRERVPRVMLAMDRKSGRQRLWIKFETPL
FT                   DKYAFALAVSKEPIGGTTSVVSIVRTQVHNVFGPDVALAPTEKMANGESAPPLSKLPPE
FT                   EAQRIKAKLLQQSLQGIVAHPRESSDSAQQATTSDSSNDAEAHQAAGTTPTPTESFQQA
FT                   NGNGPQTLPDDDPWAQPVKPVGLRPQALDPEEQAHEEPNRQQPAPEHQHKHVAVPDVSD
FT                   GIDPWSMPVDEHPHIDFGKVQSIEQQHERLTPAPVHGDDPWSAMPNGPQGFGTASPVTG
FT                   GQAMSVEDAYGMSPQGMHAADAGSTGVAGGESQPSAPQVDADDDVYSMDDAHVQTHDVM
FT                   DLKAVEEFFDVTKVEHFAADDANNPLNVKPRRMEHGDS"
FT   gene            247788..248390
FT                   /locus_tag="Balac_0212"
FT   CDS_pept        247788..248390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0212"
FT                   /product="recombination protein recR"
FT                   /note="COG0353 Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45605"
FT                   /protein_id="ACS45605.1"
FT                   /translation="MALAYDGAIQRLIDSFASLPGIGPKGAQRIAFYLLQAPDAESQRL
FT                   VDAINEVKEKVRFCEVCGNVCESSPCTICSDPRRDHGTICVVEEPKDVMSIERTREYRG
FT                   LYQVLGGAINPMANVGPSDLNIAQLLNRLHDGEVKEIIVALNPNIEGEATTTYLSRLLA
FT                   PLDIKVTRLASGLPVGGDLEYADEITLSRALEGRREV"
FT   gene            248511..249275
FT                   /locus_tag="Balac_0213"
FT   CDS_pept        248511..249275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0213"
FT                   /product="aspartokinase"
FT                   /note="COG0527 Aspartokinases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45606"
FT                   /protein_id="ACS45606.1"
FT                   /translation="MALIVQKYGGSSVADADSIKRVARRIIETKNAGNDVAVVVSAMGD
FT                   TTDDLIDQAMSIDSNPPAREMDMLMTAGERISMSLLAMAIHAAGSHAYSFTGSQAGFMT
FT                   DAQFGAAHIRAVNPDRVRRALNKGSVAIVAGFQGQSERGDATTLGRGGSDTSAVALAVA
FT                   LGADVCEIYTDVDGVFTADPRIVPTARRIPAIGYDEILEMSSCGSKVLALRCVEYAQRF
FT                   KMPLHVRSSFSHRPGTLVLPDGVDPNSLPNVR"
FT   gene            249348..249914
FT                   /locus_tag="Balac_0214"
FT   CDS_pept        249348..249914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0214"
FT                   /product="aspartokinase"
FT                   /note="COG0527 Aspartokinases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45607"
FT                   /protein_id="ACS45607.1"
FT                   /translation="MSDNTDQSLGDLFPDLGQETPIISGVAHDNSESLVTVRGVTDEPG
FT                   MAGRVFTRLAELGVNVDMIVQAGASTGTADISFTIPGSDAARVETALTAAQDTLGYKSF
FT                   DVNPNVGKVAVVGVGMKTHSGLAARFFQALSEEGINVLMISTSEIRIAALVPLSQLNDA
FT                   VRALHSAYGLDADKVEAVVYGGTGR"
FT   gene            249971..251041
FT                   /locus_tag="Balac_0215"
FT   CDS_pept        249971..251041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0215"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="COG0136 Aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45608"
FT                   /protein_id="ACS45608.1"
FT                   /translation="MVQINDRGVNVAVLGATGQVGMVMRRVLDERDFPVKDLRFLASAH
FT                   SAGKVLNWRGHDITVEDVATADLSGIDIAIFSAGGGTSKVWAPKFAEAGAYVIDNSSQW
FT                   RMHDDVPLVVAEVNPDDLDEIPTGIVANPNCTTMAIMPVLKPLADKFGLKRLIVSSYQA
FT                   VSGAGRAGVEQLMNEAKAAVDQGADKLVFGGDAIDFPEPTKVARTIAFNEVPFIGDIVD
FT                   DGSQETDEEQKLRNESRKILHLPDLKASCTCVRVGVFTAHGMSVNAEFENPVSVEEAKE
FT                   VLASAPAVELTDIPTAQLAAGKTPSFVGRIRVDQAVDDNKGLAFFVTNDNLRKGAALNA
FT                   VELAEIVARKHFADQL"
FT   gene            251226..251849
FT                   /locus_tag="Balac_0216"
FT   CDS_pept        251226..251849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45609"
FT                   /protein_id="ACS45609.1"
FT                   /translation="MASIEANKQLERLVALGYPDVADMSEDAFRALARPLIRALERSDL
FT                   GADILLVPTRELVTPESLIARTSIDRMAGFTTMPPRDIVSFLPTDGFEPPEGPFYLVIE
FT                   PHTGTCYTNREPDVARKLIESDERLPLTLEEGLAIATQHPEWLLEKNGFNLLGSRSADG
FT                   RVPSIWMSQSAPRLGAVWPNSRHTWLGNAYCIARRGVSLIEGRG"
FT   gene            252414..254327
FT                   /locus_tag="Balac_0217"
FT   CDS_pept        252414..254327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0217"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="COG0119
FT                   Isopropylmalate/homocitrate/citramalatesynthases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45610"
FT                   /protein_id="ACS45610.1"
FT                   /translation="MGQGQSSVFDLAAVAAASNGGNNDPLLPPARYIGAPQKPSDMPYT
FT                   KYVAYDKQVPFDYPERTWPGKRLHRAPRWCSVDLRDGNQALVNPMDSERKLRFWTMLVD
FT                   MGFKEIEVGFPSASETDYDFIRLLIERELIPDDVTIVVLTQAREHLIRKTYECLRGCKR
FT                   AIVHFYNSVSVLQREVVFRKDRAGIKKLATDAAHLCKELEGDAEGIDLYYEYSPESFTG
FT                   TEPEYAVEVCNAVIDVIKPTPGHPMIINLPATVEMTTPNVFADEVEYVSNNLRDRDAVV
FT                   LSLHPHNDEGMGVAAAELGMLAGADRIEGCLLGNGERTGNVDLVTLGLNLLTQGIDPQL
FT                   DLSDMPGIRKTVEYCNQIKISERHPYAGNFVFTAFSGSHQDAIKKGLEAREIAAEMAGV
FT                   DVENFVWLVPYLPIDPKDIGRSYEAIIRVNSQSGKGGMAYLLKANHNLDLPKKLQVEFE
FT                   KVVQQHADATKKEVKDGDIWHLFKDEYLPVEESGAIEAGEVVADTHDETLDQWGRLKLL
FT                   KVSMSSGEDGSDTRLTATVLDRGINVGREPEVTREIEGTGNGPIAAFLDALKSFGVVAS
FT                   VLDYAEHTMGVGSDARAASYVQCEVGQEDEEKRVVWGVGIDSSIITSSLKAIISAINRS
FT                   NR"
FT   gene            complement(254475..256883)
FT                   /locus_tag="Balac_0218"
FT   CDS_pept        complement(254475..256883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0218"
FT                   /product="penicillin-binding protein"
FT                   /note="COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45611"
FT                   /protein_id="ACS45611.1"
FT                   /translation="MVYQARTVSSSSSSPRAAHKASTSHRAPKRGQNAPKGPKKRTNRK
FT                   KGLWWKILLGVLGGLLAIGIGLFTYLYVTTDIPQPEKVAIAEKTTVYYNDGTTEIGSFS
FT                   EQNREIIDCSVLPDYVGNAIVASEDRSFYRNGGIDIMGMARALYNNLTTGSRQGGSTIT
FT                   QQYAERYYLGDTTSYSGKIREAILAMKIANSQDKQQVLCNYMNTIYLGRGAYGIQAAAK
FT                   AYFGKEAKDLTVDEAAMIAGIIPAPSMWDPAVNEAQAKSRFTRVIGIMREDGYITGQQA
FT                   SEAKFPETKPVSVSNDLAGPNGYLLTTVENELVASKAFTKDELETGGYKIVSTLDPNMQ
FT                   KIMQTVGDDRPEGMPESIQVGGIALDQKTGSVKAIYGGSDYLKHQLNNATQANFQPGST
FT                   MKPFGLLGAAMDDVNFNTMFNGNSPERFETTPGTWAEVPNALNMSWGTINLKQATANSV
FT                   NTVFMNVNQHLTPKKFAQIAHDAGISGDIQEDTLYNILGINSLTVWDLAQGHSTIANDG
FT                   TKNTLHIVDRVLKGDKEMYKPDLGTKQVFDANDCQLVQNAMLGTTQYGTAAGTAARLGR
FT                   QVAGKSGTANDETAASFVGYTPSLMNVWAIWNPGENGESQIVPEFAGYGVSSTGYPSHL
FT                   FTEFMAQALAGQPAETFATPVDNGKIGGPNGDWGLGGQRYVPSTNNGTQQQQQNEQQQT
FT                   APENTKTPEQPQPGNDNTNGNGGGETGGNPSDNNGGSNSGDSGNSGNQNGNTSGNNGGN
FT                   NGSNNGSNNGSNNSGSNSGDSGNSGNQNGNTGGNNGSQNNTGNGEQTQR"
FT   gene            257185..258327
FT                   /locus_tag="Balac_0219"
FT   CDS_pept        257185..258327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0219"
FT                   /product="myo-inositol-1-phosphate synthase"
FT                   /note="COG1260 Myo-inositol-1-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45612"
FT                   /protein_id="ACS45612.1"
FT                   /translation="MSIRVAIAGVGNCASSLVQGVEYYKDTKDEDKIPGLMHNNFGGYR
FT                   VRDIEFVTAFDVDADKVGKDLSEAIGASQNNTIKFADVPNLGVEVLRGPTHDGLGEYYR
FT                   EMITESDEEPVDVAQVLRDKKVDVLVSYLPVGSEEADKAYAQAAMDAGVAFVNCLPVFI
FT                   ASDPEWAQKFRDAGVPIIGDDIKSQVGATITHRVLARLFEDRGVRLDRTYQLNVGGNMD
FT                   FMNMLQRSRLESKKISKTRAVTSVVPHEMDPHNVHIGPSDYVAWLDDRKFAFVRLEGTT
FT                   FGDVPLSLEYKLQVWDSPNSAGIVIDAVRAAKIALDRGLAGPVLAPSSYFMKSPAVQHE
FT                   DTEARQLVEAFIKGDVEANEEELNADVAAAKAAGKDVWKA"
FT   gene            258722..259942
FT                   /locus_tag="Balac_0220"
FT   CDS_pept        258722..259942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0220"
FT                   /product="pre-pilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45613"
FT                   /protein_id="ACS45613.1"
FT                   /translation="MSEHDETNTNAQRAPHSASPAPSAPTHSTPADDTQWSVLQERAEV
FT                   REDNLDSQTQDPRIAAQIDAARARGFVPLSESESERTAKNSPEDLQAQIEAGLTQVDPL
FT                   MVRPRISSRILCGVIALVFALLAFGSYRLGVHTLKGQGYEDLVIGNFANYTPQWLLRHN
FT                   LGLTDSVVVISVSISLGAIAVFVALLRRRWWLAGQLVAFAAVSFACARVLKPALPRPLL
FT                   MQIHSSTANSAPSGHTMLAITAGLMLVCAVPRAWRAACALFAAAYSMLVGVFVIADKWH
FT                   RPCDVLMAVFLVGALAMLMLLFTRRSGMDRPGKRVSSASVQIASTVLITLGICGFAYAG
FT                   YIIWQIFPGLEYGVAWSTGGACMSAGVLVIAVNALVVGAVLAVRQLTASPLTRLGQIGA
FT                   PPAPPRR"
FT   gene            260287..263247
FT                   /locus_tag="Balac_0221"
FT   CDS_pept        260287..263247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0221"
FT                   /product="DNA topoisomerase I"
FT                   /note="COG0550 Topoisomerase IA"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45614"
FT                   /protein_id="ACS45614.1"
FT                   /translation="MTTGSKLVIVESPAKAKKIGGYLGDGYTVLASVGHIRDLAQPSQV
FT                   PADEKAKFGKFGVDVNDGFKPYYIVGPEKKKTVSELRSALRNASELYLATDEDREGEAI
FT                   AWHLVQTLKPKVPVKRMVFHEITPEAIRASLEHTREVDNNMVDAQETRRVLDRLYGYEL
FT                   SPVLWRKVGPGLSAGRVQSVATRLIVERERERMAFVRAPYWDVVATLCAPDALGEPTDF
FT                   ESRMIALNGTRLATSKDFKSDGTLTDAARTDGVVQLGESQAGDLADALADARFRVISVE
FT                   KKPYRRRPQPPFTTSTMQQAAGNRLGMSSRQTMRAAQSLYENGYITYMRTDSVTLSHEA
FT                   IEAARESVSKNFGSQYLSEKPKQYATKTAGAQEAHECIRPAGSHFRDPSQLATLPPDQL
FT                   KLYTLIWQRTLASQMADATGSTATARFAASAGGLGEATFQSSGTVIEFPGFMRVTGERG
FT                   GSGKKGEESASLPPLAESAELPAKSVLADGHETQPPARYTEASLVKTLEAKEIGRPSTY
FT                   ANIISTIIDRGYVYERGRALIPSWLAFAVTRLLETKFPKYVDYQFTADMENGLDQIAHG
FT                   NETGREWLTQFYFGSGADSARSADEAHEGLQRQVAQLGEIDAREINTIPIGDGIHVRVG
FT                   RYGPYLEDTKDLDAEGNPKRASIPDTIAPDELTVGEARKLIASNAGGPRVLGTDPATGG
FT                   TVEVRNGRFGPYVALVAPESAHESAPTGKKKAAEPKPKMASLFKSMKPETVTLDDALRL
FT                   LSLPRTVCTYDEVDAKTGETVSVTISASNGRYGPYLTKTRADGGASETRSLESEDAIFT
FT                   VDETHAQALFAQPKYGRGRGAAKPPLRTLGPDPESKREVSIKEGFYGAYITDGETNRSL
FT                   PKQYDPKTISAEDAFRLLAEKRAAGPSKRRGRKGKASAKSTGKGTAKGRKSAPKKSATE
FT                   TARDRRRKQVRELAEQGWANTRIAKEIGSSAATVKADVEYLEANEGFKRPPVVPAK"
FT   gene            263931..264551
FT                   /locus_tag="Balac_0222"
FT   CDS_pept        263931..264551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0222"
FT                   /product="Thymidylate kinase"
FT                   /note="COG0125 Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45615"
FT                   /protein_id="ACS45615.1"
FT                   /translation="MGAGLFISFEGVDGAGKTTQVNLLADYLRALGREVVVTREPGGTA
FT                   LGTQIRAMLLTTNPDEEISPRTEALLFAADRAQHVSEVIRPALERGAVVITDRYLDSSL
FT                   AYQSGGRELTADDIRTLSMWATNNLLPARTYLLDIDPRASHTRLEHAEDRMESAGDDFQ
FT                   QRTRTAFLELAAVQPQRFCVIDAQQSVGEIAALICDDVANLLE"
FT   gene            264557..265849
FT                   /locus_tag="Balac_0223"
FT   CDS_pept        264557..265849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0223"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0470 ATPase involved in DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45616"
FT                   /protein_id="ACS45616.1"
FT                   /translation="MSVWDAIVGQPKVVEELRRVAEGDGRGVAQSWLICGPAGSGTMQV
FT                   ARAFAAALESPDHGEGELPTKITSQILADRFPDVVTLSTDKVTIGIDEVRDLVTLSEQM
FT                   PSTAPWRIIIIENTERMLERTTNVLLKEIEEPSAHTIWLLCAPSAQDVLPTIRSRTRLV
FT                   TLGVPVADEIATWLEREVRVLEDPTKRERARAKAVGGRAGAKAARSGKSAKAPKPAPAP
FT                   EPRPVSHETAVRIARLCEGNLDIARLYARYPSVLRSRDQLVNNVLKMTRASQAVVFAGE
FT                   LYGSAQEQANERAEQAAGERQAEFRKLNGLSPDETVPADLRRAYTALAKKDDIKRHATR
FT                   MTRDVLDRAFTTIASIYRDVAVFQNDAEGSVGLINIENRDAIAELSAQLTREQTLARMD
FT                   AISTARRRIAGNGNALLDIEALFCALLPERR"
FT   gene            265872..266576
FT                   /locus_tag="Balac_0224"
FT   CDS_pept        265872..266576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0224"
FT                   /product="hypothetical protein"
FT                   /note="COG1881 Phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45617"
FT                   /protein_id="ACS45617.1"
FT                   /translation="MAFGGFRGNRQSVIWKWQFTRKCLRKLPFNARVLGVNKKRTGDTV
FT                   RDTGTMLVSADFNTIPEQYAKNAPDDARVDGVPCVSFPFYIDHLNPAAKYLHWEFSDPD
FT                   SIPVCGFEWIHWTMANLPVAALMFDPSDAHALQIPPDFSRRVTAMIPEAVQGRNSQASP
FT                   LYGQDQRNLQLVAHYTGPQPPDKDHGYVLQIWGTTSPIAGLEQGFWLNEMLHGLEHSQV
FT                   VDGGGITLIGKC"
FT   gene            267249..268862
FT                   /locus_tag="Balac_0225"
FT   CDS_pept        267249..268862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0225"
FT                   /product="Dipeptidase"
FT                   /note="COG4690 Dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45618"
FT                   /protein_id="ACS45618.1"
FT                   /translation="MACTTILVGRGASYDGSTIIARNEDDEPGSFNNKKLIIVRPEDQP
FT                   RTYTSVNGHLTIELPDDPLQYSETPNSFTSDGVWGEAGINEANVAMTATETITSNARAL
FT                   GADPLVPYTPAIGKPGDANYVPAVAGGIGEEDLVTIVLPYIHTAREGVERLGSLLEEYG
FT                   TYESNGIGFSDSHEVWWIETVGGHHWIARRVPDDCYVVNPNRLGIDEFDFEDAFGEQRD
FT                   YMCSADLREFMRMHHLDVDYALEGQFDPRDAFGSHSDMDHVYNTPRAWMIERYFNPLDE
FT                   TWEGPDADLTPSSDDIPWCRQPDHKITIEDVDYALAMHYQGTKFDPYGKLGTEATRHLY
FT                   RPAGINRTCERSIMQIRPYAPQADRAIHWITFAATPFNATVPFFANVDAMPDYVSNTTP
FT                   EVTLDSYYWASRFLAVLGDSDYSGTAEPIAHYKQTVAALGHQMVFATDEQLARLGGKDT
FT                   RDAAAREREDEQEALPADVEPMKPADVVKATRDEKTREVLAAANENMAKQLKAQTQTIL
FT                   AQCLQATSVNMKDAFSMADF"
FT   gene            269382..271007
FT                   /locus_tag="Balac_0226"
FT   CDS_pept        269382..271007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0226"
FT                   /product="dipeptidase"
FT                   /note="COG4690 Dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45619"
FT                   /protein_id="ACS45619.1"
FT                   /translation="MGCTTLLVGRDASYDGSTIIARNEDSCNGEFDPKQFIIVKPQDQP
FT                   RNYRAVISHVQIELPDDPLQYSSVPNADRKQGIWGEAGVNEANVAMSATETLTTNERVL
FT                   GADPLVEYVPAQGKPGDADYEPEVAGGIGEEDFLTIVLPYVKTAREGVARLGALLEEYG
FT                   TYEMNGVAFSDANEIWWLETVGGHHWIARRVPDDCYVTMPNQLGIDEFDVEDGIGEQVN
FT                   YMCSADMRDFIERNHLDLAVEGSMPFSPRDAFGSHSDSDHVYNTPRAWYMQRYFNPFDE
FT                   VWDGPDADHKPNSDDIPWCRQPDRKISMEDVKYILSSHYQETPFDPYGSLGDAASRTRF
FT                   RPIGINRTNHLAVMQIRPYRPQVNRAVQWLAYGSNPFNAMVPFFPNVDDTPAYLRDTTT
FT                   RVTSENFYWANRLIGVLCDAQFAETANAVETYQQKVGALGHAMVRAADEQVNRLGGTAV
FT                   LEAASREREANAEFAEDELVEDVQPMSPDEIITAVRNPEVREVLATANDDLARKLKKET
FT                   EKLLDSALFTSSLAMKNHFAMSDN"
FT   gene            271358..272527
FT                   /locus_tag="Balac_0227"
FT   CDS_pept        271358..272527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0227"
FT                   /product="hypothetical protein"
FT                   /note="COG1373 Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45620"
FT                   /protein_id="ACS45620.1"
FT                   /translation="MPLIPRELEPMLLERARAYPAVTLTGPRQSGKSTLVREAFPDYDY
FT                   VSLEDIDMRELAHDDPRSFLQRYSNHVILDEVQRVPELFSYMQRVMDERNEPGQFILSG
FT                   SQNFLLLNSISQSLAGRVAILHLLPLSYTELTHAGETPSNDEFVFRGGYPRLYSSLATP
FT                   ADFYPGYVATYIDRDVRAELGVKKIDSFNRFLTLAALRIGEVMNVSHLADEADVDSATI
FT                   RNWLSILNASFIAFQLQPYYRNYGKRLVKSAKLYFYDTGLAANLLGIESADQLFASQCR
FT                   GALFENAVVLEIVKQYQAQGKEPKLYYWRDSGQKEVDLIIERGGNPYFVIEIKSSATYR
FT                   PKYFETLDDIAEAMGVPTERRFVVYGGEETIPTRHGTVIGLRDIGRLVR"
FT   gene            272634..274151
FT                   /locus_tag="Balac_0228"
FT   CDS_pept        272634..274151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0228"
FT                   /product="formate-tetrahydrofolate ligase"
FT                   /note="COG2759 Formyltetrahydrofolate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45621"
FT                   /protein_id="ACS45621.1"
FT                   /translation="MTLIENFTKPYGLVDKIDAFGYLDSLKNNPDAPRKQGKVVLVTAD
FT                   TPLKASRGEGKTTTTIALIDALNERGIDAAAVLRQPSMGITAAGSKGGASGGGKASLTH
FT                   PELIDWGLCGEMGSIEAAQNLLVSFAEKAIDDGLLDTVLVPRVSEVPSRSLRQITVDRG
FT                   KGNVPERVVLTPTCELMQIVVLSRSMEEIADRVAHMIAGTKDGKPVTFGEFIDLWRITN
FT                   ILTDAVKPAKTETVNGSPVYVHGGPFANVSIGIPTLVSVEMACALHDVVIVEAGYGADA
FT                   GAQKWLDIACREYGAQWPSAAVVVTRATTWRDDPALQWRYPFHVDRLEKLGIPTFPLIN
FT                   LWEGEDDQIPALRETAEELGFRDPIVGNLFRDGGEALAPQLDAFVEAVSDEALPERPKS
FT                   FKGESLREKIEFVCGNAYGVPADRVIDKAGFAESEAEAERLCADAGIDFADLALVAVKS
FT                   PATMTDNDAAPADERTVTLKKVEVHSGAGLVQVNLTTSLTTPMPKIV"
FT   gene            complement(274266..274613)
FT                   /locus_tag="Balac_0229"
FT   CDS_pept        complement(274266..274613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0229"
FT                   /product="hypothetical protein"
FT                   /note="COG1049 Aconitase B"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45622"
FT                   /protein_id="ACS45622.1"
FT                   /translation="MPVIHTHVSVPTTAEQRDALKTAFGQAIPAVPGKSEGWLMCLFES
FT                   DVPMYFGGTNDAPAAYVEVNVFGSSVPKSAWQKLTPAIMDALQDTLQIPADRTYIRYTA
FT                   TPDWGWNGGNF"
FT   gene            275238..276224
FT                   /locus_tag="Balac_0230"
FT   CDS_pept        275238..276224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45623"
FT                   /protein_id="ACS45623.1"
FT                   /translation="MMADVEQTQIRMSGRCSAFLNERKMDATFGLLTALELLGITTPWL
FT                   RAAYSRWEKDRYLQIIADSRGMRYAEKHRYGVAYYTMNVPIHRVEVSPGIYCTDPVCTW
FT                   FMMARFVSLDYLVALGDAILGPNNRLSELGLHYELEDFISYIEEVEQWTADPSHSRKRA
FT                   PRGIGECRLAIELMRQRVESPQESIVRIDVLMKHGLPEPKINYVVNLENGHTARLDMAY
FT                   PQWKIAIEYDGKQHEESWEEDNLRRNKLAELGWAIIVVTRADVATPEAQLACAYRIAAR
FT                   IEERTHEPMPVFADGYTTEELAMVVSGKPVRPRKWRRKRGMGKREVA"
FT   gene            complement(276242..276799)
FT                   /locus_tag="Balac_0231"
FT   CDS_pept        complement(276242..276799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0231"
FT                   /product="hypothetical protein"
FT                   /note="COG2246 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45624"
FT                   /protein_id="ACS45624.1"
FT                   /translation="MRKLIEQILKFGVVGAIAFIIDWGILNLLVGVFHMHNVIAGTISF
FT                   FISLVFNYFASMKYVFKHRPDMARWMEMAIFLFSSLVGLFLNALIIWLSTYGMNRDAFI
FT                   TQHAEYLLRTNMGKLVATVIVAIWNFIIRKWLLDDTHTNAMNRLRRKGNVLSEEELEAK
FT                   WEKSFSHRLGMWSIEHTPKGWE"
FT   gene            complement(277025..277969)
FT                   /locus_tag="Balac_0232"
FT   CDS_pept        complement(277025..277969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45625"
FT                   /protein_id="ACS45625.1"
FT                   /translation="MTFNDEHAVEQVASLPAMKTAVRSGTDLTELWPLTTAERMDNDAK
FT                   YAENLQVRLTLTMARVLVGTTEVTLPDAEFVYEGADAIPGRPQEVVDALLAANDAYEQL
FT                   NPYSDSHDFSLLFEAAETLTAGWSEATQKQLGEILDDCTAYIHDTDQKRVTGLDHRFAV
FT                   VLVTFAQMLRVLRSQIIANLGSDSPHTGGASSDRVRHLERVALPLLPFINEFAETLGVP
FT                   RICVTADQWHGLLAAFATPNGDDDSADSARVLAESLLPLAAAEWRKHREDILWDPAEAK
FT                   RAAKEEDERKNKEALAAKFAHIKDDPSKPEVEL"
FT   gene            complement(278502..279161)
FT                   /locus_tag="Balac_0233"
FT   CDS_pept        complement(278502..279161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0233"
FT                   /product="hypothetical protein"
FT                   /note="COG0406 Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45626"
FT                   /protein_id="ACS45626.1"
FT                   /translation="MPATTINFVRHGKVYNPDHLLYERLPDFHLSERGRRMAQATGRYI
FT                   AQSPQLNTAVAVYSSPLDRTRETANEILLELNKVRAERGQEALGLLTDERIIEAGNEFR
FT                   GTRIGHGEGALWKPRNLKLVRNLWTPSWGESYRSIAARVQDFALEKVHEYPGEQIVVVT
FT                   HESPIWSYRHMLETGHPEHNMLLRKTALASVTSITYDSETGKVLSITYADPAKHID"
FT   gene            279568..280986
FT                   /locus_tag="Balac_0234"
FT   CDS_pept        279568..280986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0234"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45627"
FT                   /protein_id="ACS45627.1"
FT                   /translation="MSLLQGVKDVNHRIFGGYAELLRIPHAARFTVGSVIACMPFPMVG
FT                   MTMTIMTQQYYGNYSLAGALTAVQAIAGAVVGPLLGTLVDRFGQRQVSIPTIVIWMLAA
FT                   VSFVTCVRAQVTPWILFCIVPFFAAVPPWGAMSRARWTYLMGNDRAGVNRALSLSGVFD
FT                   EAMWVVGNPLASTLAVISGFLAMSFTGICVLIGALMFLTEMTTCPPSQSDLAREAGVSR
FT                   KEFREREAEKAKELRAQTAAEDARVHAKSQGLSDAEVEAAGKAAYERSMSGIKDSIWGP
FT                   GLIAVCATWFGLGAFQSAAGISIIAFATEANMKQYTGFVFACFSISSLTGALLYGAKNW
FT                   TIPLWKRFYVCLAVLNIGIGSFLFARHLWVIMVIYLIIGVCQSPTWINGNQLMLHLVPQ
FT                   TRFTEGMAWMGAMNSIGASAGSAVAGVFIDRAGSHGGFAVVTALAFVSLAIALLGFKQI
FT                   KTSTETPVLTEISA"
FT   gene            complement(281393..282526)
FT                   /locus_tag="Balac_0235"
FT   CDS_pept        complement(281393..282526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0235"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="COG3464 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45628"
FT                   /protein_id="ACS45628.1"
FT                   /translation="MRSSWLRTLAHVPYGDDAVHLLVRVRRYECVPCSRSWSDDLEAVG
FT                   AGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGMLLLEQADRFSS
FT                   VRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQVLREWMQARGG
FT                   EFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTKVRCRLQRDATGR
FT                   RGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDAYQRVIHAYRCD
FT                   DRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRHPRSSNGPTEAI
FT                   NGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
FT   gene            282863..284380
FT                   /gene="gltX"
FT                   /locus_tag="Balac_0236"
FT   CDS_pept        282863..284380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="Balac_0236"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="COG0008 Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45629"
FT                   /protein_id="ACS45629.1"
FT                   /translation="MKPALPENVRVRFCPSPTGIPHVGMVRTALFNWAEARHTGGTFVF
FT                   RIEDTDAQRDSEESFNQIIEALQWLGIDWDEGVGVGGPDGPYRQSERGQIYADVAQKLL
FT                   DAGYAYESYSTPEEIEARNEAAGRPKAFGYDGYDRNLSEEQKAAFRAEGRKPALRIKMP
FT                   DEDITFNDLIRGEITFKAGSVPDYVIVRPNGDPLYTLTNPVDDALMRINVVLRGEDLLS
FT                   STPRQIVLYRYLMELGIAKEMPLFGHLPYVMGQGNKKLSKRDPESNLFLHREHGFIKEG
FT                   LLNYLALLGWSIAPDRDIFSMDEMVEKFDVRDVKANPARFDIDKAISINAEHIRMLEPA
FT                   DFLERSVPYLFRDGVVSADSWDALNERERDILAAAAPLVQPRVRLLGEVAGMVGSLLSD
FT                   ADYIPPADDAKKQLKDSAGAVLDLAIAALDSVPESSWRTDTLHETLNKALVEDGGYKPR
FT                   LAFGPVRVAMSGRRVSPPLFESMEIVGKKITLERLRGLREHLAEIQG"
FT   gene            284730..284805
FT                   /locus_tag="Balac_0237"
FT   tRNA            284730..284805
FT                   /locus_tag="Balac_0237"
FT                   /product="tRNA-Glu"
FT   gene            284838..284912
FT                   /locus_tag="Balac_0238"
FT   tRNA            284838..284912
FT                   /locus_tag="Balac_0238"
FT                   /product="tRNA-Gln"
FT   gene            285047..286303
FT                   /locus_tag="Balac_0239"
FT   CDS_pept        285047..286303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0239"
FT                   /product="hypothetical protein"
FT                   /note="COG1409 Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45630"
FT                   /protein_id="ACS45630.1"
FT                   /translation="MSEAKPVSVSRRLGRLQFHKSGKFRVLQLADVQDGPKISKDTIAL
FT                   ITAAIRDARPDLVVFSGNQIAGYDPAFAATFTKRRWKTAVGAAPKSADLAHTRELVRGQ
FT                   IEQMVQPMVDAGVPWAVTYGNHDFQCGLTNAELDGIFREFPLCVNPSTRAKFGAETWSR
FT                   ALPKERVIASGEPGTFSMPVCDESGNTVFGIVLVDSGDYSETGGYGAPSQTALRFLRTV
FT                   PQWFGEGVESIVFQHMPLPQYYRVLKPVPRTTDRSVEGYRNYSGSYFVLDDAKTERGGY
FT                   LGEGVSCPDLDSGEFDILRDSHAYFAVAAGHDHRNAFAGEYAGVQMIATPTCGFDSYGP
FT                   IPERRAARLFEFDERHPFSPRTQLLQFGELVGKPSSKKAYVYGMSSASKPKSEGVNLLH
FT                   KPSTVSRLWHSVGNWLFNH"
FT   gene            complement(287069..287887)
FT                   /locus_tag="Balac_0240"
FT   CDS_pept        complement(287069..287887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0240"
FT                   /product="IclR-type transcriptional regulator"
FT                   /note="COG1414 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45631"
FT                   /protein_id="ACS45631.1"
FT                   /translation="MTSDTLAAKSAPSAETSTNNPSNHNDVPADDNEIHSGVGVLDKTV
FT                   KILDALESGPATLGQLVAATHLARPTAHRLAIALERHRFVVRDQHGRFVLGSRFTELAA
FT                   AAGEDRLLAAAGPILQTLLDRTGESAQIYRRQGEQRVCIAAVERASGLRDSIPVGAMLS
FT                   MEAGSAAQILLAWEDTELLHQGLRHAKFSAAKLATVRKRGWADSINERDEGVCSISAPI
FT                   RNASGQVIAAISISGPSGRMGSNPGHRFAPLVMGAGKYLSDALIKASISR"
FT   gene            288189..289586
FT                   /locus_tag="Balac_0241"
FT   CDS_pept        288189..289586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0241"
FT                   /product="isopropylmalate isomerase large subunit"
FT                   /note="COG0065 3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45632"
FT                   /protein_id="ACS45632.1"
FT                   /translation="MTLAEKVWADHLVRKGSDGAPDLLYIDLMLMHEVTSPQAFEGLRL
FT                   AGRTPRHLDQLIATEDHNTPTVDIDKPNPDETSATQLTTLEKNCREFGVRLHPLGDADQ
FT                   GIVHAFAPMLGLTQPGMTIVCGDSHTSTHGAFGALAFGIGTSEVEHVMATQTLSLKPFK
FT                   TMAINIEGDLPAGVSAKDIILAIIAKIGTGGGQGYVLEYRGRAIEQLSMDARMTICNMS
FT                   IEAGARAGMIAPDETTFAYLKGRPHAPKGEMWDQAVEYWKTLRTDDDAVFDAEVTLRAE
FT                   DLEPFVTWGTNPGQGVAISGVVPAPDDFADATERSAAERALDYMGLEPGTPIRDIPVDT
FT                   VFIGSCTNGRIEDLRIAAEIMKGHKKADSIHRVLVVPASSRIRLQAEREGLDRIFKDFG
FT                   AEWRNAGCSMCLGMNPDKLVAHERSISTSNRNFEGRQGKGSRTHLASPAVAAATAIRGT
FT                   ISTPADL"
FT   gene            289624..290304
FT                   /locus_tag="Balac_0242"
FT   CDS_pept        289624..290304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0242"
FT                   /product="isopropylmalate isomerase small subunit"
FT                   /note="COG0066 3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45633"
FT                   /protein_id="ACS45633.1"
FT                   /translation="MEKLTTITATGVPLRRSNVDTDQIIPAVFLKRVTRTGFDDALFYA
FT                   WRRDPNFVLNQPEYRDGRILVAGPDFGIGSSREHAVWALHDYGFRVVIASRFADIFYGN
FT                   TAKNGVLAAIMPQESIELIWKMLEEEPGRQMTVDLETRTVTIDDVVLPFEVNDYVRWRL
FT                   MNGYDDIDLTLQHEDDIAAYERMRAEKFPFKPKTLPAITEEAETVESAREPEAVEWAGP
FT                   LADR"
FT   gene            290559..290837
FT                   /locus_tag="Balac_0243"
FT   CDS_pept        290559..290837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0243"
FT                   /product="AsnC family transcriptional regulator"
FT                   /note="COG1522 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45634"
FT                   /protein_id="ACS45634.1"
FT                   /translation="MADAIVLITTQADKVSEAAKKIVEIPGVKDVYSVAGDVDLVAIVS
FT                   ADDFDDLSTIIPDGIAKVPGVAGTQTLMAFRTYSREDDLAAFDLGGD"
FT   gene            complement(291749..293095)
FT                   /locus_tag="Balac_0244"
FT   CDS_pept        complement(291749..293095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0244"
FT                   /product="NADH oxidase"
FT                   /note="COG0446 Uncharacterized NAD (FAD-dependent
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45635"
FT                   /protein_id="ACS45635.1"
FT                   /translation="MTTTVAVVGCTHAGVFAANSILREHPDWQVHVFERNETVSFLSCG
FT                   IALWVGGHVSDPKKMFYSSPQALEQAGATVHMHTDVTDVDVAAKTLEFRDLQTGDTQTL
FT                   PYDKLVVTTGSRPIVPPLPGIDSKRVQLCKNWDDAVQIKERAHDLKNVIVIGAGYIGAE
FT                   LAEQFSTRGTQVTLIDAADRVLANNFDRFITDQVEAKYREHGVTLALGEAVKAFRDNGD
FT                   SITVVTTKGEYTAPYAVLAVGFRPNTDLVRGQVETLDNGAIVVDEFMRASVPDVFAAGD
FT                   SATVLFNPTGKLDYIPLATNAVRQGELVGLNIEKPTRKYMGTQATSAVQLYDLSLAASG
FT                   MTQTYANNHGLDIRSTELLEDYRPAFMLSTAPVSCMLTWDPQTRLVKGAQFCSTTDEVA
FT                   GAANVVSVAIQAKFTIDMLANVDFLFQPNFDQPVYYVGAVAAKAAAEQR"
FT   gene            293349..294677
FT                   /locus_tag="Balac_0245"
FT   CDS_pept        293349..294677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0245"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="COG0766 UDP-N-acetylglucosamine
FT                   enolpyruvyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45636"
FT                   /protein_id="ACS45636.1"
FT                   /translation="MDVEKTDDVLHVVGGKPLNGTIKVRGAKNFVSKAMVAALLAPGTS
FT                   VLKNVPEIRDVHVVSDLLRLHGVNVDVNGDEGIVTIDAKNVQLADVADVDTLSGSSRIP
FT                   ILFSGPLLHRLGEAFIPALGGCNIGGRPIDFHLETLRKLGATVDKEHKDGIHITAPNGL
FT                   HGAKIHLPYPSVGATEQTLLAAVLADGKTELSGAATEPEIMDLVAVLQKMGAIISVDVD
FT                   RTFRIEGVKELKGYTHTALTDRIEAASWASAALATHGDVFVKGATQPEMMTFLNVFRKI
FT                   GGEFDITDRGIRFWHPGGDLKPVAIETDVHPGFMTDWQQPLVVALTQANGLSIVHETVY
FT                   ENRFGFTKPLVEMGATVQLYRECLGSLPCRFQQRNYKHSAVIFGPTPLEGRDIDVPDLR
FT                   GGFSHLIAALAAKGPSDVRGISLIDRGYADFRGKLTALGAQID"
FT   gene            295175..296164
FT                   /locus_tag="Balac_0246"
FT   CDS_pept        295175..296164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0246"
FT                   /product="hypothetical protein"
FT                   /note="COG0204
FT                   1-acyl-sn-glycerol-3-phosphateacyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45637"
FT                   /protein_id="ACS45637.1"
FT                   /translation="MVSKGKPSPRRAVKPLSDAQVRKLAAEYALVDPTRPFPIGRMEPN
FT                   QREIDELNPKITHRLVEGAAKVLRASCKVRAWGLENVPVEGAYITCATHVTQFDVFVPM
FT                   VAMFQMGRRPRYMAKAEMGKWPVIGKWFRAVGMQPVPRRSGKAREIEEASVQILTSNHA
FT                   LTIWPEGTVTRDPKKWPMSMKNGAGFIALEASRRVGHQIPLFCAVTWGAASINHWWPWP
FT                   RKNVVMCYDTQLDYSDLLANMDSWGDDPPTELANELVRRVRVRMKEVMANIRGTAAPDT
FT                   FYDYRIEKEVPEVPPFSDPHEIDRRAEEAEVRVGESVESADSASSHAR"
FT   gene            296520..297518
FT                   /locus_tag="Balac_0247"
FT   CDS_pept        296520..297518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0247"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /note="COG0240 Glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45638"
FT                   /protein_id="ACS45638.1"
FT                   /translation="MANVTVLGAGAWGTAFGQVLADAGNDVMMWAIEPEIVKAIQTEHR
FT                   NPVRLPSVEKLPDNMKATGDRAEAVAHADVVVVAIAAQYARGALEEFKGLIPDSALIVS
FT                   LMKGIEKSTGKRMDQVVCEALDLPTQRFAAVSGPNLSKQIAARQPAATVIGCTDIDNAR
FT                   MMANLCTTDYFKAFITADVIGLELCGSLKNVVALAVGMSHGAGYGENTAAMIETRGLAE
FT                   LTAVGTAAGALPETFHGLAGVGDLIATCGSPLSRNYTFGFNLGKGMSVAEATKASDGVA
FT                   EGVATASAVVELGEKYHVDTPLAKAVTRVLDDGISFSQMVSEMFPQGITVE"
FT   gene            297880..299016
FT                   /locus_tag="Balac_0248"
FT   CDS_pept        297880..299016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0248"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /note="COG1181 D-alanine-D-alanine ligase and
FT                   relatedATP-grasp enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45639"
FT                   /protein_id="ACS45639.1"
FT                   /translation="MAKTRVAVLYGGKADEHSISCISAASFMRALDPELFEAVPIGITK
FT                   TGTWFVDGQDPLGWNLAEGLPEAVETPDSREVVLTIGDGGDGFHARNADGSLDSLGHID
FT                   VVLPALHGPFGEDGTIQGLFEMMGVPYVGCGVLASAACMDKHYTKVLLRAAGIPVAPGI
FT                   TLDTRHYDASDEFATDGEEFLRQVNEAGLQYPLFVKPSRAGSSFGVTKVEQIGDAAALA
FT                   AAVFEASRHDWRVLVEQGIDAREIECAVVRIHPTDPTRAALPGEVVLDRRSEGDDQFYD
FT                   FDSKYMDSQASHTEIPAKIGDDLIARVRETAVRAFDAVDGMGLSRVDTFVTADGDVLVN
FT                   EINTLPGCTSISMFPQAWEAMGIPFRTVVTDLIEGALA"
FT   gene            299282..300418
FT                   /locus_tag="Balac_0249"
FT   CDS_pept        299282..300418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45640"
FT                   /protein_id="ACS45640.1"
FT                   /translation="MTQPENPYTGGEQPAQPITPPADPYGLNPNANPNPYTQPQEPAQP
FT                   YVQNAAPEQGREAYGNSNYGHAESAPQFTGNEPAQQPYGTPYEPVGTQPTTQINYGAPQ
FT                   NAAPQYGEQPAYGAPTGGAPVYGEPGGPAYGGPAQFPPQGGYDQYPPQGPTDKYNTMAI
FT                   VGLILAILFPLIGLIVSIIAMVNINKHGGSKASKNLSLAGTIVGGVLTVVSIIVSIIVF
FT                   NSVLAATNEIVSDSKSPSATHSQTQSTTDPDEDIDEDIDEDIDNDIDDIGGQLTGGSIT
FT                   LEEALKNPTVKSELEKQIQGLPDGMKGSVSAEGNTLILTFDLDSSLAEYSDSLAESLNS
FT                   VGKSAASQLNEDGGNTYSVRIVITSEGKTLYDKTSTND"
FT   gene            300654..301769
FT                   /locus_tag="Balac_0250"
FT   CDS_pept        300654..301769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0250"
FT                   /product="hypothetical protein"
FT                   /note="COG1266 Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45641"
FT                   /protein_id="ACS45641.1"
FT                   /translation="MTEPGRPQSPQQNTRAGEFQQAWQGEFQQPQYWQEPQQNPWQEPP
FT                   MNQMGERNAVESARRSYSRIGASFSVMIVVWMALVFVLGIGISMLHREAAHWMWVSLLV
FT                   SDCSFYLVAVPLAYLMLRSVPEEPTRKFGMTFGELFEWFLVSLAIVFVGGLLGNALAAL
FT                   FSGGMAQNRLDNIVGGIPAWLNILAVVVVGPIVEEWLCRKQIIARVRRYGERLAIVVSA
FT                   LVFALFHLNLYQFFYAFGLGLVLGYIYMRTSQLKYTIGLHMAINFLGSVVGPFFSDWSD
FT                   AHSAALDAGDVSGPELVVGVAAMLYILLYLVAVVAGVVLLIVKCRRLEFYVTPAQLPKG
FT                   TACSCAFVNAGMGVFITLTVFGMVLALMNVM"
FT   gene            complement(301753..302568)
FT                   /locus_tag="Balac_0251"
FT   CDS_pept        complement(301753..302568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0251"
FT                   /product="hypothetical protein"
FT                   /note="COG0668 Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45642"
FT                   /protein_id="ACS45642.1"
FT                   /translation="MLDWLKANSGRIIFLAIVIALAFVVTRLLSRGLRKVLEHNKIPQA
FT                   SIFINIARVLVWVVALTIVLHPVFGVSPASLFTALGIGGLAISLGLKDSIANTIGGFTL
FT                   MFSHVIQPGDTVSINDTTGVVQDINWRQTVVRERNGNLMMIPNSVLNTTALEKLDPANE
FT                   CLVTIPFTAKPDVDTAKLAQDLLSTVNTHARSLMNPKYKAVVRYTGFTSDGVSGNIVAY
FT                   AKHGVALTALSDAIARAVHSSKLNLNFTASSLVGIDESGALTGKSTSRS"
FT   gene            complement(302625..303194)
FT                   /locus_tag="Balac_0252"
FT   CDS_pept        complement(302625..303194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0252"
FT                   /product="AcrR-type transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45643"
FT                   /protein_id="ACS45643.1"
FT                   /translation="MENAFWALLRERPYGKITVTDIVREAGVNRNSFYYHFSGLPELAD
FT                   ATIMHAVESIPIMDHATTAENLWQEWQRTCIVAFNDPQMRKQFDHLALLAGPHSTIELT
FT                   EALRDFIRLTLLGNFDLDYDRIDLSTRILLDFTVGGIVGVLRDWPNIEHRLSPNDLTNP
FT                   DIATVAANLRTALDSSEQRRPVQSLR"
FT   gene            complement(303416..304612)
FT                   /locus_tag="Balac_0253"
FT   CDS_pept        complement(303416..304612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45644"
FT                   /protein_id="ACS45644.1"
FT                   /translation="MATIIDYVAQETRDFSEYPFHVADALVYAILSYDKIPQEVPQLSS
FT                   LLECFGSISSKLRNFNLKHPSRSLAALWRTPFPGPTLREVEERLHEYELTHPYWEHHSG
FT                   FSDDDETPHRFYRSIKRNPRFAVTRMSAAEERFDISQQTQYAAETFQLPDGTLLVAFRG
FT                   TDDSLTGWREDFNMAFTYPVPAQKQAADYLEKVGRLWPNARIMLTGHSKGGNIAIYAAM
FT                   NARDQIKDRIERIYAFDSPGFNQDVVSSYEYGTIVDRITKLVPEFSIIGMLLQSSPREH
FT                   MIVVKSNADGLMQHSCYTWLMDGDRFDTVPALSESSRDFRGALNTWLNGMTQRQREHGV
FT                   EALFRVLSSGGHSTITQLRTDGMKALPGLFSSYVGLDSEDRHYINQAIMLLAGTRFTH"
FT   gene            304727..305593
FT                   /locus_tag="Balac_0254"
FT   CDS_pept        304727..305593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0254"
FT                   /product="hypothetical protein"
FT                   /note="COG4905 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45645"
FT                   /protein_id="ACS45645.1"
FT                   /translation="MWLAAVEKTFVWFLLYSFVGWVWETGLNIVMKRRFVDRGILNGPI
FT                   CPIYGFGAALAIFVLHDEHSLIAVFLSSGVLACTLEYITSWGIEKLFHMRLWDYSNKPF
FT                   NINGRVYLNGFLFFAAGCTVVKEWVQPAVMRMLDRLDPLWLNIVSITLFVILMADVAVT
FT                   LAGLISMNGKLGRAEEYIKSVKKEQIAKMDVHITAADERIEQIEQHAEGVASRVKESVY
FT                   EHVGVHVDGARERMRDGELAEKLHGTFNWQQRRLLDAYPEMKPEHGRSVIGEIRAQLAK
FT                   YGRKHNA"
FT   gene            305657..306853
FT                   /locus_tag="Balac_0255"
FT   CDS_pept        305657..306853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0255"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="COG0436 Aspartate/tyrosine/aromaticaminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45646"
FT                   /protein_id="ACS45646.1"
FT                   /translation="MINEKYKAMLGEKSVIRMISERAAARRAEIGADEVFDFSIGNPSV
FT                   PCTPAFTNAVIDLYENEAPSALHGYSPSVGITSFRGAVADSLNRRFGMDYTEQHIFPTS
FT                   GATGSLAHAFRAVTKPGDEVLTFAPFFPEYIPYVEGTGATLTVVPPDTTAFQIDFEAFE
FT                   RALNPNVAVVLINTPNNPSGAAYSAATLERLAGILRDKQTEYGHDIFIVSDEPYREIMF
FT                   DGAAQAYPAKFYDNTLTCYSFSKSLSLPGERIGYVAVNPRATDADVLVPMFAQISRTIG
FT                   HNCPSSTMQLAVERVIDDTSDLSIYEANMNLLYDALVDLGFEVVRPSGTFYIFPKALEE
FT                   DANEFARKAMEYDLFMVPSDSFGMPGYLRLSYCVETEHLRKAIVRLRQFVTEVYGERE"
FT   gene            complement(307108..309966)
FT                   /locus_tag="Balac_0256"
FT   CDS_pept        complement(307108..309966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45647"
FT                   /protein_id="ACS45647.1"
FT                   /translation="MPNMLRFHQITRYIAQTTETESENAAHHAMPTLMPEDTRNMQEPL
FT                   GNPYQNPESTQSAQSAAGLGTDPFSPVTPVSVGGQGQSAPTNQSVQTYQLPFLAKVSRL
FT                   APIPGDPTNSRYGIVMRLKDVSQPQNGLGYIVRFADDPATGKQNNKQVQIIAWISKSLK
FT                   VYPTTVPLTNDPSTNDVEGELHFDAWTDQKNLGAVRIQSNDGLNRTITIGELQLDFSGS
FT                   GYSTGSLNGIATASSVDLGPYGPAATNSAAPAHATNTGSARHPLNSLLAAFWLAAAHFP
FT                   KLRGEQLGMGAGRIVEIFQNMQNKPLADALDEIIWRGTTNSNTASPFERFAARQLIEAG
FT                   AGQIREITAEHNLDVVQLDSTGQFWMRFNRNEITGLQRDIVLSVEGALNRLAAASRIAA
FT                   KYDNGMGLVTTLTEAQDYRAGFDELHEWDTHTSFIQSRADARNSNLTVRGATAARGGMW
FT                   DVMSRFVDICERLILPYRVEYRCDANPDTGEMVVNFTVPTSLMMPASVLTDSGWVGIRE
FT                   QRAAQAASYALRLAGIIAQAAFTAGTNITSLTVNGTLGSVTGAPVLSLAFTRTPFMMGT
FT                   VPAFMAGQFNDPALDSDPAAVLQMLRPSAQVISFGPDRGLTPITALPIPQAILAHRVPL
FT                   WRDDRELPDDLKALLGADFGRDLDVMYDGASIKGGEIFQIAEQNEDSPMSASLEIESAL
FT                   MGLQSEMPDLGERKPLYCEHPLMRLLVANLPDHTPQTRYVKAPDALYNSHIALARIHRD
FT                   SGDLDGSLAQLQQALALAPTTAQPFVDESITYVDIAGDHAKGADVLTRGLAVAVMPGDV
FT                   NFMYYRLAYSLWQTNNREAALACYAFMLGMGFHAQYEEAAEVEVRELMQEMGVDSLPDM
FT                   DAVTHTLNKHGIPVAPLTSQTELLAKAAIRLVDAGFPLAADEAVWALGALSNDDRLGAL
FT                   RQSLRFGVLDEDAVLASERPAN"
FT   gene            310344..311996
FT                   /locus_tag="Balac_0257"
FT   CDS_pept        310344..311996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0257"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45648"
FT                   /protein_id="ACS45648.1"
FT                   /translation="MAEQESALDFIEATHLWSQHAQFVGRAEGAPNPFRTIYGVEAQPG
FT                   GVWDVMTRFHTICERLQLPFHVSTSVEVNPATGDMAVAFGAPEPTQFPTAVPDSHGRAR
FT                   DCTGKRAQWTAAYALRLAALLANIGFAVNTGIIGVTVIARAGEPDGQTLFSLGFNRVDF
FT                   HFTTAKLFADGTIDDAQFDVDPAQLLAAFDVDSARVEFDADGWFAPTEDPELPESLCEL
FT                   RTPLGEDARELPDSLKSLLRADRVCDLDIADQASLSIRDIHQIAQENADSPVTAVVELG
FT                   GALTTLKQELSVSTSIRQPLYCEREALRLLVSEAAGDAATRYRTVPGAIAAVRSELARF
FT                   DMKLGQLDDALRELQELQRISPTSVQGGIAEAMAYSMAGDTARAVDAIRQALKLAVVPD
FT                   EVAFLYCLLGQMFAMAGETDTAIDAYYVASTVAAQTAYTGVARQAMEALLAQIGSADDD
FT                   GERDERSFTATVDARPTAPSRGHALGSLQAAGIPISPTQPVIQTLTRAAMLLADAGVPL
FT                   AAYDGVEILAEYSAEPTLLWMCRALQEGAGCAR"
FT   gene            complement(312003..313058)
FT                   /locus_tag="Balac_0258"
FT   CDS_pept        complement(312003..313058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0258"
FT                   /product="Ribokinase family sugar kinase"
FT                   /note="COG0524 Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45649"
FT                   /protein_id="ACS45649.1"
FT                   /translation="MLSDILHSIQAKRDHEPTVISLGQVWVDSMIKVPEFPAPGSFMNA
FT                   ESIARSVNGSFAVLEAASRMGAQTELAGILGTGPWSDMIRRALKRVNVRHTGITNKGLD
FT                   NGLRLVINDGQERSFISAPGAEVRTDAHTFDDMHPKSGDVVHISGASLMNTGAVAVGSF
FT                   ISRPECAPDVRDFRIVLTPTSMMSTVNERLLEDIVLLHPIWVLNRQQGRAIADRLGIEV
FT                   DETATMRVDGGFDDSMSALCDGLADVLRAPVVLRAGSRGAWVRRHGEPVQHIDGFETKA
FT                   THIRSAGPTHTGALCALLANGWNLESAVQIANAAASIAITKGINGVPQCPTYDEAVALV
FT                   TKALKDAEHAD"
FT   gene            313340..313519
FT                   /locus_tag="Balac_0259"
FT   CDS_pept        313340..313519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0259"
FT                   /product="50S ribosomal protein L28"
FT                   /note="COG0227 Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45650"
FT                   /protein_id="ACS45650.1"
FT                   /translation="MCGKGPQTGYTVSHSHIRNKRRFLPNLQPVRTTVDGQNVRLRVCT
FT                   KCLKAGKVQRVKVA"
FT   gene            313760..316132
FT                   /locus_tag="Balac_0260"
FT   CDS_pept        313760..316132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0260"
FT                   /product="RecG-like helicase"
FT                   /note="COG1200 RecG-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45651"
FT                   /protein_id="ACS45651.1"
FT                   /translation="MARQDGTRDVTLETPLHALLANKRRVSALKKLGVLDVRDALTYYP
FT                   FRVTDPVPVRALVQAQPGLKEKMACAVRVRSVRVSPMNARAGYRVEVLVDDDEFAATLH
FT                   VRGSLATLVFFSHRKSYVDWLAGRLRVDGHVVIAGDPTMYMDRLQFTHPELLTVGGANL
FT                   RADVSTVAEGLQRVCRPRPVYHANSRISSEHIHDTILYVLRLLAGEDPATAMHADDETA
FT                   QPHMRTLYAENPQIREHLDAAIPDILPGNLLAELNLMHRAQAFSQIHDPDSVGAFTQAI
FT                   TTMRYEEAFVCQTALIRARHDAREHNAYVCSDVQLRDEYIDTLPFVLTKGQREVVDEIS
FT                   HDMCQDHPMQRLLQGEVGSGKTVVAVSAMLQAVGSGHQAVLVAPTQVLAEQHYQSISNV
FT                   FNRAPVLLLTGGMKLAERRKVLGTAASGEPCIVVATHAAFSKSFQAPNLALAVIDEQHR
FT                   FGVEQRETLRSKSDVDPHLLVMTATPIPRTAAMTWFGDLDISWLTELPGGRKPIQTVVI
FT                   PEENAPLMAEMFWHIRHRIDAGERAYIVCPRIEESTEDAEGGESGGDARADSDDGMLLS
FT                   DEDLGETNARAPLHSVHEISERLQSLPQFQGVRFCELTGRDDDETKERVMAEFASGQTP
FT                   VMVATTVIEVGVDVPQASCIVIFDADRYGLSQLHQLRGRVGRGGTHSWAFLVSQAEPNS
FT                   IAEQRLDVIAHSLDGALIAQKDLELRGAGDVLGDTQSGGRSSLKLLRVVKDAAMITDAR
FT                   KRAELLLDADPTLEHHTQLAGAVLDFSRGNEKFLTSN"
FT   gene            316614..324704
FT                   /gene="fbp"
FT                   /locus_tag="Balac_0261"
FT   CDS_pept        316614..324704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="Balac_0261"
FT                   /product="hypothetical fibronectin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45652"
FT                   /protein_id="ACS45652.1"
FT                   /translation="MDIRQLREWGKRLFGSISANTKKAIAGVISAAMIVTVALVAIPAQ
FT                   AAGNMIADPTTFTQWEQGIGEPTDPRSTGRVWTDKSVSTQEVTLKTYDDNHVTVAPKDG
FT                   SFLVGLSAMSSAQKLIGVSNVTKPLDIVLVLDTSGSMAWGMDGDDEYAYDPVYAADITT
FT                   SKRYYVRVSGSMTRVYSSANGWYYDAGGSRHYVTPKTSAADSDAAHTQFYSRRRLTTQD
FT                   TRMYALKQAVNGFIDQTIAANAKVSDPNKKNRIGLVTYASDVNTRSGLTDSLSGLKSTV
FT                   DDLKASGATRADLGMQTANTVLGNARADASKIVIFFTDGQPTKSNGFENDVANDAIGAA
FT                   KTMKTNGASVYSVGIFTGANPDANVSSVTGKSDIELKSNAFMQGVSSNYPNATTYTNLG
FT                   AKAPNSNYYLAASDADTLNAVFNTIWSEVSSNPTSPIQAESQDGTTGERKGAVTFTDQL
FT                   GDYMTVTSMNSVIFAGTKFAFDPDAENAVVKNGNTTTYTFHGEVAGNEVYKAANLQDLK
FT                   ITVTDNGEKTGDTVRVEVPADLLPLRLYTAKVDKDGNVTTSIARTHPIRLFYDVALKDG
FT                   VRDKVAKPDAAMSQYIAQHTDASGDVYFLTNAYDTSAQPAAANGTTTAVFTPATTNDFY
FT                   YFTQDTPLYNSKNLEDPAKSIENSVTKTYYYQRTYYANNAKHEQWIDVLGSNAYGKAVA
FT                   DSKGNYYAPAGTERTGLSRLYTAPKKPNTTNTASNAIAPEWQMNNVTVRLGNNGKQTLA
FT                   GVGTLHVTEKVVWPQGAKRDPNKSFPFTLQLEGTGADGEFQAVIAGEGMTVTNGQTFEL
FT                   KDGESVTVYGLTPGLKATVEQTNHGGAGWSVNHANDSGTIEKNKTTNLDFVNTYALTPT
FT                   TLATGSIKGEKVLANRDWQPGEEFTFTISPLGENSKNPLPNPATVSVKNNGSYKAGQPY
FT                   PFSFGGIEYSNPGTYQYVISENPGDKAGMQYSGASYTATVTVEDNGNGTMTASVNMKKT
FT                   YNDQYEAVNPAEPTDYARFTNRFLGKNESAPIVNGYKNYTDQTGGNPNEDGKFKVIITA
FT                   GNNPDNGPAVPTQPVDVKADGTWSWNPTFTNAALNGQTSQTFTYHVREDVPTGASPTLN
FT                   GMTYDLNTYDVTITVSRDSNQDLITTVGYPNGAKRIEFTNTYKATPTQPQTLQVEKKVT
FT                   GRDAEARKFTFEAKLDSGDANNVKINNNDTLTNWDTMTVKTPEIKNGNTTDINFEGIVF
FT                   TKPGTYTFGISEQIPNPVPAGWTYDTHTHTVTYEVTDNNGQLEARRNTDGNDLFTNAYA
FT                   ASVDYGAEGTADGFRIGKTLTGRSMNAGEFGFIIEPQNGAPMPGGAAHATTTNPFSAVS
FT                   GQELVWPANGTLLAGLRFTQDDAGKTYEYTVREVPPEDVTQESPTKNGVTYDFAAHKVS
FT                   IKVIDNNGDGTMSTETTVDGSTDAIAHFTNEYAAAAGSQSFKLAKTVTGRDWKDGESFT
FT                   FDLTANPDQSNVPEDVLTKAMPERKSVTVGKPENGNTAQFHFDDFTFSQAGTYVYNVRE
FT                   RNAGTTTDGMTHDGRTAIASFTVVDNGLGRYVAGKPLITGIGESNTFTNAYEAQSFDGV
FT                   PDGMEFSKQLTGVEWTADREFEFTLTGKDGAPMPDGAKDGVLTKTVGKPDSGDTQTFDF
FT                   GNIKYESAGKYEYEVKETKGDMPGVTYDEHPATVTVTVTDNGKGQLEAKAEVTDAAFVN
FT                   TYKANQVTVGSTDLKLSKQLTGIAWPKDRTFEFTLTGKDGAPMPEGAKDGVLTKAVHKP
FT                   AEGDTADVIFGDITYDKVGTYEYTVKETKGDMPGVAYDGHTAKITVTVTDNGRGNLQAE
FT                   AKVSESQFVNKYSAQPATGVPTDFTLHKRVDGMAWNENQQFEFTIQGQDGAPMPKNATV
FT                   TVGKPTDGDTASFDFGEIVYTRSGVYRYTVTEIAGNQPGMAYDGHTATITVEVADDGQG
FT                   HLVTATTVENGLFTNKYTTQNVAYPGVDVTEELTGRAQAQGEFQFVVRGSDEDMQRAGY
FT                   TARARAVSGVYEFDAAASGETVTVPGLFTGLELTHDDVRSGRKFNFEVDQIGAQSGNGL
FT                   TVDEQVYAVQIWATDNGDGTMRVHTSVNGTETSEKTPVLPFHNVYATAPVTIGGEAPVR
FT                   INAHKTLHGRDLADGEFHFAVRDAKGNVIATASNDANGNVDFTPIEFTAERLANDVQNG
FT                   IAIRNVDYTKTPPVTTYSYEATVTEDEPDPTSGVTVLNGEFSIKLIVTDEGNGTLSARV
FT                   EYPAGTDRLGFSNQYGASSKLSKPIIGAKKLDVKSGDNAPEIAGKYTFTISGSEGAPMP
FT                   KNMQTTNDEAGNVNFGDIEYTMENVFGTDKVREKTFTYTVTEEGNVPGVTNDSAKTFNV
FT                   KVRDNGDGTLAVEDSEGMPFTFTNIYAVSPTDPVSPTDPDREGVVTGGVPMTKTIAGRD
FT                   LKDGEFEFALTKADGTLVGTAKNAADGSVKLPAVTFDAPGNYAYLVRENAADADNGVTY
FT                   DNRTYAVVAQVTDKGDGTLAVQWQIADSDGNAVKAMAFENTYAAVPTAVQFGVGKLLDG
FT                   RAPREGEFRFSLRGADESTPMPLAAVDGVQTVTNDATGSALFGTIGYEKAGEYHYVVNE
FT                   VKGDDKTITYDDHEYDVTVRVTDDLKGSLVAAVEYPEGVEGIVFHNVYTKPVEPSKPAE
FT                   PAQPAKPGAKPEAKEPAKEVQQVADTGADIALAVAAAAALILAGAGLLIARRRNE"
FT   gene            324931..325056
FT                   /locus_tag="Balac_0262"
FT   CDS_pept        324931..325056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45653"
FT                   /protein_id="ACS45653.1"
FT                   /translation="MLATSWDELLLDADPMLDHHAQFAGAVLDFSRGNERFLTSN"
FT   gene            325353..325928
FT                   /locus_tag="Balac_0263"
FT   CDS_pept        325353..325928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0263"
FT                   /product="hypothetical protein"
FT                   /note="COG0742 N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45654"
FT                   /protein_id="ACS45654.1"
FT                   /translation="MRVITGRFKGVPLTTPRSETRPTTDRTKEAMFSRLDSTGILSGAR
FT                   VLDLFGGTGALGIEALSRGANELVVVEASGPAAKLIAHTLTALRHNPAWEESMNARIVH
FT                   AKAERYAAKAKVGEPFDVVLIDPPYAFSTADCERLLGDLTARGLVARDGMIVLERSVRT
FT                   ERPEAPVGWQITDARDYGETAVYTYRAQ"
FT   gene            complement(325955..326782)
FT                   /locus_tag="Balac_0264"
FT   CDS_pept        complement(325955..326782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0264"
FT                   /product="tRNA-(guanine-N1-methyltransferase)"
FT                   /note="COG0336 tRNA-(guanine-N1-methyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45655"
FT                   /protein_id="ACS45655.1"
FT                   /translation="MDIDIVSVFPEYFDVLNLSLLGKAQERGLLAVRSHNLRQWTHDVH
FT                   QSVDDTPVGGGAGMVMKPEVWAECLDELLGIPADAPANAHAAPAADSPVLIFPNPSAPL
FT                   FTQQDATALSHAEHLVFGCGRYEGYDARIPQYYRERGVDVREYSIGDYVLNGGEVAVSV
FT                   MLEAITRLLPGFMGNADSIVEESYTGENALLEHNQYTKPASWRGIDVPPVLISGDHGRV
FT                   NRFRRDEALEKTSRLRPDLIARLDCHALDKQDRKTLMSLGWEVSGEHPRKLED"
FT   gene            complement(326938..327597)
FT                   /locus_tag="Balac_0265"
FT   CDS_pept        complement(326938..327597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0265"
FT                   /product="16S rRNA-processing protein rimM"
FT                   /note="COG0806 RimM protein, required for 16S rRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45656"
FT                   /protein_id="ACS45656.1"
FT                   /translation="MNMHTNSVPDPQQPQELLRVCRIGKAQGLKGEVSVELYTDDPHAR
FT                   FAPGEVLYARESAADALRPYTVAAARTFKNRWYVRFEGVDDRNAAEALRNTVLYGEPQE
FT                   LDDDEFYPKDLLGLEVYLESEVSAANADDAPEGAEFEFTDLGKVVDVIEGAQWLLKIRM
FT                   PNREAFLLPFVEALVPEVNLEEGYLTVDPPGGLVPGIGEPDIADTADSVGAAPPSA"
FT   gene            complement(327594..327827)
FT                   /locus_tag="Balac_0266"
FT   CDS_pept        complement(327594..327827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0266"
FT                   /product="hypothetical protein"
FT                   /note="COG1837 Predicted RNA-binding protein (contains KH
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45657"
FT                   /protein_id="ACS45657.1"
FT                   /translation="MLAQAVEHLIKNIVDFPDDVSVKSHENARGELIRVRVNPEDIGRV
FT                   IGRNGRTANAVRTVIQAISDHKVRVDIMDVRK"
FT   gene            complement(327832..328302)
FT                   /locus_tag="Balac_0267"
FT   CDS_pept        complement(327832..328302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0267"
FT                   /product="30S ribosomal protein S16"
FT                   /note="COG0228 Ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45658"
FT                   /protein_id="ACS45658.1"
FT                   /translation="MATKIRLKRMGKKFYAVYRVVVMDSRTKRDGRAIEEIGLYNPNTQ
FT                   PSTIEIKSDRAQYWLGVGAQPTDQVLNLLKITGDWQKFKGLKGAEGTLKTAAAKPEAAV
FT                   LVEEAENKAQKLKAAKAEAAAKAAEAETPAEVQHDDEKVELADVEESAPESV"
FT   gene            328532..331990
FT                   /locus_tag="Balac_0268"
FT   CDS_pept        328532..331990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0268"
FT                   /product="beta-galactosidase"
FT                   /note="COG3250 Beta-galactosidase/beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45659"
FT                   /protein_id="ACS45659.1"
FT                   /translation="MFIPRYFEDLDTLHVGCEPNRAYFVPASAPTDTRFAAREQSDRFR
FT                   LLNGEWDFKYYASVYDLDAEVDASAQAHEPVFTEPMFDADSYDQIAVPSVWQTHGYDHN
FT                   QYTNTRYPFPLDPPFVPHDNPCAVYRTTFGYDVDPACPRAFLNFEGVDSCFYVWLNGDF
FT                   VGYSQVSHSTSEFEVTDALDDGENTLVVLVLKWCDGSYLEDQDKFRMSGIFRDVYLLTR
FT                   PEHAIRDFYVRTDIRFADSGTRAAAAPQAVSADVTVDFDFLDGVPVEGIDVVIGDAAGN
FT                   VVAQGVTEAVQSETGTVGESAHRRQAVENGSAFPAKARVKLTVEQPVLWNPEVPTCYTL
FT                   MILSDGESITQPLALRDIAVVAPDGRHQTVLLNRRPIVIHGMNRHDSDPVTGYTISPEQ
FT                   FRTDLLLMKSHNVNGVRTSHYPNAPHYYDLFDELGFLVIDEADIEAHGVADAVLPKPGA
FT                   ESANMEEWQRAQLMWNGLIANNPRFVPAILDRIQRLVERDKNRGCVIFWSMGNESAYGI
FT                   GFEKALEWVKTLDSQRLTHYESARYVEEGGTLQHDYGNIDVHSRMYPSIAEIDAYFSES
FT                   GPNGDGANGEDGTAENGQVKPYIMCEYCHAMGNGPGDLEDYFQCIERHEGLLGGYIWEW
FT                   CDHAIYAGRNARGRQEYLYGGDFGEWPNDGNFCVDGMVSPDRTPHSGLDEFKNVFRPAR
FT                   VVSVDAERGVVNLRNHYDFRELGEAVIVMWEVYVDGVMQTYSLVEPGTFAIEPHAVGEV
FT                   RLSGWESVWPVAQPGRVTLVLRYLAREAQWGQEQLFELGFDEVELPNPTGDNSSQWVRH
FT                   QVEDMLAGDEIGESVTLEESDARIVINGANWRYVFDKCTGLFSELVYANRTILATPMTL
FT                   DIWRAPTDNDRNVRHEWERCGYDRAYARAYDVQTRTVVSSGIGEAALGVDGGAYGEETA
FT                   VEDAEGPMAVNAVEIKCSMGAVAPTVQPIARMDTTWTVHADGSVALHMNVRKDPAFPFL
FT                   PRFGIHMQLLKSMSNVTYCGLGPNESYVDKRRASWHGVFSASVSQMGEREIKPQENGNH
FT                   HDCSWARVQGDGVALMIVQGDGSQPESPAELLRGFDFQALEYTAAEMTRARHDFELQPS
FT                   GFTEVSVDYMQSGIGSNSCGPELLPQYRLDAPEFDFAITLRPQLA"
FT   gene            complement(332270..333439)
FT                   /locus_tag="Balac_0269"
FT   CDS_pept        complement(332270..333439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0269"
FT                   /product="hypothetical protein"
FT                   /note="COG3568 Metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45660"
FT                   /protein_id="ACS45660.1"
FT                   /translation="MIIALWVILVLLLVWISLSELPAGWDGHAPLPYLIALSPFAWIGI
FT                   TAVAIWSGCLREWPLMACAIVGLIASLLRKTAYYMNDLKTPNTGELIARKLAEKRESEN
FT                   LTISSNSAAVENLANGHFNVFTLNCRYGEANAHEIVNTVRTNDIAVLALQEMSPDLVTE
FT                   LHDAGLDDLLPFHQFGDPSSSDNGGFNGLWLRVEPAEQTPTGVPIPAADVPTVTLPVTS
FT                   TFNITFASAHPKSPQRSCKDWSAGIIGLGALAKSANKDRDRNADDSCNNREIAVLMGDL
FT                   NSSIVHPSFRELLASGFHDAALVEARGEHPTYPSWLKWPRIVIDHILFTDFMTASNVRA
FT                   VFIDGTDHLGLTATLTIRDTRTQANAAARESWPSSLPPLPAKSRRKTAD"
FT   gene            complement(333902..334900)
FT                   /locus_tag="Balac_0270"
FT   CDS_pept        complement(333902..334900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0270"
FT                   /product="Putative Co/Zn/Cd cation transporter"
FT                   /note="COG0053 Predicted Co/Zn/Cd cation transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45661"
FT                   /protein_id="ACS45661.1"
FT                   /translation="MELGHTLATPLRKFDKLESGNTHTVCATGGSMHQKKIEQQALKVG
FT                   IVVNIVMVLAGFFVFFLTGLKSMFLDASFTVISVISGGVAAYLSKKTVRVSDRFPNGMF
FT                   ALEPIYAICKSIFTICLLLFSFLDVAQIAIAYFVHGEGERLEFGPVIIYQILAVAVCIA
FT                   LVAYYRARNRTLGNASLMLKAEANGTWIDGMISLGIGIVAVLLYFLPNGTPLDFLHYTG
FT                   DFFITTIIVALTIKEPVTVLRDAFVELIGGTHDDEEVSELVSREASAHLPAGVKVQTIH
FT                   VFKTGMNFDIDIIVNGTGDVVRVEDLVEARKRMERALEPKLHLVNVDFVFD"
FT   gene            334935..336578
FT                   /locus_tag="Balac_0271"
FT   CDS_pept        334935..336578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0271"
FT                   /product="signal recognition particle protein"
FT                   /note="COG0541 Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45662"
FT                   /protein_id="ACS45662.1"
FT                   /translation="MAAFSSLTDRLSNAFKHLKSKGKLSDADIDGTIREIRRALLDADV
FT                   SLDVVRSFTARVRDRALSTEVSEALNPAQQVVRIVNDELTDILGQGVDRPLNFAKNPPT
FT                   IIMLAGLQGAGKTTLAGKLGYWLKDSGHTPLLVAADLQRPNAVTQLEVVGERAGVPVYA
FT                   PEKGVQSAGGDAVSAPGETTGDPVKVARDSIEYARQKMYDTVIIDTAGRLGVDETLMQQ
FT                   ARDIRDAVQPNEVLFVIDAMTGQDAVRTAQAFDEGVNFTGVVLSKLDGDTRGGAALSVA
FT                   SVTGKPILFASNGEGLKDFEVFHPDRMASRILDMGDILTLIEQAQREFDEEETRKAAAK
FT                   MAEGEFGLDDFLAQLQQVRKLGSMKSLLGMIPGMAQHRKELEMFDEREVDRTEAIIRSM
FT                   TPEERRNPKIIDGSRRARIAYGSGVSVSAVNALLQRFEQASKMMKRMTNRAGMGGGMAG
FT                   GFGGFGGPGGSKKGKKGKKGKKGGKSGNPMKREAEEKALRAKLAGKSNPGGSAFAKKPQ
FT                   ANELPAGLQDMLGGADVPSNLGGGLSGLLG"
FT   gene            complement(337722..339359)
FT                   /gene="cysS"
FT                   /locus_tag="Balac_0272"
FT   CDS_pept        complement(337722..339359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="Balac_0272"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="COG0215 Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45663"
FT                   /protein_id="ACS45663.1"
FT                   /translation="MTHAQSHTTDQFDETLAAGNHGVANAAVDLKLYDTATHAVSRFEP
FT                   IKPGEVGMYVCGATVQSAPHIGHIRAAVAFDIIRRWFERLGYKVTFIRNVTDIDDKILD
FT                   KAAAAGEDWWARAYHYEREFTHAYNELGVLAPTYEPRATGHIIDMVHLIERIIDNGHAY
FT                   VIRDEHGELTGDVYFDVASWPHYGELTHQKQTAEVDEAAAVADRMGPSVDASGDDKYNP
FT                   ADPADLSENKRDPRDFALWKRPKSTDPADARWKTPFGTGRPGWHIECSAMSYRYLDGMF
FT                   DIHGGGLDLRFPHHENEMAQTRAAGYRTANRWMHSAWVTAKGEKMSKSLGNGLSVPVVL
FT                   AEHSAWVVRYALGSVQYRSMLEWSDQTLAEAEAAYERIMNFIGHAADALGEQPSRDEIT
FT                   GVSADNLPVDFVAAMNDDVNVSRATAAIFTQIREGNTLLARLAGNADDADRTALRAALV
FT                   NVRAMLDTLGLDPLASPWIDGGDEAGGDSSALKTLGELVDAQLAARAEARKNKDFAKAD
FT                   QIRDALAAAGITIEDGPTGSTWTLAPSR"
FT   gene            complement(339408..341609)
FT                   /locus_tag="Balac_0273"
FT   CDS_pept        complement(339408..341609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0273"
FT                   /product="ABC transporter ATPase component"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45664"
FT                   /protein_id="ACS45664.1"
FT                   /translation="MPTFDLGLEHVSLDFATKTIFTDVTQGVFEGDRIGIVGRNGDGKS
FT                   TLLHLLEGTQAPDSGRVTTRNGLTFGMLDQRDQLDDDATIREAALEGREDYEWAAQTES
FT                   REIVEALLGGLNLNARIGTLSGGQRRRADLARLLLKDWDVLALDEPTNHLDVVTIHWLA
FT                   EHLKNRWAKGTGALLIVTHDRWFLDEVCESMWEVHDGQIEPFEGGYSAYMLQRVERDRQ
FT                   ADVRETKRRNLARKELAWLSRGARARSTKQKFHVKAARELIADVPPMRNTLELKQMATS
FT                   RLGKQVVDLVDVTQIFDREQGAVADIDPDIADMERMGTDSESSAGTQIDIVTPMVQEPQ
FT                   AFGSVTMDVDDADDPRLISAFGSRAAQIAAEHGLKAREAVTGYNALRGMTENELAANEA
FT                   ANTGADATSAAAHIEVSGREILDDVTWLIGPGDRFGIVGANGAGKSTLLKILDGSLAPT
FT                   AGRVNIGKTVKFAVLSQRLDELEKLGNYKVKEVLSRYKPTYIVDGKEVTPGQLMERLGF
FT                   EGAQLMTPIRDLSGGQKRRMQLLLILLDEPNVLIMDEPGNDLDTDMLAVMEDLLDTWPG
FT                   TLIVVSHDRYLLERVTDEQFALIGGKVRHLPGGVQDYLDMVDDLKRGKALPQADSADAA
FT                   QSAHTAQSENVRTADEQSADQPKLSGKEYAQASRRVSAIERKLEKIEQQKGELESQMNA
FT                   HDPTDYEGLGKLSAQIAELETQQGELETEWFDLSEQLGK"
FT   gene            complement(341775..342512)
FT                   /locus_tag="Balac_0274"
FT   CDS_pept        complement(341775..342512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0274"
FT                   /product="amidotransferase"
FT                   /note="COG0518 GMP synthase - Glutamine amidotransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45665"
FT                   /protein_id="ACS45665.1"
FT                   /translation="MTKPEVLILQHAEWEKPGLILSDLEEINLPTQTLNISKQKKPDLP
FT                   DFDEVAGLVVMGGPMGAADFDDYPGLKAEMKLIRAAIGTGKPVLGVCLGHQLIGAALGA
FT                   RVKKASAPEIGIAPIKRVAKHDFFSMWSKELNVLQWHGDCISLPDSAELLARSSDTRVQ
FT                   AFRFGSALGMQFHLEVTPQLLEEWLDEPSMVKQLKASGGSKSQLREAFAASYPQIQPLG
FT                   EQVFSGFAARCSTYSFSLTSRKS"
FT   gene            complement(342689..343243)
FT                   /gene="ilvH"
FT                   /locus_tag="Balac_0275"
FT   CDS_pept        complement(342689..343243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="Balac_0275"
FT                   /product="acetolactate synthase 3 regulatory subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG0440 Acetolactate synthase, small (regulatory
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45666"
FT                   /protein_id="ACS45666.1"
FT                   /translation="MASYPASKPGSQRHTLSVLVENRPGVLARIAGLFARRAFNINSLS
FT                   VSPTERPDISRITVTADVEEVPLEQIIKQLNKLLHVLKIVDLDESTTVERELVLIKVAA
FT                   DQSNRSDVLEIVRLFRVRVVDVNPESLTIEATGAGGKIDALLGLLDHYGIIELVRSGAV
FT                   AMTRGPRALSEKVVGSEITGR"
FT   gene            complement(343259..345187)
FT                   /locus_tag="Balac_0276"
FT   CDS_pept        complement(343259..345187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0276"
FT                   /product="acetolactate synthase 1 catalytic subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG0028 Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase(cytochrome,
FT                   glyoxylate carboligase, phosphonopyruvate decarboxylase)]"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45667"
FT                   /protein_id="ACS45667.1"
FT                   /translation="MSPTPLQAFSGVAKANANQHTHKRTIVDGEKMTGAQALVRSLEDL
FT                   GVKVVFGIPGGAILPVYDAIDEHTKFRFVLMRHEQAAGHAAEGYAVATGEVGVCIVTSG
FT                   PGATNVITAIADANMDSIPMIVVTGQVGVNAIGTDAFQEADIVGATYPVAKHSYLVTDA
FT                   QDIPRVLSEAHYIARSGRPGPVVVDLTKTAQNGTMYYSWPQRMILPGYNPTTEAHGRVL
FT                   DDAARLFQHAFRPVLYVGGGAVRSDAGAEVKALSDLTGAPIVTTLPARGIVPDDDPAVL
FT                   GMLGMHGTIAATGAVQRSDLLVAIGARFDDRVTGKLEAFAPGARVIHIDIDPAEIGKNR
FT                   TPDVPIVGDVKTVLSALMPRIERQHAIHGKPNLTTWWGLINSWVEKYPLTYQEPTDGTL
FT                   APQWVVEELSHAANPETIWVSGVGQHQMWATQFINFSHPHQWISSGGLGTMGFGLPAAI
FT                   GASIGSQRYFDGKKPVWLIDGDGSFQMTSEELAAAFLEGAPVKIALLNNSVYGMVRQWQ
FT                   TLFYNNHYSATILHEEEKTGLEGVPDFVKLADAYGCVALRARTKDEAVEAIRRANEIND
FT                   RPVLVDFRVWKDAMVWPMVAAGDSNDNVTYLPGIKPLHQADGLAAMPVDSDAQADEATA
FT                   IITEEQD"
FT   gene            complement(345563..346339)
FT                   /locus_tag="Balac_0277"
FT   CDS_pept        complement(345563..346339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0277"
FT                   /product="ribonuclease III"
FT                   /note="COG0571 dsRNA-specific ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45668"
FT                   /protein_id="ACS45668.1"
FT                   /translation="MSVRVSTQEIGESAMQELFTALGTTLETDLLVEALTHRSFSHEHE
FT                   GVKNYERLEFLGDAVLEFVVTETLFKQYPDKSEGQLAKIRAKAVSEESLSAIARDRLHV
FT                   GPYILLGHGESEQGGAEKSSILCDIVESLIGATFVQYGVDKAREVVHHLVDDTLAEVAT
FT                   EGPALDWKTSLTVKAHEMGLPEPRYQMSVGGPEYALEFTAFAMLGDSKEVLGVGNGSSK
FT                   RKAQLAAAEQAWHVLDEREHAPKPERKRERRPLTDA"
FT   gene            complement(346664..346858)
FT                   /gene="rpmF"
FT                   /locus_tag="Balac_0278"
FT   CDS_pept        complement(346664..346858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="Balac_0278"
FT                   /product="50S ribosomal protein L32"
FT                   /note="COG0333 Ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45669"
FT                   /protein_id="ACS45669.1"
FT                   /translation="MALPKYKMSRANTRTRRSTWKAKAAQTITCPNCGAPTLAHVACPS
FT                   CGSYRGRVYREAIRSAHTK"
FT   gene            complement(346937..347533)
FT                   /locus_tag="Balac_0279"
FT   CDS_pept        complement(346937..347533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0279"
FT                   /product="Putative metal-binding/nucleic acid-binding
FT                   protein"
FT                   /note="COG1399 Predicted metal-binding, possibly nucleic
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45670"
FT                   /protein_id="ACS45670.1"
FT                   /translation="MARIEYTDWTVPVAQVGSRAGQTMQVDRDFPAPGGIGDSIVGVKE
FT                   GEPIHVNGQFDSIIDGLIFTGTFTAPVTAVCARCDRDLSGDWSEQVTAFFPYEDADAGK
FT                   TKNEDVEIIAGEEESGDTYPLIDNGAFANIEPLLRDTFVSALPLNPLCKPDCKGLCPQC
FT                   GLDLNESPEHVHEVTDLRFADLEALKEQLEREQGE"
FT   gene            complement(347618..348319)
FT                   /locus_tag="Balac_0280"
FT   CDS_pept        complement(347618..348319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0280"
FT                   /product="hypothetical protein"
FT                   /note="COG3599 Cell division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45671"
FT                   /protein_id="ACS45671.1"
FT                   /translation="MTQNDSSTQTIHDGGNDAPQPPQDSSARRPAFNMDDLPDLRDNAP
FT                   DPDALRKAEFTTVYDIIDSLEEMITSAKGSMFSPSSVKIDRDDFLDKLEDLKTKLPVQL
FT                   ERASALMREAEGRLANANSQANVIISTAQARAANIIRDANERADYLASQEKVTEIARQK
FT                   AKTMIDKAQAASDRLTSGADQYCIKIMNELHSQLGKMTRDVEGGLNVLEEREAKAREEL
FT                   PHAEESDYPQD"
FT   gene            complement(348370..348849)
FT                   /locus_tag="Balac_0281"
FT   CDS_pept        complement(348370..348849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0281"
FT                   /product="Phosphopantetheine adenylyltransferase"
FT                   /note="COG0669 Phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45672"
FT                   /protein_id="ACS45672.1"
FT                   /translation="MTIAVCPGSFDPVTNGHIDVITRCCRLFDEVHVVVAVNAMKKPLF
FT                   TETERVDIIKHALADSGMTNYVVAWTDGLITDYCRKVDSPVIVKGLRQNGDYEAELGMA
FT                   LVNRHLAYVETMFLPANPVLEHISSSVVKDVARHGGDITGMVPDYVVPLLEKALR"
FT   gene            349025..349318
FT                   /locus_tag="Balac_0282"
FT   CDS_pept        349025..349318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45673"
FT                   /protein_id="ACS45673.1"
FT                   /translation="MSFAYNDALDDNTTAATEPSSDTGTAVLERPKAQERRADDGDADR
FT                   FAHYVSRDRIAESRLTGRPVVALCGKVWVPKRNPKDYPICPECKRIYEEMTK"
FT   gene            complement(349453..350460)
FT                   /locus_tag="Balac_0283"
FT   CDS_pept        complement(349453..350460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0283"
FT                   /product="reductase"
FT                   /note="COG0667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45674"
FT                   /protein_id="ACS45674.1"
FT                   /translation="MPDFITHYSPAPDRYDRMQYAHVGTSGLQLPRIALGLWHNFGDLT
FT                   PYGQMQQIVFTAFDHGIFHFDLANNYGPMYGAAERNFGHIMRESLRPYRDELIISTKAG
FT                   FDMWAGPNGVGGSRKYLLSSLDQSLERLGLDYVDIFYHHCPDPNTPLEETVGALETAVT
FT                   SGRALYVGLSNYDGPLLEQAAQMLAERHVPFIINQNRYNIFDRTIERNGLKEATSKLGK
FT                   GLITFSPLEQGLLTNRYLNGIPADSRIGHDDRFLNKSALTESRLTQIRELNDLALSRGQ
FT                   TLAEMSLAWLLNDPAVTTVLVGASKPQQILDDIAALNNTHFTPEELARIDSISL"
FT   gene            complement(350537..351997)
FT                   /locus_tag="Balac_0284"
FT   CDS_pept        complement(350537..351997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0284"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="COG1488 Nicotinic acid phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45675"
FT                   /protein_id="ACS45675.1"
FT                   /translation="MTSAHICALIRLGWGTTTSARGESTAAPANREEITQEKRTANTGD
FT                   TMVVYDPSLMTDMYEYTMLDATLQDGTANRPCVFEVFTRHLPEGRRYGVVAGIGRLLDA
FT                   LEDFHLDDADLKFLSDRHIVSRGTVKWLENYHFTGSIRGYREGEVYFPNSPILQVRGSF
FT                   GECTLLETLILSILNYDSAVAAAASRMVTAAKNRPCMDMGGRRTNEWAAVAAARASIVG
FT                   GFKGTANLLAAKLYDLPAIGTAAHCFTLVHDSERQAFESQIAALGTNTTLLVDTYNIEE
FT                   AVKTAVEVAGPNLGGVRIDSGDLAALAQRVRNQLDALGATNTKITVTNDLDEYAIASLQ
FT                   TAPVDSYGVGTQLVTGSGAPTCAMVYKLTERANNAGHMEPVAKKSVDKATAPGAKLAFR
FT                   SYEYSLADCEHVISGSESALENFVPGEGWEDLLTDFVVNGTVDPQFQGHDGLMAAQDYH
FT                   AKALAKLPITAQSLMRGEPVIPTKLEVL"
FT   gene            352165..352785
FT                   /locus_tag="Balac_0285"
FT   CDS_pept        352165..352785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45676"
FT                   /protein_id="ACS45676.1"
FT                   /translation="MRYLAGIWRLAIAALCFIGTSPAWHAVSLWAFLMYQIGFIAGIVM
FT                   LWSGCASILRGVQPPALLRGFVLTYAFSLAAVHFFVTPAAEFGVPAQQVIPLSAQVLAL
FT                   IVVGMLAVDFFAFEPHRAFKPVYPLVWLVYLPLYAAFAIARAYWFPHSGPTANAYPYDY
FT                   LIITQFTWGGAGVACLKIVAIYLAVGVVLCLFDRALPAKSAAE"
FT   gene            353043..353735
FT                   /locus_tag="Balac_0286"
FT   CDS_pept        353043..353735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0286"
FT                   /product="ribonuclease PH"
FT                   /note="COG0689 RNase PH"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45677"
FT                   /protein_id="ACS45677.1"
FT                   /translation="MRITRAFTDVPEGSVLIECGNTRVMCTATFTDTVPRWRKDSGLGW
FT                   VTAEYSMLPRATAQRTDRESVRGKVGGRTHEISRLIGRCLRGVIDMKALGENTIQMDCD
FT                   VLQADGGTRTASITGAHVALVDALNWAKQNGKIKSVKNVLLDSVSAVSVGVIDGEPMLD
FT                   LPYVEDSRAMTDMNVAMTGSGKFVEIQGTAEHRPFSRNELGVLLDLATKGNRELQAAQQ
FT                   AALDADLR"
FT   gene            353764..354483
FT                   /locus_tag="Balac_0287"
FT   CDS_pept        353764..354483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0287"
FT                   /product="Xanthosine triphosphate pyrophosphatase"
FT                   /note="COG0127 Xanthosine triphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45678"
FT                   /protein_id="ACS45678.1"
FT                   /translation="MNIVVATHNEGKLVEIRDILAEEFGDGAHDIELVSAGSLGLPDPV
FT                   ETGITFEANALLKARFVARLTGLPAIADDSGLIVDVMGNAPGILSARWAGEHGNDAANI
FT                   DLLLAQIEDIPDDDRTARFRCAAALVVPIAAEEDVADFEADPSDGMDDGDGLVDARETV
FT                   VLGEMPGTIVRHPHGSNGFGYDPIFMPDEQPAGAEESGELLTSAEMTPEQKNAISHRGK
FT                   ALRALMPAIRELVETGE"
FT   gene            354549..355808
FT                   /locus_tag="Balac_0288"
FT   CDS_pept        354549..355808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0288"
FT                   /product="FemAB-like protein"
FT                   /note="COG2348 Uncharacterized protein involved in
FT                   methicillin resistance"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45679"
FT                   /protein_id="ACS45679.1"
FT                   /translation="MNEQEFRAFAEASPQSNFQQTVEMANLRRMHGMDVDFVGMREDGE
FT                   IKAGAVFATHHAPMATFCSVISGPLCDYDDDELVAEFLRALARFAKKKGAVHLDIAPNQ
FT                   RYRVRDDHGEALPESEGGAPDKRMIRNIEQAGYEHGGFVRGYTSTVRWRFAKDMTGIGD
FT                   ESELLKSYSKRTQWSIKRARSMGVHVREIGVDELDTFARIEQQTAERRHFEFRGPQYFK
FT                   QFAQCFGERARFVLAEIDTAEYQRSMQRKADDLRALVDGLEAKIAQRETTKLRRRLNEE
FT                   SSNLAAANKRLAEANELVEKGDLIPAAASMFVLGPREVVYLFSGSVEEYKPFYASALIQ
FT                   HEAMLRYCVQGVEPFGHVNLYDFYGIDGIFDDPDDEGRGVLEFKQGFNGYVVEMPGDFM
FT                   KVLRPVTYRAQRLAHKLLGR"
FT   gene            complement(355838..356845)
FT                   /locus_tag="Balac_0289"
FT   CDS_pept        complement(355838..356845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0289"
FT                   /product="hypothetical protein"
FT                   /note="COG0679 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45680"
FT                   /protein_id="ACS45680.1"
FT                   /translation="MTLLQPIALLAIIIAGYLFKRCRLFGQRDYRIIQVMLFDLVLPGA
FT                   IVYSFATNPHDPSLLWLSAFGFVVALVPVLVIFSATRHSPVTQRAFLMLNATGLNIGCF
FT                   CFPVVQAFLGEQAIVPAAMFDIGNCIMVAAGTNVMTQTLLHIQPGRPLTEQGAGDAPTL
FT                   PYTRPTDRDAKRLARRSLLHTVLKGFVGSIPFDTYVIMIVLMVCGLSLPAWFADLFRPL
FT                   SNANACVAMLMVGMMMDLPANRSDTFAVLKVLAWRLPFGLAFAAVAWFLLPFDAGIREA
FT                   TMMCCLAPVAVFSTLFTDEVLGNARLAGFTLSVSAVISLGMMTGAHAMIAAGII"
FT   gene            complement(356963..357047)
FT                   /locus_tag="Balac_0290"
FT   tRNA            complement(356963..357047)
FT                   /locus_tag="Balac_0290"
FT                   /product="tRNA-Leu"
FT   gene            complement(357105..357180)
FT                   /locus_tag="Balac_0291"
FT   tRNA            complement(357105..357180)
FT                   /locus_tag="Balac_0291"
FT                   /product="tRNA-Thr"
FT   gene            357297..358508
FT                   /locus_tag="Balac_0292"
FT   CDS_pept        357297..358508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0292"
FT                   /product="mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /note="COG0836 Mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45681"
FT                   /protein_id="ACS45681.1"
FT                   /translation="MSNGFDDFYAIIPAGGTGTRLWPLSREAKPKFLFDLLGSGRTLIQ
FT                   STFDRLAAIAGMDHVCISTGERHVDAVEEQMPEVAPEHIFAEPAPRDSTAAIALATAVL
FT                   ARRHGNDIVVGSFAADHVIRGKVAFVDAVRQAVATARAGYVTTIGIAASRPSTAFGYIH
FT                   EGESLAARVPDAPDAVLVERFVEKPNAATAQAYLNTGEYRWNAGMFVMRADVLLDHLHR
FT                   VKPQLARAIDAIADAVIEDDRDLARAQAEAHERGENVRETVNPDDFHAHRDEAMRKYWQ
FT                   GIEKIAFDYAVAEPLSVEGGVAMIPGDFGWDDIGDFNSVAALLPSVDERNLKILGNTEQ
FT                   VVTLDSAGDIVVPNSERTVALLGVNDMVVVDTPDALLITPRARSQEVKSMVKTLAESGC
FT                   DELL"
FT   gene            358798..360495
FT                   /locus_tag="Balac_0293"
FT   CDS_pept        358798..360495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0293"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /note="COG0166 Glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45682"
FT                   /protein_id="ACS45682.1"
FT                   /translation="MAINPPVDATGTAAWKKLQQHYDELQAQGIDLKQWFEDDPTRVDS
FT                   LSFDVGTLRFDFSKNLIKPETLALFAELADEVNLKQRTKDMYSGVHINNTEDRAVLHTA
FT                   LRRDASDEGKLIVDGQDVVKDVRETLDRMYAFADKVRSGEWKGVTGKEIETVVNIGIGG
FT                   SDLGPVMVYEALKPYADAGIKARYISNIDPNDLAEKTRDLDPETTLFVVVSKTFGTLET
FT                   LTNARQARAWLLEQLQASGAIDGTAEQKAEAVEKHFVAVSTNLERVKDFGIDPANAFGF
FT                   WDWVGGRYSVDSAVGLTLAIVFGPARFEEFLAGFRQVDQYFAETPFEKNAVVIMGMINV
FT                   WYRNFFKVASHAVLPYDQYLHRFPAYLQQLTMESNGKSVRWDGTPVTTETGEIFWGEPG
FT                   TNGQHAFYQLIHQGTQLIPADFIAFANTPNPLKDGDQDMHELLLGNYFAQTKALAFGKT
FT                   ADEVRAEGTPEDIVPARVFSGNRPTTSIFGVRLDAFTLGELISLYEMVTFVEGTVWGID
FT                   SYDQWGVELGKQLAKQITPAISQNDEALAAQDASTRSLINFYRKVREF"
FT   gene            360819..361184
FT                   /gene="rplS"
FT                   /locus_tag="Balac_0294"
FT   CDS_pept        360819..361184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="Balac_0294"
FT                   /product="50S ribosomal protein L19"
FT                   /note="COG0335 Ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45683"
FT                   /protein_id="ACS45683.1"
FT                   /translation="MVNAIEAFDAKHMKPADEIPAFRPGDTVDVNVKIQEGNNSRIQTF
FT                   TGVVIGRQGAGVRETFIVRKISFGTGVERRFPLHSPSIDSIKVVRRGRVRRAKLYYLRN
FT                   LRGKAARIVERRDNSAK"
FT   gene            361398..362123
FT                   /locus_tag="Balac_0295"
FT   CDS_pept        361398..362123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0295"
FT                   /product="Signal peptidase I"
FT                   /note="COG0681 Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45684"
FT                   /protein_id="ACS45684.1"
FT                   /translation="MDSSNEPMPQSPAPMETHGNRDAGAGNLDSAGTEQQLASTRGTAI
FT                   RDFFLWCAIPVAIVVLLRIFVFGMYVIPSRSMENTIMPGDRVITTKLSPRPVALKRGDI
FT                   VVFKDPSNWLASEETTYHSDYLIKRLIGMPGDTVECEGAGQPVKINGVAIDESAYVKPG
FT                   DQPSTFPFKVTVSEGHVFVMGDNRSNSADSRFHLNDAQHGQVPIRDIAGVAFARYWPLN
FT                   RISWLSNYSDVFANVPDAG"
FT   gene            362168..362944
FT                   /gene="rnhB"
FT                   /locus_tag="Balac_0296"
FT   CDS_pept        362168..362944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="Balac_0296"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG0164 Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45685"
FT                   /protein_id="ACS45685.1"
FT                   /translation="MAPSFALERQIAADGFDVIVGFDEVGRGSLAGPVMVGAAAFLARN
FT                   LDEAQTAMPQYLADSKTLTEHRRESLYEPLQAWVDGFAIGSASNAEIDAWGISHALGIA
FT                   ALRALDGVERALGMGSPGDSEIRGFDERCKYSGTWAYTKHSPQQHADGLHVGAILDGPN
FT                   DYISKALGTFEAPAVPMPAQVRTLVKADAQCASVAAAAVLAKVTRDRLMEQLARDHAEY
FT                   ARYGWERNKGYGSKAHREAIAQCGPSDLHRVSWHLA"
FT   gene            363051..364037
FT                   /locus_tag="Balac_0297"
FT   CDS_pept        363051..364037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0297"
FT                   /product="SalX-type ABC antimicrobial peptide transport
FT                   system ATPase component"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45686"
FT                   /protein_id="ACS45686.1"
FT                   /translation="MNAMQNNNPGAPMPQAPQNAPHPLPQTPADAMPHNGYAPQPPMTA
FT                   APMPYPDGAPMGGQSLALQGIDLVMDYNTSASGNPAATQPAAWQMGQPLALNHANFQLG
FT                   EGERVAIMGPSGSGKSTLLHVLAGIMKPTAGQVLFRGANIDRIPDAERTRMRRQAFGFV
FT                   FQSGQLLPELPAIENVALPLMLGGMAYSQATDQAAMWLERMGLRNLMRNRPGQMSGGQM
FT                   QRVAIARALCVNPAIIFADEPTGALDQNTGHEVMNLLMQAAAANNAAVVLVTHDPNIAA
FT                   YCDRTVSMRDGMILDAANRRAGMQRQPQNDAPAQAVQMGAQPQGALQ"
FT   gene            364034..365458
FT                   /locus_tag="Balac_0298"
FT   CDS_pept        364034..365458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0298"
FT                   /product="Permease component of hypothetical
FT                   ABC-typetransport system"
FT                   /note="COG0577 ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45687"
FT                   /protein_id="ACS45687.1"
FT                   /translation="MSTFALWRLFHRHMFHHDDEPDAPRDHTGLLAVIAFAAATAIFLT
FT                   VLGGLHGFIWRASPDHTVGCFFNDSACSTHANVSVNGEFYVVLAMFACVLLVVPFTTLA
FT                   GSAARLAATRRDERLAVLRLAGATTSQVVRLIALEAVGQAVIGSVLGIAGYFAVMPLIM
FT                   MLHFENHTFDFEQLWVGPWALIGTVVGVAALALVSALLTLRKVAITPLGVTARQGAAMP
FT                   GKWRVALFVVALVFGFAMLNNMNLVAGAGVAVAYGVVFAIIGGCFMLLNVIGSWVIAAV
FT                   AKSRAHRPKSAATMIAMRRILDNPKRAWRNVSGIALAVFIAGITAVCGALGTASGDADA
FT                   ETLMMMHDISLGGTLTLVFAAVLAAVSSGIMQSASVFDQADEYHMLMLEGTDALTLRKA
FT                   RFSEVLTPLNTVIVISAGCSLLLMLPLVGSMLSNPAVLLRCLFGIVLCYALVTVGAVSA
FT                   NHTATRLDSISRRRDD"
FT   gene            complement(365642..366583)
FT                   /locus_tag="Balac_0299"
FT   CDS_pept        complement(365642..366583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0299"
FT                   /product="hypothetical protein"
FT                   /note="COG0679 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45688"
FT                   /protein_id="ACS45688.1"
FT                   /translation="MGGLISAMEGFCVIGIVIAAGYAAARLQIGGAQAQYVFNRLSFFI
FT                   ASPCLMFAILAQENITHLFDSTIIVAFCSAVGVGLVFLVLNRLFFHLKAPDATIGVLNS
FT                   LYLNSNNIGLPIATYILGNPALVAPILVMQQALFTPVGLTVLDVTTKGKFSVKQVLKQP
FT                   LHQPLLIGTVLGIIVSVVSSKVGHFIVPNFLFDPIDMIGDSAVPMILMAFGMSLHGTKP
FT                   MQNKSNLPAIWTVAALKNIVMPLIAFGIAFAMGFRGPTLYGCVVLAALPTGQNVYNYAA
FT                   RYNVGMTFARDGILISTMTSPIVIAIIAALLS"
FT   gene            366797..368017
FT                   /locus_tag="Balac_0300"
FT   CDS_pept        366797..368017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0300"
FT                   /product="dipeptidase"
FT                   /note="COG0624
FT                   Acetylornithinedeacetylase/Succinyl-diaminopimelate
FT                   desuccinylase and related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45689"
FT                   /protein_id="ACS45689.1"
FT                   /translation="MQDVIDRAGEPLKLTVDAGVGEQAALTDLCMQVMRVYSVSDDETH
FT                   LTDMTEAFLRTLPHLDVQRHGDTLVARTNLGRDRRVVLAGHLDVVPVIDNFPPKLLEPG
FT                   DPLILPGVAEAHPGERVVWGRGATDMKSSDAVLLYLAATLTNPKYDLTYVFYDHEEVAA
FT                   EKNGLRKVAEAHPDWIAGDFAIIGEPTSCGIEGGCNGTIRFDVVTHGIAAHSARAWMGH
FT                   NAIHDAAEILRRLNEHTDATVSVDGLVYREGLNATLISGGKGTNVIPDECRVHVNYRFA
FT                   PDKSLAEAKALMMGADCGAELGNGEHQATGGVFEGFGIEMKDESPSARPGMDSELTRSL
FT                   AALAKARTGKDPEAKLGWTDVARFSQLGVPAVNFGAGSPLLAHKHDEQVAEGELTLMAG
FT                   ILRDWLS"
FT   gene            368580..371666
FT                   /locus_tag="Balac_0301"
FT   CDS_pept        368580..371666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0301"
FT                   /product="ribonuclease G"
FT                   /note="COG1530 Ribonucleases G and E"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45690"
FT                   /protein_id="ACS45690.1"
FT                   /translation="MPDLTENGLGSPEFDNTDTTNTTNDSTPTRRRRGRRVVRGAGEAG
FT                   AQMQLEVHDRVPLFQEPSAAIEAGKPTKALPAGSHEEESAESGDSNEPTATRRRSRRAS
FT                   TSTRSRSTRTTNDEAEEPTTTRSRRGRGAAQNDDEEPTVHTRRRSRAQADEAEEPRSTH
FT                   SRRSRRTVSDESEQTNDDSYESRTQHVLDALDESFDDDAETHETGRGRSRSRSRSTSRS
FT                   RTSRREVLEDADQHESADVENDEEESSARGNRRAGRPMTSLLFQEPVLPARSRSTHDEE
FT                   NDEGSDDEPLHDLDLNEGSTRSRKRSRNRRLNAQERRAAAEVEQIEEDLVLDDIVYAPI
FT                   DDETGKSGDESDSEESGIHTRRRRRRKSQENANAEREESENEEGTRTRRRSRAEDEEEN
FT                   DESTVTRRRRRRRNSKGGEEEEQPRRSRKQQYIDEITDVEGSTRLEAKKQRRRDNRRER
FT                   SRQNQLLEQDFLARRENVDRLMVVRERGRHTQISVIEDNVLVEHYVSDIQEVATVGNIY
FT                   LGRVQNVLPSMEAAFVDIGQARNGVLYAGEVNWDATRLEGQPRRIELAFKSGDPVLVQV
FT                   TKDPIGHKGARLTSQVTLAGRFLVLVPSGGMTGVSRKLSDRERNRLKSIVSKIAPKDMG
FT                   VIIRTAAEGASEEAIAKDLEGLTNQWAEIQRKREEFLHGKRPKLLQGEPDVAIRVVRDI
FT                   FNDDFNKMIVEGDGVYHRIEEYLDHMAPDLHNKLERWDPEEHGGKDVFDRWQIDSQLRK
FT                   GMERQVYLPSGGSIVIDRTEAMTTIDVNTGRFIGKGKSLEETVTRCNLEASEEIARQLR
FT                   LRDIGGMVMIDYVDMVMPANRDLVLRRLVECLARDRTKHQVAEVTSLGLVQMTRKRIGQ
FT                   GLVEAFSEECPECKGRGFIVHDEPTISAEFDDPYAMKGGDPFVRTNKHGHGTPEVHAPK
FT                   GSSAAVKAKLAQIAAAAVAANVAAEAEESVEAPAADTTEETAKVDVAVESTVESAAESA
FT                   GNAGDTERVEQVEGEVIDDAEQSADDAAAVTVEDAAEES"
FT   gene            372654..372962
FT                   /gene="rplU"
FT                   /locus_tag="Balac_0302"
FT   CDS_pept        372654..372962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="Balac_0302"
FT                   /product="50S ribosomal protein L21"
FT                   /note="COG0261 Ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45691"
FT                   /protein_id="ACS45691.1"
FT                   /translation="MYAIVKAGGHQEKVEVGDTILVNRLDAKNGETVEFPVALVVDGEK
FT                   VIIAAADLAKISVKAEVVNDDAKGPKIRIQKFKNKTGVARRKGHRQKLTQLKITAIA"
FT   gene            373002..373253
FT                   /gene="rpmA"
FT                   /locus_tag="Balac_0303"
FT   CDS_pept        373002..373253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="Balac_0303"
FT                   /product="50S ribosomal protein L27"
FT                   /note="COG0211 Ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45692"
FT                   /protein_id="ACS45692.1"
FT                   /translation="MAHKKGASSSRNGRDSNPQYLGVKKFGGEAVVAGNIIVRQRGTKF
FT                   HAGKNVGVGKDHTLFALADGNVQFGVRRDRKVVDVVTE"
FT   gene            373438..375150
FT                   /gene="obgE"
FT                   /locus_tag="Balac_0304"
FT   CDS_pept        373438..375150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obgE"
FT                   /locus_tag="Balac_0304"
FT                   /product="GTPase ObgE"
FT                   /note="COG0536 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45693"
FT                   /protein_id="ACS45693.1"
FT                   /translation="MSDFVDRVTVHVKGGDGGNGSAGIRREKYKPLAGPNGGNGGKGGS
FT                   VILKADQNATSLLDFRFMPHRTADSGTMGLGDTKDGSNGADLVLPVPVGTVVFEARGAQ
FT                   GFPKKPGAVLADLRHAGDTYVAAAGGAGGLGNAALANRTRRAPGFALLGEPGDERDIIL
FT                   ELKSIADVALVGFPSAGKSSLIAAMSAAKPKIADYPFTTLVPNLGVVQAGDMRYTIADV
FT                   PGLIPGASQGKGLGLTFLRHIERTEIIAHVIDCVTIDPDRDPLSDYYALEKELGEYADD
FT                   LDLPLGAIPIPERPRVIILNKIDVPDAKELADFVRPEFEKLDLPVYEISTASHAGLKEL
FT                   NFALAKLVKEMRAQIAEREESVDEERVVIKPLEEPGTQRRNGRNAQVREFEIEREDDGH
FT                   GNFWFTVTGVKPERWVRQTNFDNDEAVGYLADRLAKLGVEDSLRKHGAHAGDEVRIGRG
FT                   ERAVAFDWDPTIAAGAEMLDGTQLGSRGKDLRLEEEDGRKRRRTNSERRREYHEMMDAR
FT                   AAVRAAMQAERAAGHWADPSIDDDRHDEQSLFGRGEVEEYEDEPGADGSRQLD"
FT   gene            375211..376344
FT                   /locus_tag="Balac_0305"
FT   CDS_pept        375211..376344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0305"
FT                   /product="gamma-glutamyl kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="COG0263 Glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45694"
FT                   /protein_id="ACS45694.1"
FT                   /translation="MQTPSQEEVRRAVAAARTVVVKVGSSSLTQPSGHLDVDKLNALVG
FT                   AIAQVRMLGGNIVLVSSGAIAAGFGPLGFESRPTDVATQQATASVGQGLLMAQYEMAFG
FT                   RYGIRVGQLLITAEDTMQPRQYRNARRTMAKLLELGVVPIVNENDALASNEIRFGDNDR
FT                   LSALIANMVRADALILLTDVDALYTAPPSEPGSHRIGFVPNITELLDQVRVGGSESGVG
FT                   TGGMVTKLEAARMAAVSGIPAVLTAARNAGPALMGDEVGTAFAPVKQRGSARRLWIKFA
FT                   AHPRGVLVADSGAAKAVRGGRASLLAAGVLESRGDFAAGDPVWIDDEAGNHLARGLAGY
FT                   DSEEIPNMLGRNTAQLRRLLGEEYAHPLVHRDNLVLV"
FT   gene            376458..377675
FT                   /locus_tag="Balac_0306"
FT   CDS_pept        376458..377675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0306"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="COG0436 Aspartate/tyrosine/aromaticaminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45695"
FT                   /protein_id="ACS45695.1"
FT                   /translation="MPTDQTRLPLSNRIDKVAPSATLAVDMKAKAMKAQGIDIIGFGVG
FT                   EPNFATPEAIVEAAAAAVVNPANYKYSPTPGLPELRQAIASKTLRDSGYEVEPEQVVVT
FT                   NGGKQAVYEAFQLIVNDGDEVIIPSPYWTSYPEMVKLAGGKPVEVFAGADVNYEPNLDD
FT                   IEAARTDRTKAIIVTSPNNPTGAVWSERTIRDIAEWALDHNIWVISDEIYEHLTYDGVK
FT                   TTHIGAAVPQIREQLIVLDGVAKTYAMPGWRVGWMVAPLAVAKAASKLQGHMTSNVNNI
FT                   AQRAAIEAVSGPLDAVAMMRDAFNVRRLAIVAALNDINGVHCPMPEGAFYAFPNVEGLL
FT                   NRPMGPNGTTFTTSAELAEALLEEGHVAAVPGEAFGAPGYMRFSYAVADEEITEGMRRF
FT                   KEWAEA"
FT   gene            377822..377897
FT                   /locus_tag="Balac_0307"
FT   tRNA            377822..377897
FT                   /locus_tag="Balac_0307"
FT                   /product="tRNA-Trp"
FT   gene            377938..378168
FT                   /gene="secE"
FT                   /locus_tag="Balac_0308"
FT   CDS_pept        377938..378168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="Balac_0308"
FT                   /product="preprotein translocase subunit SecE"
FT                   /note="COG0690 Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45696"
FT                   /protein_id="ACS45696.1"
FT                   /translation="MARKTDHGEEVIKPNVFMRIGLFIKQIIDELRKVVTPTRKQLFYW
FT                   SLAVFIFVALLMVFVTAMDFGLGKLSFLIFG"
FT   gene            378299..379291
FT                   /locus_tag="Balac_0309"
FT   CDS_pept        378299..379291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0309"
FT                   /product="Transcription antiterminator"
FT                   /note="COG0250 Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45697"
FT                   /protein_id="ACS45697.1"
FT                   /translation="MTDEVNLENIDDLPINLDAVSADDNTADAQEVQIDQVEAASESED
FT                   IAEGMAYDAVSAGDDAQPSDQAAAQEDSLTDSVDDSAAVDSDAHSEGTADEDTQHADAE
FT                   EAAADEAPEAAAEAEEEAEEDAGSKAVKEFSKSLRTLEGKWYVLHTYSGYEKRVKSNIE
FT                   SRVQSFGLEDTIFQVEVPMEEVEKHTEKGKKVVTRVRVPGYVLIRMYPDENARRIVRET
FT                   EGVTGFVGPSREPAPLSRKEVVSMMAPMIASHALKEAGDKPAAAKKRTLEVSYKVGDQV
FT                   TVTDGPFTSMSAVVSDVEPATQKLTVLVSIFGRDTPVELGFDQVQRLDA"
FT   gene            379533..379964
FT                   /locus_tag="Balac_0310"
FT   CDS_pept        379533..379964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0310"
FT                   /product="Ribosomal protein L11"
FT                   /note="COG0080 Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45698"
FT                   /protein_id="ACS45698.1"
FT                   /translation="MAPKKKVSALIKLQIEAGKANPGQKLGPVLGSHGVNIMDFCKAYN
FT                   AATQDKMGQVIPVEITVYEDRSFDFVLKTPPASDLLKKAAGVAKGASNPLTDKVGSVTK
FT                   AQVKEIAETKMADLSARDIDAAMKIIEGSARSMGITVND"
FT   gene            379984..380673
FT                   /locus_tag="Balac_0311"
FT   CDS_pept        379984..380673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0311"
FT                   /product="50S ribosomal protein L1"
FT                   /note="COG0081 Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45699"
FT                   /protein_id="ACS45699.1"
FT                   /translation="MAKHSKKYREAAERIDRNNLYTPEEAIALLKSMPAYNFDQTVEAV
FT                   LRLNVDPRKADQLVRGSVNLPNGTGKTAKVLVFARGPKATEALEAGADIVGDDDLVEKV
FT                   ANGFLDFDSVVATPDMMGKVGRLGRVLGPRGLMPNPKTGTVTMDVTKAIKDIKGGKVDF
FT                   RVDKNGNLSFLFGKLSFSAEALDQNFRAVADEVKRLKPATVKGRYITKATISSTMNPGI
FT                   PVDPASI"
FT   gene            380796..381587
FT                   /locus_tag="Balac_0312"
FT   CDS_pept        380796..381587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0312"
FT                   /product="hypothetical protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45700"
FT                   /protein_id="ACS45700.1"
FT                   /translation="MTKFEHADILDLLGGDIDDNAVMRLVFECLISGIDDDRVVSLMNL
FT                   IGWRGSFSCFALGGTPADSMGATFTQISSAVRDFGGSHAIFGMYGRFVIACIELEAAVS
FT                   PEIVCTAALPAFAQSEAVYLSPVREGVPGASHAVRETLFSLQAAPSLSTQSRPLRADEL
FT                   LPERALLGDEVAREELYRNVYLVLHGDNEDDPSYITVSTFLRHGGSLEATAKELNVHPN
FT                   TVRYRLKKAAETTGWDATNPRDAFVLNTAIALGRMREAGVR"
FT   gene            381645..382541
FT                   /locus_tag="Balac_0313"
FT   CDS_pept        381645..382541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0313"
FT                   /product="hypothetical protein"
FT                   /note="COG0340 Biotin-(acetyl-CoA carboxylase ligase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45701"
FT                   /protein_id="ACS45701.1"
FT                   /translation="MTTELNGDYRRAREKAHVISLDTVTSTNDYAAQLVADGRLDRNGM
FT                   TIVLAREQTQGRGRLDHTWVSVPGKSFIASVICIVNADTAKDPQVNGWLQMIAGMSVID
FT                   ALRETVMSANMDWLDHTRGNPSMRSELQLKWPNDIVYQGMKLGGILAQLVQIPGDENSV
FT                   AIIFGVGLNLDLAPDQLPTAQSTSLQLIASCVNGAACVPADQLADMIAAGLVNALSKRL
FT                   WYFGENPAGYAQNLHRRIAEECWTLGKPVLVHRTDGTTLTGEAVAINEDASLSVRDDSG
FT                   QVHVVRTGDVGVLPVED"
FT   gene            complement(382563..383192)
FT                   /locus_tag="Balac_0314"
FT   CDS_pept        complement(382563..383192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0314"
FT                   /product="hypothetical protein"
FT                   /note="COG1268 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45702"
FT                   /protein_id="ACS45702.1"
FT                   /translation="MHELMHSVTRVNLRSLVRTLAPSLIVALLLCGSTMAGKIPVPGTP
FT                   VPITLQTFVLMTAALTLGWRRATAGTVLYLGLGAAGLPVFSGGGSTLSLIGPSGGFLFG
FT                   FVPSVMLTAVLAGTANRAITSLRTKHDMHPALAGAARFIACFMACAFGFLIAGYGFGAA
FT                   FQSTVTGMPLGITAASTLVFVPGDLIKIAVASLLALPVLASADSAR"
FT   gene            383488..385362
FT                   /locus_tag="Balac_0315"
FT   CDS_pept        383488..385362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0315"
FT                   /product="JadJ"
FT                   /note="COG4770 Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45703"
FT                   /protein_id="ACS45703.1"
FT                   /translation="MTDTVSKLLIVNRGEIALRVVRTAREMGIPTVVVYAEQDRHSQYV
FT                   KMADEAFLLSGDTYADTYLNEDLLIDILRRSGADAVHPGYGFLSEVPSFADKVIEAGAT
FT                   WVGPSSRALTDLGDKISARRVAVYAKVPPVPGISHSLGDMRVLLDFAHTHGYPLMLKRA
FT                   DGGGGRGITLVRDDDELRGFYLNHNAVQGGDLDEYFVERFIDHGRHVETQCGRDSHGNF
FT                   TVYSTRDCSVQRRNQKLIEEAPAPFLGDDVVEQLHAYSHRLFDAVDYVGLGTCEFMVTD
FT                   AGKVYFLEVNPRLQVEHTVSEEVSGLDLVREQLQIAAGGKVSPEPTARGHSFELRITSE
FT                   DPKTNLTPSSGTLERVQWPAGPGVRVDSGVVEGDTISPKFDSMMGKLIVTAHSRQAAVA
FT                   RVRRALDELRIEGVPTPVELYRQVFGDDEFTAEHGHGFDVSTKWLERKYLNHEPATVHG
FT                   GQPASLDAGAGAAEPELDHSEQFVIEMNNRRVVLNVPSDMFANLTGAARSHGERRPTQP
FT                   LRGQGSHHVDRGNARTAERPGVISAPMQALVTRINVSEGQQVAKGDLLVVLESMKMENY
FT                   VYSPANGTVKEIFASPATGVEAGETLLTMEVAGTSKPANPTTDTTEEA"
FT   gene            385364..386995
FT                   /locus_tag="Balac_0316"
FT   CDS_pept        385364..386995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0316"
FT                   /product="propionyl-CoA carboxylase beta chain"
FT                   /note="COG4799 Acetyl-CoA carboxylase, carboxyltransferase
FT                   component (subunits alpha and beta)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45704"
FT                   /protein_id="ACS45704.1"
FT                   /translation="MIDSIDANLAAVEAADAAAANGADAQGAMRQPIRPAVTKAAELAR
FT                   DAENRARDRQHVKGKFTARERLDLLLDSGTFEEIGRFRGGDINKGVAGSAVITGFGEVW
FT                   GRKVAVYAQDFSVRGGSLGVAEGRKICHLMDQALALRVPIIALIDSGGARIQEGVAALT
FT                   EYGNIFRKTCEASGFVPQLSLILGPCAGGAVYCPALTDLIIMTRENSNMFVTGPDVIKA
FT                   STGESISMDDLGGGIVHNVKSGVAHYLGADEADAIDYARTVLAYLPANSGQTAPRYAYM
FT                   ATRADRDIAERLGTVVPGNERQPYDVLDVIRCLVDYGEFVQVHELFAQSAVVGFACMDG
FT                   QPVGIVANQPNVNAGALDVDSSEKVARFVRLCDAFNLPIITLVDTPGYKPGAEQEHAGI
FT                   IRRGAKVIYAYANAQVPLVTVIMRKAYGGAYIVMGSKAIGADLNYAWPTSQIAVLGAAG
FT                   AVNIIHRKDLQKAKDAGRDVEAVRAKYIAEYEETTVNANLSMEIGQVDAMIDPEQTREV
FT                   LVDSLKTLASKRRVSRTGKHHGNQPL"
FT   gene            387129..396446
FT                   /locus_tag="Balac_0317"
FT   CDS_pept        387129..396446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0317"
FT                   /product="fatty acid synthase Fas"
FT                   /note="COG0331 (acyl-carrier-proteinS-malonyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45705"
FT                   /protein_id="ACS45705.1"
FT                   /translation="MSTPEFFVNRLNSEPHALMFAGQSTPWVVAVKQLMDDPELAQRLI
FT                   DHVAAAHDLLTPVSAQLLATTGRETDLFSFEANPAKLGPAADATASIEGIALAQLGALL
FT                   DLDQLGYTLASANPVALLGHSQGILGVHMAQAIIDAGSIEAARPQIDEILAIAALIGAA
FT                   GTREARAHGLVRKYGDATPMLSVKGILPAQADELIRRVDDARGPIAVAVINSANHVVLS
FT                   GHPQDLASFAVEVAKEHKHQAQLRAEKVRGGSVFDPVLEYLEVTLPFHSPIMEQAVEQT
FT                   VAWAEECGIDVARARVLAGEVLVNQVDWSAQVANLFKENDPRTLWAVDLGPGTTLAKLF
FT                   GTVAEGTGVGVVEAANVADRAKLATETDAPARMQDWTQYVPQVVRTLQGERIETAFTRL
FT                   TGKPPVLLAGMTPTTVDPEIVAAAANAGYWAELAGGGQVTADVFDRHVAELEEQLDEGR
FT                   TVEFNAMFMDRYLWNLQFGTSRIVPKKRASGAPIDGVVISAGIPEPDEAVALVKELNAE
FT                   GFPYVCFKPGTVDQIRQVVRIAKAVAPANILVQVEGGSAGGHHSWESLDDLLLNTYAQV
FT                   REQSNLVLVVGGGIGTPERAADYISGEWSTRYDHPLMPVDGVLVGTAVMTAKEAHTSPE
FT                   VKQLLVATPGIADAGSDAAADVFAPLGEAWVPSGKAVGGVSSGLSHLHADIYELENASA
FT                   RCGRLLVRVMKHPEELESRRQEIIDALNETAKPYFGDLSGMTYEDWARRFAELSFPWAD
FT                   GTYADRYLHLLQRIEARVIDLEQGEFTPMFSTRADVESDPFAALAALVEAYPQMGELKV
FT                   VPTDEAWFIELVREYPKPMPFVPAIDNDLLRWWGQDQLWQSEDPRYSADSVRIIPGPIS
FT                   VAGITTVDEPVADILGRFSDAMTARVASNAASRTDRFALLADCEDAEDFIRRSPNISWI
FT                   GHQMANPAFGTARGDANYELKHLGRDEQAGVEQFDLDIHLDTFWDDDPDGGLSKHAVRD
FT                   IVIPLNVTLDATGMIPVVDRERLPEHVYRMLADTAGIGNTAITGDKLEAMPQITEVADT
FT                   ETFPFGQAHAGYTLSANLGFDHEAATGGALPMDLTPSRIAPDALVGPAWPAIYAALGSV
FT                   MVDGYPVIEGLLNAVHLDHLIELEVSEDELLAHTGEEISLTGWAEPYFESASGRVVTIH
FT                   VRHTAADGTVLANETERFAIRGRAYNDALPAAAPDFGGIDEQIVSTPRRMLRRVNVRAP
FT                   HEMTAFARTSGDFNPIHTSHRGAAISGLTQPLVHGMWLSATAQHAVQALDEQGAHYEIA
FT                   GWTYNMYGMVQLDDEVEISIERIGRVAHAGLVLEVTCRIDGSIVSRATAIARAPISAFV
FT                   YPGQGIQQQGMVLDERAKSPAARDVWERADRLTRERLGFSILAVVRDNPKELTANGVTY
FT                   RHPEGLLNLTQFTQVALATVAFAQTARMQEAGADIRPSYFAGHSLGEYNALSSFAHVIP
FT                   LETVLELVFHRGSTMHHLIDRDAQGRSNYRMGALRPNQFGVDDAHVKEYVESVAKASGE
FT                   FLEIVNYNLAGQQYAIAGTIAGLKALQADSARRVAEYGGKPAFILVPGIDVPFHSTLLR
FT                   KGVPEFRDKLDALLPAEIDYRGALEGLYIPNLVAAPFEMTKEFAQKILDVVPSERIAAA
FT                   LADDAVWDSYAADDQKLGRLLLTELLSWQFASPVRWIETQALLFGSAEQGGLGVEEIVE
FT                   VGLGNAPTLANLASKTLRLPEFSRRHVTVYNVGRDEGRVYMTDSDSLVPEVDDVRTPAA
FT                   DPAAPAQAVAAANASASVVVETAEPVAPVAPAGGVSGANVPDLDYRAHDAIEMLLSYAA
FT                   KVRPEQIGENDTTDTLTNGVSSRRNQLLMDISSELGVASVDGAAEASIRDLNALVDKVA
FT                   PNYKAFGPVLSDIVRDRVRSLFGAAGVKLPQITKRVTETWQLGEGWANHVVGQLVLATR
FT                   EGTSSRGGDLATLGTDAASNAAAANALIDAAVQAVAAAHSVQVAMPSAGGASGGVVDSA
FT                   ALDAYAQSVTGSDGVLAATARFVLGQLGLAEPNAVEAEDENAAIVATVEAELGSDWPAQ
FT                   VAPRFDERQAILFDDRWASAREDLARAYYNGETDAIAGDFTGAGAAVARQAAWYAQQSA
FT                   GSALAEQYERIAQQAMESTQSAHLEYDGEVAVVTGVAPNSIAAQVVNGLLAEGATVIAT
FT                   SHSFKPSVKAWAQRTYREHAQGDAKLWLVPANLSSYRDVDALVNWVGHVQKKTSGATTT
FT                   VLKPAYEPSLFFPFAAPPVHGSLADSGALFESQARLMLWGVERAIAGFAAIGADTDVQH
FT                   KLHVVLPGSPNRGVFGGDGAYGEVKSAFDAIVNRARSEQVWSNRVTFAHPKIGWVRGTG
FT                   LMGGNDPLVEVVERHGLKTYSTEQIAEELLKLTTAAAREQAQVAPLDVDLTGGLGSEPI
FT                   DIKALRAQALADAAPDAAEETSETEADAPIKALPSPRVPHQAAVDLAEWERVSAKPEDE
FT                   IVIVSIGELGPWGSGRTRAEAELGIHADGEVDLSAGAVLELAWNMGLLSWQDSPKPGWY
FT                   DTDGNLVPETDIAERYHDEVVAKSGVRPFETGMGSDYRSGTDEEEAEVYLDHDVTFGVP
FT                   TRQIADEYVAMDPEHTSLAQDGESGEWNVTRHAGSMIRVPRRAAMTRTVGGQFPDGFDP
FT                   LKWGIPASMVGDVDEIALWNIVTTVDAYLSAGFTPAEILEAVHPSMVASTQGTGFGGMS
FT                   SMRKLYLDRFLNHEIPTDILQEALPNVVAAHVMQSYIGGYGNMVQPVSACATAAVSLEE
FT                   GADKIALGKADFVVTGAIDDIGVESVIGFGNMNATANSQEMLDKGIAPRFFSRANDRRR
FT                   GGFVESQGGGTILLTRGDIALRLGLPVAGVVGFVHSYADGAHTSIPAPGLGALAAGMGG
FT                   RSSKLVRDLARLGVDPDDITVVSKHDTSTNANDPNESELHNTLAHAIGREDGNPLFVIS
FT                   QKSLTGHAKGGACIFQVNGITQLFKSGVIPANASLECVDPKLERDDLMVWLREPLHIGS
FT                   RHTVKAALATSLGFGHVSGFTAIVHPGAFEAAVEHTAGVEALKAWRARANERLAAGRRH
FT                   FEEGMMGRAALYEPIDNRRFHEDGRGYDAHEVEKAMLLDPDARLGADGYFA"
FT   gene            396679..397125
FT                   /locus_tag="Balac_0318"
FT   CDS_pept        396679..397125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0318"
FT                   /product="putative holo-[acyl-carrier protein] synthase"
FT                   /note="COG0736 Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45706"
FT                   /protein_id="ACS45706.1"
FT                   /translation="MMLGLGHDVVDVGAFAEQLEMPGTRMTRLFSARECRQASLRASIK
FT                   HDGEALHLAAKWAAKESVVKAWCEALVGRGITERPYTVDDTPWSRIEIVDDATGCPRVV
FT                   MAAEVHVELCRSLAVTESAEPVWHVSISHDGGIASAVAVLDMRE"
FT   gene            397186..397259
FT                   /locus_tag="Balac_0319"
FT   tRNA            397186..397259
FT                   /locus_tag="Balac_0319"
FT                   /product="tRNA-Gly"
FT   gene            397338..398048
FT                   /locus_tag="Balac_0320"
FT   CDS_pept        397338..398048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45707"
FT                   /protein_id="ACS45707.1"
FT                   /translation="MPDSEQQEIARLRSEPAATPTTPSSAGVMAQNIVSKHPEATIPES
FT                   DISLADIERKQSNPVKWTVSIVLVLAALIAPFWVGRSFAVHSTARVIEQLGHFTSYGIA
FT                   LVSWGVTTMIFVSLIMMIVDNRRMAWFGSFIVFLSLEQFIGGLSLFKLNFWSSTYVIYG
FT                   SHAYVANAANLGVIASALALAVFAIVWVGLLVMIRKDSPLNVLTHVWVSFIMFLVFELA
FT                   ALAILFCGGFMAVA"
FT   gene            complement(398124..399095)
FT                   /locus_tag="Balac_0321"
FT   CDS_pept        complement(398124..399095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0321"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="COG0039 Malate/lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45708"
FT                   /protein_id="ACS45708.1"
FT                   /translation="MGICTKIGIVGMGHVGAHVANSLVLQGIADELYMTEICSGERDRS
FT                   KKLAAEVQDLGDSLAFCPHNVALHNCGDDYAQLAQCDVIVNCAGDVSLSSKDRDGELFF
FT                   TTDTAKTFIKTIADAGFHGIWITIANPCDVVATEIWKESGMDPRRIIGTGTALDSSRLK
FT                   YVLSRVTGYDQHSITAYMLGEHGNSQFAAWSNVYFGGKPLSQLAMEQPERFAFDYAELE
FT                   AEARKGGYVTYAGKHCTEFAVADAACRLVRAVISNEHYITACSTLLTGEYGEEGFFISL
FT                   PCVVGADGVEEVMRLDLSDAEIDEFRKSCAHVKENLARTHIL"
FT   gene            399403..399672
FT                   /gene="rpsO"
FT                   /locus_tag="Balac_0322"
FT   CDS_pept        399403..399672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="Balac_0322"
FT                   /product="30S ribosomal protein S15"
FT                   /note="COG0184 Ribosomal protein S15P/S13E"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45709"
FT                   /protein_id="ACS45709.1"
FT                   /translation="MALTAEEKQDIIAKYATHEGDTGSPEVQIALLTKRIADLTEHLKF
FT                   HKHDHHSRRGLLLMVGDRRRLLDYLKKVDIERYRSLIERLGLRR"
FT   gene            400014..402635
FT                   /locus_tag="Balac_0323"
FT   CDS_pept        400014..402635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0323"
FT                   /product="polynucleotide phosphorylase/polyadenylase"
FT                   /note="COG1185 Polyribonucleotide
FT                   nucleotidyltransferase(polynucleotide phosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45710"
FT                   /protein_id="ACS45710.1"
FT                   /translation="MEGPEIKAVEAVIDNGSFGRRTVRFETGRLARQADGAVAAYLDDD
FT                   SMVLSTTTAGSSPKENYDFFPLTVDVEEKMYAAGKIPGSFFRREGRPSSEAILACRIID
FT                   RPLRPLFPHTLRNEVQVVETVLAVNPEDSYDVLALNAASASTLISGLPFTGPVGGVRLA
FT                   LIDGQWVAFPRWSERERAVFEIVVAGRVVESGDVAIAMIEAGAGKNAWNLIYDEGQQKP
FT                   DEEVVAGGLEAAKPFIKVLCDAQNELKRLAAKETREFTLFPEYTDDLYNRIDEIAHADL
FT                   DEALSIAEKLPRQERIAEIKQRVKDTLSVEFTDMDEMEKDKEIGNAFKELQRQIVRRRI
FT                   LTQDYRIDGRGLRDIRTLSAEIDVVPRVHGSALFQRGETQILGITTLNMLKMEQQIDAL
FT                   SGPTTKRYMHNYEMPPYSTGETGRVGSPKRREIGHGALAEKAIVPVLPSREEFPYAIRQ
FT                   VSEAIGSNGSTSMGSVCASTLSLLAAGVPLKAPVAGIAMGLVSGDVDGQHIYKTLTDIL
FT                   GAEDAFGDMDFKVAGTADFITALQLDTKLDGIPADVLAGALKQAHEARKTILEVINECI
FT                   DGPAEMSPFAPRIITTTVPVDKIGEVIGPKGKMINQIQEDTGAEIAIEDDGTVYISSEG
FT                   GEAAEKAKQIIDEIANPHVPQAGETYKGTVVKTTSFGAFVNLTPGIDGLLHISQIRNLA
FT                   DGQRIDAVEDVLKEGDSVEVVVQGVDDRGKISLAIPGFENQENNAGGRRSDDRPRRDDR
FT                   RHSDDRRRDDRPRRRSDDRDRDYDDRPRRRRDYDDDRDYDDRPRRRSHRDYDDDRDYDD
FT                   RPRRSDRRRDYDDDRPRRRRNDDRNPRYVADENYDEYREGREVRHERPRRRVRRDFDPF
FT                   DD"
FT   gene            402924..403499
FT                   /locus_tag="Balac_0324"
FT   CDS_pept        402924..403499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0324"
FT                   /product="LemA-like protein"
FT                   /note="COG1704 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45711"
FT                   /protein_id="ACS45711.1"
FT                   /translation="MSGWIIALIVIAIILVLTIWVIGMYNSLIGMRNRVGNSWAQVDVL
FT                   LKQRADLIPNLVEVVKGYATHESTVFEQVTKARAGVVEVANNPNSTLEQRAAAEQALTN
FT                   AMVNLRAIVEAYPDLKANQNFLDLQGRLASLEDKIAYGRQFYNDTVLKYNNRIMQVPTN
FT                   IIAGMFHFQPAQYFAADEADRSVPQVKF"
FT   gene            403585..405801
FT                   /locus_tag="Balac_0325"
FT   CDS_pept        403585..405801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0325"
FT                   /product="hypothetical protein"
FT                   /note="COG4907 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45712"
FT                   /protein_id="ACS45712.1"
FT                   /translation="MKKLSRSVFSSFTISCIIIVATLLLGYFVATDANNSDLSYRALDY
FT                   NVRVEDNGDLRIRETVDVKLDSRKDEDDNPKPWKQLYQQYTLRSSNLTNITNISVKNLT
FT                   SGEEYTQTEPQSPSGISNSTWNEKFARRWYIADVTDGDTNPKPYEPLTDGLASSGSDGV
FT                   VTKTVEIGWNIPATQSSSSKRFQIDMTWEGVTTAYNDVAKFQWEPFGAKNQTPIGVMTT
FT                   TVEFPAGVTRSDSWAWLHYSGNSSTERTANGLKFTAYNVRSGQYLDLVAMIGANHMHGV
FT                   TRHVDEDTKQWTLDDEARQEREWHERQRRNAQLRIVLWVAIAVAGALLAFFGIRSAIRS
FT                   VDAAKYKGNIEYWREPPNMSPAAAAQLYDIVMGVRNGGVTLANREMASTMMSLVSKGAI
FT                   AVYPGKAELYRGIDMSRANSAGLAQMLSSNGASEKELMKTSTIVIMPRALAEHHEELNL
FT                   CGSEERLLGILMEAYKRIHSPVFDLRQMNKAFRKWTNGYKAIEKFNAACKAELESLHAT
FT                   RSVGTAAVTCGILGIIVGIASAFYFIAAEHNFALALCISLPITVLCLFALVYCTTTGIT
FT                   DSGQQYAGQVRGLAKYLEDFSEFSDRGVLDLTLWDRYLVYATAFGISKKALRQLAAAYP
FT                   QVADQDWLDSNASNLGLLYWSTRPSTIVGSGIGNALANGTGSFGGFAGGFVDIGTQLNS
FT                   GFSSIQSTIRSAAPSSSSGSGGSFGGGGFGGSGGGSGGGSFGGR"
FT   gene            complement(405798..406763)
FT                   /gene="nrdF"
FT                   /locus_tag="Balac_0326"
FT   CDS_pept        complement(405798..406763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="Balac_0326"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   beta"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0208 Ribonucleotide reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45713"
FT                   /protein_id="ACS45713.1"
FT                   /translation="MPKLIDRVTAINWNRLDDEKDLEVWDRLTGNFWLPEKVPVSNDIP
FT                   DWRQMSDAEHTLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMESVHA
FT                   KSYSSIFSTLCSTREIDEAFDWSEKNPHLQRKAQIVLDYYEGDDPLKRKVASTLLESFL
FT                   FYSGFYLPMYFSSHAKLTNTADVIRLIIRDEAVHGYYIGYKYQKGLEMASDAKRAEMET
FT                   YTYDLLNELYENEVEYTHSLYDEVGLSDDVEKFLHYNANKALMNLGYPALFPSEICDVN
FT                   PAILAALSPNADENHDFFSGSGSSYVMGRAEETDDDDWDF"
FT   gene            complement(406803..408899)
FT                   /locus_tag="Balac_0327"
FT   CDS_pept        complement(406803..408899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0327"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   alpha"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0209 Ribonucleotide reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45714"
FT                   /protein_id="ACS45714.1"
FT                   /translation="MLNLYDEDGNIQFDKDHEAVDAFLAEHVAPRMIRFESTRERLRYL
FT                   VDHHYYEYDVFSKYSPEFLDAFYAHADALPHRFETFLGAFKFYRSYALKTFDGEHYLED
FT                   FPQRAAAVSLALADGDEPMAMRTLDEIVLGRFQPATPTFLNLGKAQRGEPVSCFLVRIE
FT                   DNMESISRGINAALQLSKRGGGVALLLSNLREEGAPIKHIENQSSGVVPVMKLLEDSFS
FT                   YANQLGARQGAGAVYLHAHHPDILKFLDTKRENADEKIRIKSLALGVVIPDITFELAKR
FT                   REKMALFSPYDVERVYGVPFADVNVTAKYEEMLADDRIRKTFIDAREFFTTLAEIQFES
FT                   GYPYLLFEDTANAANPIDGRITMSNLCSEILQVQEPSTYYEDLSYAHVGRDVSCNLGSL
FT                   NIARAMDAGLAGPVETAIRALTAVSQHTHIGAVPSIARANEEGHAIGLGQMNLHGFLAR
FT                   EGIRYGSPEALDFTNMYFETVAFHAYRASHALAVENGHAFARFADSAYARQPSDGNYFD
FT                   KYLDGSLDTEPRTGTVRALFERFGVRIPTARDWRELQGEILRDGIYNQYLQAVPPTGSI
FT                   SYINHATSSIHPIASKIEIRKEGKIGRMYYPAPYMTNDNLDLYDDAYEIGWKAIVDTYA
FT                   EATPHVDQGLSLTLFFPDTVTTRDLNKAQIYAWRKGIKTLYYIRIRQQALEGTEVAGCV
FT                   SCML"
FT   gene            complement(408939..409364)
FT                   /gene="nrdI"
FT                   /locus_tag="Balac_0328"
FT   CDS_pept        complement(408939..409364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="Balac_0328"
FT                   /product="ribonucleotide reductase stimulatory protein"
FT                   /note="COG1780 Protein involved in ribonucleotide
FT                   reduction"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45715"
FT                   /protein_id="ACS45715.1"
FT                   /translation="MSAVVYFSSASRNTERFVEHCDFPSCGVNVFRIPLQPNAAPLNVR
FT                   EPYIIIVPTYGGGDARKAVPPQVKRFLNDPANREWIRGVIASGNTNFGEAYAAAGPIIS
FT                   RKCHVPLMYRFELMGTREDVHAVREGVRRFFSDTPTD"
FT   gene            complement(409361..409624)
FT                   /locus_tag="Balac_0329"
FT   CDS_pept        complement(409361..409624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0329"
FT                   /product="glutaredoxin-like protein NrdH"
FT                   /note="COG0695 Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45716"
FT                   /protein_id="ACS45716.1"
FT                   /translation="MHITIYSKPNCPQCAATKRAFDRLGAPYTVVDITTDPVALATLQE
FT                   AGFRQAPVVFVDSDFWTGYRPDRIRDVARRLQTVSSASGVLA"
FT   gene            409933..410796
FT                   /locus_tag="Balac_0330"
FT   CDS_pept        409933..410796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0330"
FT                   /product="aldo/keto reductase family oxidoreductase"
FT                   /note="COG0667 Predicted oxidoreductases (related
FT                   toaryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45717"
FT                   /protein_id="ACS45717.1"
FT                   /translation="MVLHRNLGPFDTTAIGLGEMPLTIENNLGPKMGVETIHAALDAGC
FT                   RQIDTAWAYYCSGGEEQTGEKLVREALASWDGPRDEVLVATKVGHFRNFTDGKPTWDVD
FT                   GSPENLIKRAKQSAFELGVDMIDLLYFHRPDPKIPYGESCEAMKEIRSMGIAREIGISN
FT                   ASIEQIDIAREILGDSLIAVQNQFSPIYTETADTLDYCGKVGLSFVCWSPLGGFRKPKD
FT                   ESKFDPFREVAEAHGVSYQQVVLAWELAKGSHVFVIPGAHRPATILDSLKAGDLELTPE
FT                   ELAKLG"
FT   gene            411107..412642
FT                   /locus_tag="Balac_0331"
FT   CDS_pept        411107..412642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0331"
FT                   /product="protease or peptidase"
FT                   /note="COG0826 Collagenase and related proteases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45718"
FT                   /protein_id="ACS45718.1"
FT                   /translation="MKRRGKPEVLAPAGNLRGLKTAVDYGADAVYCGGKSFGMRSAPRN
FT                   LSLDDFREGAAYAHERGARVYVTLNILPRNNEITAIERYIEDLRTTGVDALIVTDIGVM
FT                   MLAHRIAPELELHVSTQAGVTNYLAANALHDLGARRVVLAREMDLQAVRDIRANIPDDL
FT                   DIETFVHGSMCMAFSGRCLISNYLTGRDGNHGECAQPCRWKYSLVEEKRPGQVFPVEET
FT                   AQGTYLFNSQDMNMMAHLDDLIDSGATSLKIEGRSKSAYYVAAMTNAYKTAVNEYMVQR
FT                   GFEDEAGNELKPFHDRVVRAGEEGFADSARDTIMLNADAAFAGMPNWDSANDEGEAGGI
FT                   SNRQARRTGLKRQGQLVEESDDGWRHAPVRPAPHVELPQWLMEEPYKVAHRDYSTGFYY
FT                   PEQKVTQNTDRSAYFRDWLVVGEVLSWSPEEGGRVTIMSRNKMEPGQLVEFLLPGRAPL
FT                   EYVVPDGGIRDADGNEVPMVNNPAHVFSLPLGVEVPVNAALRSRTKKPTLKAE"
FT   gene            412971..414176
FT                   /locus_tag="Balac_0332"
FT   CDS_pept        412971..414176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0332"
FT                   /product="hypothetical protein"
FT                   /note="COG1496 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45719"
FT                   /protein_id="ACS45719.1"
FT                   /translation="MSEQEQHTDEQNANAAPKPMQINLDDLLKAVQAHGQKTVEQEDKA
FT                   AREGGKDADGKTYDDAILDSSAIEPTDDEGNPIPVTIPVVLSPGITVIYTTRLGGVSAE
FT                   EWAHFNLGGKSGDDPVAVERNREALADELHVKLSLIDQVHSGKSVDIDEVYTENKPFGF
FT                   DASGSHTEAQAKAKRAGEPVVDDVESENAEVQVIEGDAQVTCRKDIAIGVFAADCLPVL
FT                   FADPQAGVVAAAHCGRKGLQRNVIAATVDMMVKKGASKENIVATLGPAICGDCYEVGDQ
FT                   IADEFDAQFPGTFTLTRFGGPGIDLNKAALMELHQAGIKDDRIFSSQPRVNAATQYLSQ
FT                   DAELEELCREDNEGDPALEERIKGIRYSMCTLENPLWFSHRRAELAHKRHEGRMLALIV
FT                   RS"
FT   gene            414203..415030
FT                   /locus_tag="Balac_0333"
FT   CDS_pept        414203..415030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0333"
FT                   /product="2-C-methyl-D-erythritol
FT                   4-phosphatecytidylyltransferase"
FT                   /note="COG1211
FT                   4-diphosphocytidyl-2-methyl-D-erithritolsynthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45720"
FT                   /protein_id="ACS45720.1"
FT                   /translation="MTQQTKVPVVAVVLAAGSGVRFDPAKPKQLVALNGKPIVAWSIEA
FT                   FENDEHVDDIVVVVNNTVREAVEQLIDDASYAKVRAIITGGAERSDSTEAALTTLADAG
FT                   IPQDAKILIHDAVRPFVSRQEIDGCIDALDEFTAATVACPSTDTILLTQDLGDREVIQS
FT                   VPERRHSFRAQTPQAFRFGTIRDAYAKAAGDPDFRPTDDTRVVVDYLPDQPVAIVGGSP
FT                   RNMKVTTQDDMPLARALANALAGAPRGPQNERQRAAKEQLHAMFGKAFGVEGE"
FT   gene            414990..415709
FT                   /locus_tag="Balac_0334"
FT   CDS_pept        414990..415709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0334"
FT                   /product="Pyrrolidone-carboxylate peptidase"
FT                   /note="COG2039 Pyrrolidone-carboxylate peptidase
FT                   (N-terminal pyroglutamyl peptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45721"
FT                   /protein_id="ACS45721.1"
FT                   /translation="MPCSARHSASKASDMQELSVVMSGFDPYEDVTANPALIVPDTLAE
FT                   QGMGGAMDSDDDLKDVAITVHAVHMPVSFSKAWPILEAALEEHRPQIVVATGLKRASRG
FT                   ILLERCAINVKDTNRPDADNKVPSHHVINAAGPAAYWTGLPLNAILGAFAADEIPASLS
FT                   SNAGTFVCNALFYKLQDWASRQGRTLSGFVNLPPVDEREHSQHGLTLDQQIRAGRDVIR
FT                   ETARYYVKPIGVNTLIA"
FT   gene            415868..417586
FT                   /locus_tag="Balac_0335"
FT   CDS_pept        415868..417586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0335"
FT                   /product="hypothetical protein"
FT                   /note="COG3599 Cell division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45722"
FT                   /protein_id="ACS45722.1"
FT                   /translation="MVDRFPVVLRGYDKERVDEAMLAAQNSIDRLREQVKAGDDTVLQL
FT                   QAQLQEEKNRKANTDNSFASLGANAQQMLASAEQTSTELLERAKKDAASARTEAQSQSQ
FT                   TLVNNAKLDAQHLVDDAQAKADTILKNAQSEANTIVTNARQEAEQLRASTAKTVSDQRQ
FT                   ALDLELTNSREEHKKRLASERAQQERELADLSAQTAKTISEQRKSANEEMARLKSETND
FT                   QIETALADANKKLADVREQVSKLMTEAQRKAGEITDAAKAHAQEITDAAEVNRTQTMSQ
FT                   VNAEVEQIRADIAAQQDEATKKVQELLQSLEESRKSAKEEAEKEIGQAKQAREEADAYA
FT                   AEKRESADTEAREIVRKAGEEASKQIEDRRKAAQSELDGLRKRIGELQTREADITQRVS
FT                   ELRSMFANAFAGFGFGIDKHSTDTMSVVNTVAGDNDSSDTPQAPADNGSVRSDLANTML
FT                   INPSDSAQHEASHPMSHVTVPVAPALHDHAAQANAADDDNAGTNDEAQVPAVDIPADPN
FT                   TPSPEAPEAPAASAAEVMEAIDGDEPISDDTHVTGDADSLFDSSDNMPVAPNNEQ"
FT   gene            417767..419107
FT                   /locus_tag="Balac_0336"
FT   CDS_pept        417767..419107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0336"
FT                   /product="aminopeptidase C"
FT                   /note="COG3579 Aminopeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45723"
FT                   /protein_id="ACS45723.1"
FT                   /translation="MSDKISPLSSHDLDDLTSEFEGSKSNVMAMNAVTAAGINKVARNY
FT                   DRARLLQRRFSTSLDNGEATHQDRSGRCWLFSSLNVARYVAKKTMNIKEFEFSQNYAMY
FT                   FDKLERVNYFLQDIANLIREGEPTDSRLFQHMLHDVMGDGGQWTMAMNVYKKYGAVPKD
FT                   LYPETESSKNTGELDTQLRRMLHTAVSQMEKSPEHIDEIILQATKAGHRILTIHLGEPP
FT                   KSFDWEWTDKDGEFHRVGEITPVEFWNRYVGDADLESYVCLVDDPRHEHAKGKKIGIEH
FT                   LNNVAGGDPTEYLNVPIQFMKDCARDVLVEQGIPVWFGADCHPMMDREDGAWATDLFEY
FT                   GKVYDYDFTMDKEERVRFADSAMNHAMAFVGVDVADDNKTTRRWRVENSWGTKIADKGY
FT                   FTMGDDWFDQYVFEVAVPKALLPDEYLKALDEPAQMLPAWDPMGALA"
FT   gene            419579..420709
FT                   /locus_tag="Balac_0337"
FT   CDS_pept        419579..420709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0337"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="COG0722 3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45724"
FT                   /protein_id="ACS45724.1"
FT                   /translation="MAAMRGPDSSQDSVLDANAVVPETVDVNIRQLDPIPAPRYFIKEL
FT                   PLTEQMGKQVLEQRAQIRDILHGRDDRMLAIVGPCSIHDPKAAHEYATRLAELADELKR
FT                   DLLIVMRVYFQKPRTTIGWKGLINDPDIDGEFDIRKGMWLARKVLCDVVGMGLPAATEW
FT                   LDPITPQYLCDLVSWGAIGARNTESQVHRELASGLSMPIGFKNATDGSVKPAADSCYTA
FT                   AFEHHFLSINLDGHVIAAETKGNPDCHLVLRGSNHGPNYDAESVAAALRDLHESKAEGP
FT                   SKHGLIIDAAHGNCGKNEVVEAAVVENIAERIAGGERGILGIMMESFLKGGHQAPAPLA
FT                   QLEYGQSITDSCVPWARSEEVLRKLAQAVNARRAAR"
FT   gene            420924..422927
FT                   /locus_tag="Balac_0338"
FT   CDS_pept        420924..422927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0338"
FT                   /product="hypothetical protein"
FT                   /note="COG1835 Predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45725"
FT                   /protein_id="ACS45725.1"
FT                   /translation="MAAGTKVSRDVPRGVAQARHFNGVDGLRAIAIVAIIAYHARPMLL
FT                   KGGFLGVTLFLVVSGFFITRSLMNAVDGHRFLLFDYLRRRVKRLWPAVISTIGLTAVLV
FT                   YACAPPLILKMRGDAVPSALFYSNWSFIFRKLSYFDAAGLPSPLTHLWYTSLIMQFYLL
FT                   WPLLFIPLFLHCRRHWVRVGVLGALIAAGTLEMMMLYRPEADTSRLYYGLDTRAAEILV
FT                   GVLLAMLVHDSASRSDQERRAADGRIVFDRQIGRYHAVLRRGDLGVVAAGICALALALG
FT                   FLLVDARAAWMYHGGFLFFAVVSAVLLYASMQDARVGRILGVKALRYLGSRSFSLYLVH
FT                   YPLLEVMNPATRTTGIPWYEWIGQFLVILMAGEAFYQIVEALTGTPWLPWMRCRITSVG
FT                   AGRLRTSAWILTIVGVVMTFVMALPLDWRAIAHARSVKARPELALTAEQARERLAQQQK
FT                   RESETSKENGKEHKDSSGKPNAQAKPKVAPPVVKALKVPANLEPQRWACDRKAMVCQAK
FT                   VLMIGDSVTEGVSDTLREHFPNATIDGAVSRQFDQGVQILRDDLARGMDPQVIVFALGT
FT                   NGPVSEQMAQQVIDLAGGRPLYFATTRAPVDWVPGNNATFIGMAERNPNVGIIDWSGTS
FT                   QGRDDYLYDDGIHPNQLGMQAYLQMFLNAFCA"
FT   gene            423000..424247
FT                   /locus_tag="Balac_0339"
FT   CDS_pept        423000..424247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0339"
FT                   /product="3-deoxy-D-arabino-heptulosonate 7-phosphate(DAHP)
FT                   synthase"
FT                   /note="COG0722 3-deoxy-D-arabino-heptulosonate
FT                   7-phosphate(DAHP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45726"
FT                   /protein_id="ACS45726.1"
FT                   /translation="MSENPYEPMSKEQKDAIVQGNGLTYTHEQMRQVQHAIAAGKNPLV
FT                   VLENVPRWEDMAGVDRIINRRVLELDPLPTPAQVLAELPLTRQMQDIVAYSRDEVRACL
FT                   YGQDDRLLVIVGPCSVHDPKAALDYAHRLRTLKDELGEDLLIVMRVYFEKPRTTVGWKG
FT                   LINDPDIDGSHNIQKGLLLARRTLLDVLGAGVATATEFLEPTSPQYIADAVSWGAIGAR
FT                   NTESQVHRQLASGMSMPIGFKNATDGSVKAAVNSCIAAEDQHTFFGIDHRGRACAVETL
FT                   GNPDCHVVLRGSSSGPNYDAESVAQALASIRDKMGDEAAASHGLVIDCSHGNSGKDDVR
FT                   QAQVVREIAERIAGGERGISGVMMESFIVGGNQAPAPLAELTYGQSITDKCLSWPVTDE
FT                   LLHTLADAVRTRRWNR"
FT   gene            424326..425018
FT                   /locus_tag="Balac_0340"
FT   CDS_pept        424326..425018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0340"
FT                   /product="5'-methylthioadenosine nucleosidase"
FT                   /note="COG0775 Nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45727"
FT                   /protein_id="ACS45727.1"
FT                   /translation="MQTVAIISALDEEAAHIADSLDNMTVTERASLSVARGTLTTDAGE
FT                   ELDVAVTVGGMGLVNAAATTQFLIDLVHPEAVIFSGIAGNLNKSLHINDIVLGKTLRYL
FT                   DTDMRLVGQWKPGTSEFHSDPALLQIAEGALDEMGINHIQGTIASGNYFVDTPQKVSQV
FT                   IEQTHADAVEMEGAAVAHVAARNDVPALVIRAMSDSADTDYEEFKDFDISEYADTAARL
FT                   VVRILRGM"
FT   gene            425050..426273
FT                   /locus_tag="Balac_0341"
FT   CDS_pept        425050..426273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0341"
FT                   /product="Signal transduction histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45728"
FT                   /protein_id="ACS45728.1"
FT                   /translation="MTPGEIAMAIAMGVLLIAGGYAIAYRAGRNREREREPSEAALFAG
FT                   HADADAVDGERRMLAMLEEAVIVTDSSANVLVANEAAIERGLSVDGLIVDAGIRDLVQE
FT                   AAQSDAAVERELELARDSQRLHVAVTAQCTADDRVTVVCADTGYRRSVDRVRRDFVTNV
FT                   SHELKTPVGAIMLLAETIDDAGDDVDMIRHFAARIGVEAKRLDGLVRRLIELGRMHGDR
FT                   ATTRRTVDARELVRQAIIDTEVTAGARHTMVRMRDDAGENHPLPVTVDAAAVHIALKNL
FT                   VENAINYSPEHAEVTVEVSRGEDQARIRVVDHGIGIPRQLQGRIFERFYRVDPARSRLT
FT                   GGTGLGLSIASHHILANQGKLEVWSKPGEGSTFTVMLPLAMRDDDTPCNRDADAEGDPD
FT                   GTGKEADR"
FT   gene            426270..426977
FT                   /locus_tag="Balac_0342"
FT   CDS_pept        426270..426977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0342"
FT                   /product="response regulator of two-component system"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45729"
FT                   /protein_id="ACS45729.1"
FT                   /translation="MTRILVVEDEPSYLDPLLYQLTREGYEAHGAATGEEAWELYEEME
FT                   FDLVLLDLMLPGISGTTLCRRMHELRRVPIIMVTAKSTENDVIVGLEIGADDYVTKPYS
FT                   FRELLARIHAVLRRSLEPRASGTPGGNDETLTCGPIEMSVASHEVRIHGELTQFPLKEF
FT                   EVLEYLMRNKGRVLTRQQLIGRVWGSDYVGDTKTLDVHVKRIRAKIEADPSNPALLTTV
FT                   RGLGYRICDERSR"
FT   gene            427064..428179
FT                   /locus_tag="Balac_0343"
FT   CDS_pept        427064..428179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0343"
FT                   /product="ABC-type phosphate transport system periplasmic
FT                   component"
FT                   /note="COG0226 ABC-type phosphate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45730"
FT                   /protein_id="ACS45730.1"
FT                   /translation="MRSNLARRVLAALCGMAFIATTTACGDNTDPANRPVANASSISGS
FT                   FAGAGASSQQTAVEAWVAGYQKTNPDARISYNPSGSGAGVATFLTGATVWAASDKPLDA
FT                   KQVEESTSVCAGASAFDVPVYISPLAIVFNLQGVSDAGKHINMDAATIAKVFDGRITRW
FT                   NDAELTAQNPGLSLPDLPITVVHRSDKSGTTLNFLEYIKAAAPADWPYELSENWPNDVG
FT                   QGAKGTSGVISTIDQANGTIGYADFSQAGGMGTVAVQVGDTPTVISAEAASKAVADSTL
FT                   DKSVPGKHRVVLDINHTTRVTGAYPIVLVSYDIACPAYTDANTARFAKSWLSYVTSEEG
FT                   QAQAMNATGSAPLPANIAKYVRESIDAMEVK"
FT   gene            428184..429164
FT                   /locus_tag="Balac_0344"
FT   CDS_pept        428184..429164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0344"
FT                   /product="phosphate ABC transporter permease"
FT                   /note="COG0573 ABC-type phosphate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45731"
FT                   /protein_id="ACS45731.1"
FT                   /translation="MSSAPKPPAQPAADSSLTKPVSGEKADRIFRGIAYACGILILVVL
FT                   AAVALFLLFRAWPLIGGDQRTNSDVISSFTGGKATSFWGYVGPLLFGTVLVAALALIIA
FT                   FFVSIGIALFISHYAPKRLAAMLSYIVDILAAIPSVIYGLWGGLVLVPAIYPFWNWIAE
FT                   HLGWIPIFAGPASNPPRTVATVALVLAIMILPIITSITRDIFLQTPKLLEEAALGLGAT
FT                   KWEMIKMSVLPFARSGIISASMLGLGRALGETMAVLMILSPGLKYSFKLLQASQNQTIA
FT                   ANIAAQYPEADSIGVSVLIGTGLVLFVITFLVNLLARRITEKASK"
FT   gene            429161..430153
FT                   /locus_tag="Balac_0345"
FT   CDS_pept        429161..430153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0345"
FT                   /product="phosphate ABC transporter phosphate-binding
FT                   protein"
FT                   /note="COG0581 ABC-type phosphate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45732"
FT                   /protein_id="ACS45732.1"
FT                   /translation="MMSEPQSTPHADAAPVIDFDKFKPTRSYTAARKRKDMVMRALIIL
FT                   AFVVALIPLISVLWTTLAHGIRRLNWDFLSHNMTNVIGGNQTPSGGYGGILHAIIGTLE
FT                   ITLGAMVISIPIGVMCAVYLIEYAGKSKLARTIHLLVDVMSGIPSIVAGLFAYSMFAIL
FT                   VGPGTLNGFEGSVALSLLMIPTVVKTTEEMLKIVPNDLREASLALGVTKQRTITKVVLR
FT                   TALSGIVSGSILAIARVIGETAPLLMTAGYIVSTNANLFLGEMTTLPVYVYQEYSKYHA
FT                   NCPADAGSGCVTAIPMERAWSAALVLIVIVLILNLIGRIVAKVFAPKKK"
FT   gene            430190..430969
FT                   /locus_tag="Balac_0346"
FT   CDS_pept        430190..430969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0346"
FT                   /product="phosphate import ATP-binding protein pstB"
FT                   /note="COG1117 ABC-type phosphate transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45733"
FT                   /protein_id="ACS45733.1"
FT                   /translation="MGQQIDIRHLNIYYGSFLAVEDVNLHIAANKVTAFIGPSGCGKST
FT                   VLRTLDRMHEITPGAHVKGDVLLEGKNLYAKDVDPVAVRRDVGMVFQRPNPFPTMSIRE
FT                   NVLAGVSLNNRKISKSDADDLVEWALRGANLWNEVKDRLDNPGIGLSGGQQQRLCIARA
FT                   VAVHPQVLLMDEPCSALDPISTLAVEDLIEELKQDYTIVIVTHNMQQAARIADYTAFFN
FT                   LKAVGQPGHLEYFADTSTMFNNPQNEEAERYVSGRFG"
FT   gene            431261..432601
FT                   /locus_tag="Balac_0347"
FT   CDS_pept        431261..432601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0347"
FT                   /product="hypothetical protein"
FT                   /note="COG2252 Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45734"
FT                   /protein_id="ACS45734.1"
FT                   /translation="MAGLTTFFAMSYIIVVNPQILSQTGMPWGGVFLATIIAAIIGTLV
FT                   MGLFANVPYAQAPGMGLNAFFTYTVCFGLGFTWQETLAMVFLCGLINILITVTKVRKMI
FT                   IKAIPEPLQQAIGGGIGLFVAYVGLLNVNFITFTPKDTKAAGQGLATGATPGMATLNSP
FT                   VLWLFLIGLLLAIVFTILKVKGGLLLTIIITAVIGIPMGLTTMSNSVSLGETFSQLPQT
FT                   FGALFTGEGFGSLFSDPAKLPLVLVTIFAFSMSDTFDTLGTFIGTGRRTGIFSKADEES
FT                   LENGHGFSSKMDKALFADSIATSIGAICGTSNTTTYVESSAGIAAGGRTGLTSVIVAAC
FT                   FAVSAFFAPVISAVPSAATAGVLVIVGCLMAASLKEVKWDDITEAIPAFFAAVFMAFSY
FT                   SISYGIAGGFITYCIVKVCKKKANEVHPIVWIVSALFILDFICMAVL"
FT   gene            complement(432936..433859)
FT                   /locus_tag="Balac_0348"
FT   CDS_pept        complement(432936..433859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0348"
FT                   /product="ABC-type metal ion transport system periplasmic
FT                   component"
FT                   /note="COG0803 ABC-type metal ion transport system,
FT                   periplasmic component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45735"
FT                   /protein_id="ACS45735.1"
FT                   /translation="MENEYMKRLLRTLTILLAALATIFAVAGCSNSKAGDTQIDKEKVI
FT                   TVIASTNVWGSVAKQLGGRYVDVTSILNNTGTDAHDYEPSTNDISKFQHAQVAILNGAG
FT                   YDEWAAKAAGQSKAIVIDAAAAGGKKTGDNPHVWFSAAVRNKTADEITAAYIKLMPSEK
FT                   AEFEKLNKDWHTEEDDLEAQLQTVAQADGKMPYGAIESVGDYLAQDMGMTDVTPKGYKN
FT                   ATSNESEPTASDIKSFTEALKKGDMKMLIANSQEKSQLSDQLTDAADSGNIPVVDITEQ
FT                   MPSQYKTLNEWLKAIAEQIQATQKKK"
FT   gene            434212..434733
FT                   /gene="rplJ"
FT                   /locus_tag="Balac_0349"
FT   CDS_pept        434212..434733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="Balac_0349"
FT                   /product="50S ribosomal protein L10"
FT                   /note="COG0244 Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45736"
FT                   /protein_id="ACS45736.1"
FT                   /translation="MKRPEKEAVVAELTEQFRNASAVYLTEYRGLTVPQISDLREKLGR
FT                   DTSYTVAKNTLFRIAAKEAGIEGLDEMLKGPSAVVFVDGDFIEAAKVLRDFAKTNKALI
FT                   VKGGFADGTVYDAEGAKQLADLKSRPELLAELAGALKGTMSKAAYLFNALPTKVVRTID
FT                   ALRDKQEKAA"
FT   gene            434844..435224
FT                   /locus_tag="Balac_0350"
FT   CDS_pept        434844..435224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0350"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG0222 Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45737"
FT                   /protein_id="ACS45737.1"
FT                   /translation="MAKFTQDELLEAFGEMTLVELSDFVKAFEEKFDVEAAAPVAAVAA
FT                   AAPGAAPAEEEKDEFTVVLSAVGDKKIQVIKAVRAITNLGLAEAKALVDGAPKPVLENA
FT                   KKEDAEKAKAQLEEAGATVELK"
FT   gene            435507..437081
FT                   /locus_tag="Balac_0351"
FT   CDS_pept        435507..437081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0351"
FT                   /product="Tfp pilus assembly protein"
FT                   /note="COG1716 FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45738"
FT                   /protein_id="ACS45738.1"
FT                   /translation="MASVEPGTTVEIGRKPLRPLPDDGKRRVEILDDSRSVSKRHAQLM
FT                   VALDGRAFLRDLNSTNGTFVVRAGDELVRLQSGVDYPLQSDSVHVQFGDVPVDFTKFIE
FT                   DDDSTKDDAPVVNLFDYAVEGSSNEPEAADMSVDDILNLRAGEPTDIFNASMVRARAKR
FT                   MHDAEQQSFVPFTQPINPLPMQDLDDSDAGDAAPRDLFADAKDVAEGKISEPAAAQEHP
FT                   YIPKMSDKPKHAGAPADRLISVSELASAHPRSMPQPQENMPEPAAEVDAASESIVVEQT
FT                   SVTEETTQEEPAEPVAAEPAAQGIGEHGESVQPSANAPAVEEPDGNAEESAAASEQAPV
FT                   SDEESRQNEEPSGSAGTTSDEAASETEVNGDIASLAAQDVSQDEQELRGDNAPEVATVT
FT                   VDAADVDYSRFQRHDEPQTDESAEGEYEPAFEPGSVFEKVANGDFAKSEPLVSVAGFTS
FT                   DDARRSDDFSEQFEMARHPELLPFLAMNPSLYDDLYTWLAAQGNADIDEALSKNAGYED
FT                   YRKAMGK"
FT   gene            437078..440725
FT                   /locus_tag="Balac_0352"
FT   CDS_pept        437078..440725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0352"
FT                   /product="hypothetical protein"
FT                   /note="COG1112 Superfamily I DNA and RNA helicases and
FT                   helicase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45739"
FT                   /protein_id="ACS45739.1"
FT                   /translation="MSSMSNTDTPETKAPTSGSIDKLRRWRDEYRASLMASPLEDVNQL
FT                   SAKLDLTHAHPSGISQLFASGSAPLHSLFRDSGMLRAAARRTERVLDDQSAKKRISGVA
FT                   ELSLVVGVATWKGNKMPVLLYPVEVVRDGTPVENHTTITFTGHVRLNSAFLNAMRENGV
FT                   NLDERALFDGSNYASGTPETAAVFAVITKAAQQVFADFSIERQIILGCFVDPSTQILME
FT                   SRMIIERLARGPINNVMLNALAGYPEAIEQLSRITLPPYSPFDGDPHSEYEVGDVDNTV
FT                   RYAANVAAAGHSLFVDGTLGNDTAEQAASIASRCIMAGRSVLYVPCVTSQKRTFAMLMK
FT                   ANELGEQLLDVANPNANAAIDHQLISAVGYQQGVATSRFEQLADELVGVRSRLTRYLGD
FT                   LHGVNQTWGVSAYQTIQNLASISELPAHPMTRVRLTKECALAIGKSLDEWAKKLERAGE
FT                   LGEYSVGPDDTAWYGASLYSEEEAIDAYQRVVNVLRSLLPATREQVTTTVKVCGFSIPQ
FT                   TADEWSKQVTVLKNLRRVLDVFQPEIFERDIDAMIEATESKQERKTSDSQMGFWDRRRH
FT                   IKEAKSMLRVGAQVEDLHEALLVVKRQGEQWRLFVPHGGWPVLPPKLDDIIATQEQLMS
FT                   NLTALDTVLATTPAGAELQQQDFNALEERLKALFDDRKALDTLPERCVIERELKRAGLG
FT                   ELVDDLRERKVKVDAVSNELRLAWWTTVFDDIVHSSAIISNQDGSALQAASDRFVQVDV
FT                   EHVRSIGPMIMQESMRRLCDLLFSRTQEANMMHTALAGASSISLSRIHQDHPEILAAAK
FT                   PVIMATPATLAAVTNPTPIADVVIIDAAAHLPSVLLLSILCRARQVVILAHRSTVTSEG
FT                   IGMLMSMLPNISVASHPTRRDPRVNRFLEEQGYGKVNTDVVREPMQGHIRFHKIEAAGV
FT                   PLMASGLVESSQQEIAEVVRLITQRAQTFTLVPPSYLLTVVCLTSTFRTRLGAELRSLA
FT                   AKSEAMGRFLRHVRIVDIADVAGARATDVILSMSYAKTTHGRLLQQFGVLENNGGRGML
FT                   LDALALCDHHLDIVSAFGASDLDDDRLHQDGPKMLKVLLQWAEDLDEANVVRPAIKQTD
FT                   ENVLFNDLATRIRERGLNVAVDYGYDGGMKLPMVVGLKDKPFALAVFTDDAQFMGMQST
FT                   RERHRILPQEIESLGWSVMTIWSVGAFVNPEKEVDRVVARLGEIYQDKQ"
FT   gene            440760..441002
FT                   /locus_tag="Balac_0353"
FT   CDS_pept        440760..441002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45740"
FT                   /protein_id="ACS45740.1"
FT                   /translation="MTNKNEEPTSSHDAARPYSATRRTPRVHRRVVHQGTERFDADGVK
FT                   PEPSEMQTAQQRQADDDKRILGELPPHWAVFEERQ"
FT   gene            complement(441021..441578)
FT                   /locus_tag="Balac_0354"
FT   CDS_pept        complement(441021..441578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45741"
FT                   /protein_id="ACS45741.1"
FT                   /translation="MLLALSVGVALFCTLQCVALATATRQAVVAARDLDAGLVIATGDV
FT                   EMVEMPDHDALRHALGCPDDAVGLVTQTRIEKGDILLTTDVGELPQVPEHHTVIDVRLG
FT                   LGQHSFPIGTVVELRSTQACADDARASPEGCVVSSHAVVMAQPRLDDTGSTVTQMAMSA
FT                   VEALQVLAAQEHGTLIAARGAS"
FT   gene            complement(441817..442008)
FT                   /locus_tag="Balac_0355"
FT   CDS_pept        complement(441817..442008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0355"
FT                   /product="hypothetical protein"
FT                   /note="COG2331 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45742"
FT                   /protein_id="ACS45742.1"
FT                   /translation="MPIYHYRCKKCGYDFTKEQSFSDDPIKVCPQCGAEQVHKVYAAVP
FT                   ITFKGSGFYRTDSHSSSK"
FT   gene            complement(442140..442877)
FT                   /locus_tag="Balac_0356"
FT   CDS_pept        complement(442140..442877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0356"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="COG0212 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45743"
FT                   /protein_id="ACS45743.1"
FT                   /translation="MPHGGAQFTNVAEAKRMLRHEVFVRRRGTSLSMSMQAGEQCAQIA
FT                   CEAGLFQSPSRIIACHVSMGTEISTIPLLSIALGCGYTVLVPKMGVDLDLGWGVLRSLD
FT                   DLLRLHVPDEVAVDQMEPSLFPHAQTRRPGEPEGQTYPPEALQMCSTVIVPALLVNPAG
FT                   VRLGRGAAWYDRALRFAGPQADLMAMCWPWEFVDAPLPCEEHDVRMNAVLTPRGFTRLG
FT                   STGPTRAHTDDPSCDSPAGEPDE"
FT   gene            443034..443717
FT                   /locus_tag="Balac_0357"
FT   CDS_pept        443034..443717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0357"
FT                   /product="acetytransferase"
FT                   /note="COG1670 Acetyltransferases, including N-acetylasesof
FT                   ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45744"
FT                   /protein_id="ACS45744.1"
FT                   /translation="MSVFQALHDVMKRRRNSAFTAPLTLKSPAGSPDLTLRTMDAADQE
FT                   EWGRLRSVNERWLAPWESSDPHGTEPLTFKSWVNRQREEEREGTSIIFLMEHEGEIVGQ
FT                   ISLGAIYPGPMRTGIIGYWIDEDHAGRGLTPLAVAMLADWALLDPTGPQLHRLEIDIVP
FT                   ENERSRRVVQKVGAKYEGVRRQYMYVHGEWRDHESYSLLDTDVPQGFVHRLLGDTPGES
FT                   LHNLS"
FT   gene            443739..444962
FT                   /locus_tag="Balac_0358"
FT   CDS_pept        443739..444962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45745"
FT                   /protein_id="ACS45745.1"
FT                   /translation="MDYESLSTIVLVVIVAILMVSWLPRRTVQGMKQVIKHQSDRYSAS
FT                   LHLIDEGDGTRFSDARTVELKGTPMASPHTVRDREYVAQVRDLRRAAARRRKILVGALL
FT                   GISVLVFVLAVILVFSPYFTLIPIALMCVVLALGAHASRQAREWEDRHAQRQRELKERK
FT                   VRENKRVVEERTRAAHPEPSARRQMQDGSQTDVMEAREIHQALQRAREEQARAIARRKA
FT                   QDTRDHHADEASLRSGMRAEHADVDAAVQAAEEATHNPGHLTIREERAAQMSDETNELA
FT                   QINASSAPDAFDMAVNQDLISFSLGSDPFDGPEVVQSMEIKSTRQVSKAVPKDSSSAKP
FT                   ADAGAAESRDAAADNADVKEAQTVSAVSVNDSVAFHNSEAQANVEAPDASSDSLGVDLQ
FT                   SILARRGN"
FT   gene            445184..445480
FT                   /gene="groES"
FT                   /locus_tag="Balac_0359"
FT   CDS_pept        445184..445480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="Balac_0359"
FT                   /product="co-chaperonin GroES"
FT                   /note="COG0234 Co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45746"
FT                   /protein_id="ACS45746.1"
FT                   /translation="MSFPLTPLEDKIIVKQAEAETQTASGLIIPDNAKEKPQQGEVLAV
FT                   GPGRRDDEGKRVPMDVKVGDKVLYSKYGGTEVHFKGEEYLIVSARDLLAVVND"
FT   gene            445870..445951
FT                   /locus_tag="Balac_0360"
FT   tRNA            445870..445951
FT                   /locus_tag="Balac_0360"
FT                   /product="tRNA-Tyr"
FT   gene            445953..446027
FT                   /locus_tag="Balac_0361"
FT   tRNA            445953..446027
FT                   /locus_tag="Balac_0361"
FT                   /product="tRNA-Thr"
FT   gene            446029..446105
FT                   /locus_tag="Balac_0362"
FT   tRNA            446029..446105
FT                   /locus_tag="Balac_0362"
FT                   /product="tRNA-Met"
FT   gene            446149..446319
FT                   /gene="rpmG"
FT                   /locus_tag="Balac_0363"
FT   CDS_pept        446149..446319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="Balac_0363"
FT                   /product="50S ribosomal protein L33"
FT                   /note="COG0267 Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45747"
FT                   /protein_id="ACS45747.1"
FT                   /translation="MASKSADIRPGITLACTVCKERNYITTKNRRNTPDRLELKKFCPK
FT                   CGKQTLHRETR"
FT   gene            446413..447633
FT                   /locus_tag="Balac_0364"
FT   CDS_pept        446413..447633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0364"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /note="COG0812 UDP-N-acetylmuramate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45748"
FT                   /protein_id="ACS45748.1"
FT                   /translation="MDVGGYIERFVEPTTRVALIEEVEDADSKGIPLCVIGGGSNMLAS
FT                   DDEFHGVVIRDARRNIIVPDEAAPVEGGDYTVHVNAEAGVNWDDLVQFCVERGLEGLEG
FT                   LSGIPGTVGASVVQNIGAYGQEVASAVESVEVWDREEKKTLDMSNVDMQFGYRFSLLKR
FT                   SMYKAPGVPNAQYYPTPRYIVLSVTFALVHTGTGTVNYPQLASALNVNLHDRMPIDRIR
FT                   AAVLEVRASKGMLEDATRYREPIMMGTKRADQVEAAIAAQHAFREQHDGAARDMIIDIA
FT                   SDTGTNSDPNRRSCGSFFMNPIISEADAARLPEDAPRFPATLPDGSTGVKTSAAWLIDH
FT                   AGFHKGYKLSDDARAGLSTLHTLSITNRGGATCNDIVKLADAIRDGVRKQFGVTLIPEP
FT                   VLVNVTL"
FT   gene            448005..449507
FT                   /locus_tag="Balac_0365"
FT   CDS_pept        448005..449507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0365"
FT                   /product="Amino acid transporter"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45749"
FT                   /protein_id="ACS45749.1"
FT                   /translation="MGVAVAVGAGIFSVGAQAAAFHAGPAVIISFIIAGIVCGAAVMCY
FT                   AEFASVMPVAGSAYTFTYATLGEIFAWIIGWDLILEMLMAGSVISKFWGVYLNDFLRLM
FT                   GVNFNTNIMIGSFHLDIAPIVIVAFFTTLLVLGTKIGARVDGAMTVLKIAVVLFVVIVG
FT                   FFYVKASNYTPFIPPAEPSADVANATTVHGTLGQPLFQWLTHMSPTIYGVPGIISGAAL
FT                   VFFAFIGFDVVATASEETRNPKRNVPLGIGVGMSLIIVMYVLVAIVTTGMVSYKQLASV
FT                   ESPSLATAFELVGADWAAKIISFGICLGLATVVMVLLLGLTRVVFAMSRDGLLPRTLST
FT                   TGKHGTPARLQIVVGVVVAIIAACFNIDVLSDMVNIGTLSAFTLVALAIPIMRKRRPDL
FT                   KRSFRMPGNPWVPLLVALANFYLMLNLTVLTWIRFLIWLVVGFIIYFAYGYNHARVGTG
FT                   ELDAEVVKYEKQRQLKAQRAKQSGSVGRGNDAAVTKVEAGKD"
FT   gene            449673..449996
FT                   /locus_tag="Balac_0366"
FT   CDS_pept        449673..449996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0366"
FT                   /product="ferredoxin"
FT                   /note="COG1146 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45750"
FT                   /protein_id="ACS45750.1"
FT                   /translation="MAYVIAQPCVDVKDKACVDECPVDCIYEGKRSLYINPNECVDCGA
FT                   CEPVCPTEAIFYEDDLPPEWEWYKDAAVEFFAEVGDLGGAQAAGPIGKDPQRVADLPPQ
FT                   NAA"
FT   gene            450091..451248
FT                   /locus_tag="Balac_0367"
FT   CDS_pept        450091..451248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0367"
FT                   /product="N-succinyldiaminopimelate aminotransferase"
FT                   /EC_number="2.6.1.17"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45751"
FT                   /protein_id="ACS45751.1"
FT                   /translation="MGFKDFSTPYDWSRVGRYKRIAQAVPGGMVDLSVGSPVDAVPDSV
FT                   RKALAVSANDANACGYPVTGGTADLRRAICEWFRGCRDVEIEAIGADVVPTVGSKEGVA
FT                   MMASLLQLSSGDVVVQPRVSYPTYEIGTQVAGATVVKVDDVAAVDSWRNIPGVKAIWVN
FT                   SPSNPTGAVLSAAQLHDIVNAAREIGAVVLSDECYALMNWTKANDDEGNREAAIESSPC
FT                   ALRADVCDGRADGVVVLYSLSKQSNMAGYRTALLAGDAQIISRMTAFRKQLGLIMPGPV
FT                   QAAMAAGLRDAASVRAQHNRYHDRLGELVCALRGYGYRVNMPQGALYVWTKAKSADCWT
FT                   DMKALASIGIIASPGEFYGAPEYLRFSATATDEQIHRACERLAQA"
FT   gene            complement(451286..452602)
FT                   /locus_tag="Balac_0368"
FT   CDS_pept        complement(451286..452602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0368"
FT                   /product="DNA-damage-inducible protein P"
FT                   /note="COG0389 Nucleotidyltransferase/DNA
FT                   polymeraseinvolved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45752"
FT                   /protein_id="ACS45752.1"
FT                   /translation="MSTAPRIEAAKRDWGHDETGCTILHIDMDAFFASLEIARHPEFRG
FT                   KPVIVGTGNRAVVSAASYEARKYGINSAMPAARAHQLCPNGIFLPVDHHYYSAVSHEIF
FT                   HTVFREVTDRIEQVSVDECYMDVSGALLAWHSPTRIAQWLRAQVAERFGITCSVGIAGN
FT                   KLVAKMASTNAKPNGMLLIPLDKHAQFVQLMPLRGIPGLGPAQEKRLNAWGINSVSQLA
FT                   RCSVEELIQATGSKAAATHLWEASHGIDPCTLTLHAPEKSIGQERTFDTDCNDLATAST
FT                   LIKQCCDKVASILRAKGLMARTLTVKLRFPDLAYSTKQMQLEQPTDAASTLYPHAIDLL
FT                   LRMMGMPADCRGTEVKLTRPIRLAGISTSTLTKREETVIQPTLDELLEENERVAPMPQA
FT                   SSSIPSPANGTRSTRLRCAEEAVDQIRRKFGQDSAHLGA"
FT   gene            452771..452861
FT                   /locus_tag="Balac_0369"
FT   tRNA            452771..452861
FT                   /locus_tag="Balac_0369"
FT                   /product="tRNA-Ser"
FT   gene            453222..454229
FT                   /locus_tag="Balac_0370"
FT   CDS_pept        453222..454229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0370"
FT                   /product="2-hydroxyacid dehydrogenase"
FT                   /note="COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45753"
FT                   /protein_id="ACS45753.1"
FT                   /translation="MTQILETQPERTDLPLTVMPCVVADMIEPFKANFEVLRDVTRLRM
FT                   YTDTTLDPDEIVRRCEGADAVIVIGVHIDDNLYTRLTHTQGHAKCFAFGGTGVASYIDL
FT                   ARARQDGVRVCNVRRYGDAAVAELAIALMMELARHVGELDTQVREGSWHGVFGTELAGK
FT                   TLGLVGFGGIGQHVARIANGFGMRIQVWNSHVHADALAANPEIALVDGIDDLMATSDIV
FT                   SLHLPLTDETRGGITFENLNHLRPGSMLINTARAEIIAPGALERRLERGDLLAGLDVFD
FT                   KEPLPQDSPLRSVPGVVLTPHVAWRADGAYASLTRQVMEAIVSFYEGGDFNVVV"
FT   gene            454286..454921
FT                   /locus_tag="Balac_0371"
FT   CDS_pept        454286..454921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0371"
FT                   /product="hypothetical protein"
FT                   /note="COG1739 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45754"
FT                   /protein_id="ACS45754.1"
FT                   /translation="MRTLLNPADEPAHDAFVEKKSEFIGDACHVDSLEDALAFVETVRE
FT                   RHPKARHVAYAAIVTGDDGRVMERMSDDGEPSGTAGKPILDVLRANELTDCVIAVTRYF
FT                   GGILLGSGGLIRAYSTGASIAVKAADVAQIVVCARYAVPLDYSQLGPMRHLVEVMGAVE
FT                   ESADFSDHVVLIVLVRDDARESFEHRVREQFSATVTPEYVGRCHRAMR"
FT   gene            454900..455718
FT                   /locus_tag="Balac_0372"
FT   CDS_pept        454900..455718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0372"
FT                   /product="AbrB family trancriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45755"
FT                   /protein_id="ACS45755.1"
FT                   /translation="MPPRDAVTRRTPPRDAGAAPIAACALDLGCTARSADDAHEVEVSM
FT                   ADGEQTAQTARNTQADGVQDAAGNQGEASEAQTPQFEPLTVTYERLRHSTDPQELHEFA
FT                   RRPLPDRAKQAAFSRATALLEAVAGNQHTPLEDRVFLAETMPFPNVLVKLSEDPSPEVR
FT                   RAVAANRDDKNWLVGRLTKDEVPEVRDEALRNPQTSWKMRMEGAQNPEVDAQTLDFLSR
FT                   LGVELEPDAPRILSTMVRRGVALNPNAGAETIERLKEDPVPEVAKAAQRR"
FT   gene            455827..457995
FT                   /locus_tag="Balac_0373"
FT   CDS_pept        455827..457995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0373"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="COG1640 4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45756"
FT                   /protein_id="ACS45756.1"
FT                   /translation="MAELNEESPERLARPLIRLAQSLGVATSYVGMSRDFHEIPDDVLV
FT                   AVLKALNVDASSEETIEVSLEHVNNQRAMRLIEPTVLHIVGEQSHVPIHLAITEAPKVT
FT                   ITLEDGTIYQHDIAVEPLPDVKVHEVNGKFFSTAQIALPADLPEGYHTLHIAAGQREAD
FT                   ATLISAPQRIPLLDPLKNGSLWGWMAQLYSIRSADSWGVGDFADLRTLLIDSKRYTNAD
FT                   FMLINPVHAGEPVSPLTPSPYLPVSRRFINYTYIHPEDIPEYYALDDAAKQSVKDAHAK
FT                   MEAYNADPNLIDRDAMWLEKEKALRTIFNTGLQSVRQQAFDDYKARCGEDLEAYATWCV
FT                   CYAKWGKPENTPDNWINKYTKDSPEVKQLREQNSDLLEFYRWLEWIAVEQMHAAQQAAR
FT                   QAGMKIGIMSDMAVGVHPDGSEVWWNPERFANGATVGAPPDMFNQQGQNWSQPPLSPLS
FT                   LKETGYKAYREMVRGMFDCAGAVRIDHILGLFRLWWIPEGQPASNGTYVYYDHNTMLGI
FT                   LAIEADRVGGLIVGEDLGVVPSYVQQSLADYAIFGCAVEWFEQMDGVFIPPKDWRPYAL
FT                   ASVDNHDMPPAAGYLEYEHVRVREQLGLLGEDSSAFERSARAEHQAMLQMLVDNGYLDV
FT                   NVMKDESGRWEEIVEALYRALNSSPCKLKAVSFVDAVGERRTQNQPGTDNEYPNWRVPL
FT                   ADYHGDNVPLEHLFDSDLLQRIAKIMNS"
FT   gene            458277..458726
FT                   /gene="rplM"
FT                   /locus_tag="Balac_0374"
FT   CDS_pept        458277..458726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="Balac_0374"
FT                   /product="50S ribosomal protein L13"
FT                   /note="COG0102 Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45757"
FT                   /protein_id="ACS45757.1"
FT                   /translation="MKTFTPKPADLTHDWYIIDAKDVVLGRLSVAAANLLRGKNKPSFA
FT                   PHADSGNYVIIINADKIALTGDKMDKELYSHSGRPGGLRRDSYAELLKNKPERIIMHAV
FT                   KGMLPKNKLAKVQLTRLRVFAGEEHPHVGQNPQVYEIEQISQQAK"
FT   gene            458746..459237
FT                   /gene="rpsI"
FT                   /locus_tag="Balac_0375"
FT   CDS_pept        458746..459237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="Balac_0375"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG0103 Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45758"
FT                   /protein_id="ACS45758.1"
FT                   /translation="MAENTNNSAVTETEETTAAFTTETNSGAGTGTSTIAPGYGTGRRK
FT                   EAVARVRLVPGTGEWKINGRTLEEYFPSKLLQREVNSPIVLLKLEGKFDAIVLVDGGGT
FT                   TGQAGAIRLGVARALNAIDRDANRAALKKAGFLTRDARVVERKKAGLHKARRAPQFSKR
FT                   "
FT   gene            complement(459345..462041)
FT                   /locus_tag="Balac_0376"
FT   CDS_pept        complement(459345..462041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0376"
FT                   /product="glycogen operon protein GlgX"
FT                   /note="COG1523 Type II secretory pathway, pullulanase PulA
FT                   and related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45759"
FT                   /protein_id="ACS45759.1"
FT                   /translation="MQLQKLQRYATRPGFFYTDDGGADVVVRSETAEQLWLSVLEPVDK
FT                   PSAFYNQAVRLPDDAADRLLDYMRHYPICSRIVPALGLRETLFKMTGPNYGLWNLHLDK
FT                   AWDGLQYGFRADGTWDPHHGLRFNPYKFLIDPYAKGIERAMQLDPSMFAYQCTIGDDGK
FT                   VEGDSWGEMSTLDSLGHCPVSVAIDDRDARKHDGDPEHPHVPWSKTVIYELHVKGFTKN
FT                   APWLPEELRGTYAGLAHPTTLAYLQDLGVTSIELLPIMAKQPEVFLQERVRTNYWGYST
FT                   LNFFSPEPGYATKKAQQAGAAAVRREVIDMVRALHESGFEVIMDVVYNHTCEGGNAGPS
FT                   VCWRGLDNLSFYRQQTQHAGELEDTTGCGNTVDFTDTHNITFAVDSLRYWAKRIGIDGF
FT                   RFDLAVSLARLKGMFTPYHPFLYALRSDQLLGNLKLIMEPWDLGFQGWRTGQFLSPFGE
FT                   WNDRFRDASRQFWLSDINQTAGHGVTTMQEMATRLCGSADLFATDPGRGATSSINYISA
FT                   HDGFTLADLTSYDHKHNEANGENNNDGTNVNHSANFGVEGPTDDLSIESARERSRMNML
FT                   GTLILSLGTPMLLAGDEFGNTQYGNNNAYCQDNEIAWLDWDWINCTEETAESRQLEATA
FT                   NLIAVRKSLDIYNHEDFFTRLSQLGLLKPSSRVQWSLPDGTMPMDSDWRDPSVRSFMMH
FT                   LYFKDEPDALIVVNGDETDRRMHLPSDSTFNLLWSSAQTTGEQPAPGTSVTKILRSAAV
FT                   SPLAETLRFKRATSPLHDLDAHGAVGADAEENAARQEIGTTKPTAKLTAHETQLLESIL
FT                   DRKIKDTLDQQMPPMTAGAHSGTGDPTRISMADSDPTTTAFDVEHDAPTPEDTAPAAGS
FT                   PNAVPSNVWTFPALSISLLLQSERRSW"
FT   gene            complement(462100..463191)
FT                   /locus_tag="Balac_0377"
FT   CDS_pept        complement(462100..463191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0377"
FT                   /product="Rok family repressor"
FT                   /note="COG1940 Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45760"
FT                   /protein_id="ACS45760.1"
FT                   /translation="MESTTVKRHNRELILRELFAAPSMTKRQIADATRLSMPTITENLR
FT                   ELAADGLIVPAEARASTGGRKAQTWQFNARHRTAIGVALRPTEVVCMAVDLRGNVIAEH
FT                   KVTMARRNDNAYYERAAHTISTFAQSLPSPIGVCFALPSSAARHCICVAEDWNAATESY
FT                   QGISRILTLPCSRIARNVAYATVELHNHPLLRNAVCLYLGEYINSAIVMDGVAREGNLE
FT                   HMQLDASGDICRCGSRGCLEVLCSSRQLTEEGESLPGFFGVLEQGERNHHVRMDRWLGS
FT                   LAHAVNNIRTFVPADVILCGPIADYLDDSEIAQLERLTTCAEHVNPSARNPQVMRGCCV
FT                   EYQDAVGAAQSLIPASHDGIPSD"
FT   gene            463598..466345
FT                   /locus_tag="Balac_0378"
FT   CDS_pept        463598..466345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0378"
FT                   /product="bifunctional acetaldehyde-CoA/alcohol
FT                   dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45761"
FT                   /protein_id="ACS45761.1"
FT                   /translation="MADKNSAETATKAAKLAVNVEDKKAAAQAEVDALVRKAQKALAEF
FT                   EKLDQQAVDRIVAKASVAALNKHLVLAKLAVDETGRGLVEDKATKNIFACEHVTNYMAG
FT                   QKTVGIIREDDVLGIDEVAEPVGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPG
FT                   AQKSSVEAARIVRDAAIEAGAPENCVQWIEHPSIEATGALMQHPGVATILATGGPGMVK
FT                   AAYSSGKPALGVGAGNAPAYVDNNVDVQRVANDLILSKHFDYGMICATEQAIIAHKDIY
FT                   APLVKELKRRKAYFVNDEEKAKLEKYMFGCTAFSGETPKLNSVVPGKSPQYIAHEAGFE
FT                   IPEDATILAAECSEVGENEPLTMEKLAPVHAVLKFSDKEQGFEMCEEMLKHGAGHTAAI
FT                   HTNNDDLVREYGLRMHACRIIWNQPSSLGGIGDIYNSIAPSLTLGCGSYGGNSVSGNVQ
FT                   AINLLNIKRIARRNNNMQWFKIPAKTYFEPNAIKYLRDMYGIERAVIVCDKVMEQLGIV
FT                   DKVIDQLRARSNRVTFRIVDYVEPEPSVETVERGAAMMRDEFEPDTIIAVGGGSPMDAA
FT                   KIMWLLYEHPEIAFSDVREKFFDIRKRAFKIPPLGTKAKLVCIPTSSGTGSEVTPFAVI
FT                   TDHKTGYKYPITDYALTPSVAIVDPVLARTQPRRLASDAGFDALTHSMEAYVSVYANDF
FT                   TDGMALHACKLIWDNLAESVNSEPGETKKKAQEKMHNAATMAGMAFGSAFLGMCHAMAH
FT                   TIGALCHIAHGRTNSILLPYVIRYNGQVPEEPTSWPKYSKYIAPERYQELASLLGVDPG
FT                   KTPAEGVENLAKAVEDYRDNKLGMNKSFKDCGVDEDYFWSILEQIGMRAYEDQCAPANP
FT                   RIPQIQDMMDIAIAAYYGVSQAEGHAMRVEREGVGATEEASERV"
FT   gene            complement(466661..467635)
FT                   /locus_tag="Balac_0379"
FT   CDS_pept        complement(466661..467635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45762"
FT                   /protein_id="ACS45762.1"
FT                   /translation="MTELDCEARRQQRCICASDSRQAKMLARRCAGGELVRVYRGMYAH
FT                   AQFWRTLPPPVQIVYLARALAKSHPDWVFNGETAACVRNLQIPWHALTHRVTIACTAGP
FT                   QKSDGPRLQRIRHPNMRAEIIDGIPVTPLVCTASDCVLTMEPCAAITALDGCFKTGLST
FT                   RELLRECAANGTDAVVTLLPHVNPASENGGEAYAHAVMTARYGFRKPQQQVPLTDPQTG
FT                   HIYRADYYWVCDDGTVIVAELDGAQKYIDPQMTGSRSVHAVVADEREREKALERAGVHR
FT                   TVRFTFDDVIHSERLHAKLHSAGVPTHFLGSTDINGYRVAIIG"
FT   gene            467831..468580
FT                   /locus_tag="Balac_0380"
FT   CDS_pept        467831..468580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45763"
FT                   /protein_id="ACS45763.1"
FT                   /translation="MIVLMPALSAFLVSGPTWNSVWLLVLWCLCYCVQFSAARWAKSHG
FT                   RARYRMPMLVYAALLVCAGLPFVFRFPGMLWWAPIYCVLCAGSLICAWRRREHSIPANI
FT                   CAVLASSTMAIPVASLGTHGGDAPALAHLLPFGQSILPPLGVEIAGAYALTLFGSVLYV
FT                   KTMIREQGNTRYLAASWIWHILVMAIGFLYSPIYGWLGAILLARAVVMPVATRNMRKTA
FT                   KIAGIGECVTSLVSFVMITYAATVLIP"
FT   gene            468858..469166
FT                   /locus_tag="Balac_0381"
FT   CDS_pept        468858..469166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0381"
FT                   /product="Ribosomal protein S10"
FT                   /note="COG0051 Ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45764"
FT                   /protein_id="ACS45764.1"
FT                   /translation="MAGQKIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTE
FT                   KNVYCVIRSPHKYKDSREHFEMRTHKRLIDIVDPTPKAVDSLMHIDLPADVNIEIKL"
FT   gene            469184..469834
FT                   /locus_tag="Balac_0382"
FT   CDS_pept        469184..469834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0382"
FT                   /product="50S ribosomal protein L3"
FT                   /note="COG0087 Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45765"
FT                   /protein_id="ACS45765.1"
FT                   /translation="MSQNKNRNALLGKKLGMSQVWDENGFFVPVTLVEVSTNVVTAVKN
FT                   EETDGYKAVQLGYGQVDPRKVTKPMAGHFAKAGVTPRRHLAEVRTENVEDFEPGQELTA
FT                   EVFPEGVQVDVTGTTKGKGFAGTIKRWGFKSYRRTHGSHKNERRPGSVGACATPSRILK
FT                   GKRMAGRMGHVTNTVQNLTVVSSDVENGILAIKGAIPGPKGGIVLVRSAVKGA"
FT   gene            469840..470496
FT                   /gene="rplD"
FT                   /locus_tag="Balac_0383"
FT   CDS_pept        469840..470496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="Balac_0383"
FT                   /product="50S ribosomal protein L4"
FT                   /note="COG0088 Ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45766"
FT                   /protein_id="ACS45766.1"
FT                   /translation="MANVTLNVTDNNGKEAGTLEAPEALFGFTAEEVQAHVPLIHQVVV
FT                   AQRAAARQGTHAVKNRGAVSGGGRKPWKQKGTGRARQGSIRAPQWYHGGVAHGPVPRDY
FT                   SQRTPKKMKAAALRYALSDRANNGRVAVVDFQLDAPSTKKAIAALAPVVADNFTTVVLS
FT                   RDNVNEWLSVRNIPTVYPIFADQLNTYDVITAQYVVFSKDGLEAFVAAKTAAKEA"
FT   gene            470501..470797
FT                   /gene="rplW"
FT                   /locus_tag="Balac_0384"
FT   CDS_pept        470501..470797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="Balac_0384"
FT                   /product="50S ribosomal protein L23"
FT                   /note="COG0089 Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45767"
FT                   /protein_id="ACS45767.1"
FT                   /translation="MVAIHKPAHDIILKPVVSEKSYALSDMGQYTFVVAPNANKVQIKQ
FT                   AIEEIFKVKVTNVNTLNRAGKRTRTRTGYGRRVNQKRAIVTVAEGQSIDIFGN"
FT   gene            470835..471665
FT                   /gene="rplB"
FT                   /locus_tag="Balac_0385"
FT   CDS_pept        470835..471665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="Balac_0385"
FT                   /product="50S ribosomal protein L2"
FT                   /note="COG0090 Ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45768"
FT                   /protein_id="ACS45768.1"
FT                   /translation="MAIRVYKPTTPGRRNASVSDFSDLTRSTPEKSLIRKNSKTGGRNN
FT                   YGRMTSRHRGGGHKRQYRLIDFRRWDKDGVPATVAQIEYDPNRSARIALLHYADGEKRY
FT                   IIAPEGIKQGDRIETGANADIKPGNNLPLRNIPTGTVVHAIELRPLGGAKIARSAGAAV
FT                   QLVAKDGAYAQLRMPSGEIRNVDARCRATVGEVGNSDHANIQLGKAGRARWMGKRPITR
FT                   GESMNPVDHPHGGRTRGGKPPVSPWGKGEVRTRRPKKASNKMIVRRRPNGKNRK"
FT   gene            471681..471959
FT                   /locus_tag="Balac_0386"
FT   CDS_pept        471681..471959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0386"
FT                   /product="30S ribosomal protein S19"
FT                   /note="COG0185 Ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45769"
FT                   /protein_id="ACS45769.1"
FT                   /translation="MTRSIKKGPFVDAHLQKKVDEQNAKGTHNVIKTWSRRSMITPDFI
FT                   GHTFAVHDGRKHVPVFVTESMVGHKLGEFAPTRTFKGHVKDDKKSRR"
FT   gene            472038..472340
FT                   /locus_tag="Balac_0387"
FT   CDS_pept        472038..472340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0387"
FT                   /product="50S ribosomal protein L22"
FT                   /note="COG0091 Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45770"
FT                   /protein_id="ACS45770.1"
FT                   /translation="MVDLIRGKKATEAITILKFAPQDASTPVLKVLQSAIANARVKADK
FT                   AGEPFRENDLYIKETYVDEGVTLKRFRARAQGRAARINKRTSHITVVVASKEGDR"
FT   gene            472343..473176
FT                   /locus_tag="Balac_0388"
FT   CDS_pept        472343..473176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0388"
FT                   /product="30S ribosomal protein S3"
FT                   /note="COG0092 Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45771"
FT                   /protein_id="ACS45771.1"
FT                   /translation="MGQKINPFGYRLGITESHRSKWFSDSNKVGERYRDFVLEDDAIRK
FT                   VMNKDLERAGVSRIIIERTRDRVRVDIHTARPGIVIGRRGAEAERVRAKLEKLTGKQVQ
FT                   LNIFEVKNPAIDAQLVAQGIAEQLTNRVTFRRAMRKAQQDAMRAGAKGIRIKLSGRLGG
FT                   AEMSRSEFYREGRVPLQTLRALIDYGFFEAKTTYGRIGVKVWIYKGDMTEREFEEQQAQ
FT                   QGNNRPGRRGGDRRPRRGQRAGQRPTGQNQVKTGPDQQMEAEVSKEAAVEPETKE"
FT   gene            473184..473603
FT                   /gene="rplP"
FT                   /locus_tag="Balac_0389"
FT   CDS_pept        473184..473603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="Balac_0389"
FT                   /product="50S ribosomal protein L16"
FT                   /note="COG0197 Ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45772"
FT                   /protein_id="ACS45772.1"
FT                   /translation="MLIPKRTKYRKQHRPDRHGMSKGGNEINFGDFAIQALAPAYVTNR
FT                   QIEAARIAMTRYIKRGGKVWITIFPDRPLTKHPLGARMGSGKGTPEFWIANVHPGRVMF
FT                   EIGGVSEDVAREALRRAIDKLPMKCRVIAREGGDI"
FT   gene            473603..473851
FT                   /locus_tag="Balac_0390"
FT   CDS_pept        473603..473851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0390"
FT                   /product="Ribosomal protein L29"
FT                   /note="COG0255 Ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45773"
FT                   /protein_id="ACS45773.1"
FT                   /translation="MPVGSEEYTIKNLNEKTNAEIEGFIKKSKEELFNLRFQHATGQLE
FT                   NTARLKAVKRDIARMYTVLRERELGISQAPAATETKA"
FT   gene            473861..474121
FT                   /locus_tag="Balac_0391"
FT   CDS_pept        473861..474121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0391"
FT                   /product="30S ribosomal protein S17"
FT                   /note="COG0186 Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45774"
FT                   /protein_id="ACS45774.1"
FT                   /translation="MAEERNFRKVRRGYVVSDKMDKTISVELELRTTHPLYGKVVRSTR
FT                   TVKAHDENNQAHVGDLVSIMETRPLSKTKRWRLDSIIERAK"
FT   gene            474210..474578
FT                   /locus_tag="Balac_0392"
FT   CDS_pept        474210..474578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0392"
FT                   /product="50S ribosomal protein L14"
FT                   /note="COG0093 Ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45775"
FT                   /protein_id="ACS45775.1"
FT                   /translation="MIQQETRLHVADNTGAKELLAIRVLGGSKRRYAGIGDVIVASVKD
FT                   AIPGGSVKKGDVVKAVVVRTVKERRRADGSYIKFDENAAVILGSGREPKGTRIFGPVGR
FT                   ELRDKRFMRIVSLAPEVI"
FT   gene            474580..474915
FT                   /locus_tag="Balac_0393"
FT   CDS_pept        474580..474915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0393"
FT                   /product="Ribosomal protein L24"
FT                   /note="COG0198 Ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45776"
FT                   /protein_id="ACS45776.1"
FT                   /translation="MVAKIKSGDLVKVIRGKDRGKEGTVKRVLKDDRLIVEGVQIVKKH
FT                   VRATQQGQQAGIVSVEAPIHRSNVMVIDPETKQPTRVGVVIKEEARDGKVKTVRVRVAK
FT                   KSGKELA"
FT   gene            474912..475496
FT                   /gene="rplE"
FT                   /locus_tag="Balac_0394"
FT   CDS_pept        474912..475496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="Balac_0394"
FT                   /product="50S ribosomal protein L5"
FT                   /note="COG0094 Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45777"
FT                   /protein_id="ACS45777.1"
FT                   /translation="MSEVVDEVIIEEPVTPRLKTMYKEEILPELEKEFHHDNPMQIPRI
FT                   EKVVVSMGVGAAARDSKLIEGAVRDLTAITGQKPKITKAKKSVAQFHLREGQAIGAYVT
FT                   LRGDRMWEFLDRLLTLALPRIRDFRGINGHQFDGQGNYNFGLTEQSMFHEIDPDEIDHQ
FT                   RGMDITVVTTTKDDDEAYALLKLLGFPFKEN"
FT   gene            475498..475683
FT                   /gene="rpsN"
FT                   /locus_tag="Balac_0395"
FT   CDS_pept        475498..475683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="Balac_0395"
FT                   /product="30S ribosomal protein S14"
FT                   /note="COG0199 Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45778"
FT                   /protein_id="ACS45778.1"
FT                   /translation="MAKTCLKVKALRKPKFKVRAYTRCMVCGRPHSVYRKFGLCRICLR
FT                   EKAHRGELPGVTKSSW"
FT   gene            475771..476169
FT                   /gene="rpsH"
FT                   /locus_tag="Balac_0396"
FT   CDS_pept        475771..476169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="Balac_0396"
FT                   /product="30S ribosomal protein S8"
FT                   /note="COG0096 Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45779"
FT                   /protein_id="ACS45779.1"
FT                   /translation="MTMTDPIADMLTRLRNASAAKHETVDMPYSKFKKNIAEILKREGY
FT                   IADFTAKEARVGQTLEVTLKYGPHGERSIQGIKRVSKPGLRRYAKSDALPMPLGGLGIA
FT                   IISTSSGLLTQKECLDRGIGGEIVAYVW"
FT   gene            476186..476725
FT                   /gene="rplF"
FT                   /locus_tag="Balac_0397"
FT   CDS_pept        476186..476725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="Balac_0397"
FT                   /product="50S ribosomal protein L6"
FT                   /note="COG0097 Ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45780"
FT                   /protein_id="ACS45780.1"
FT                   /translation="MASHIGKLPIEIPAGVEVTINGQEFAAKGAKGSDSYTIPEGVTAK
FT                   VEGNEIIVTANDDLRPTRAKHGLARSIVASMVKGVHDGYSKSLDIVGTGYRAQMKGKGI
FT                   EFSLGYSHTITVNPPEGITLELPNPNQVIVKGTDKQAVGQVAANIRKLRAPEPYKGKGI
FT                   KYSDEVIRRKAGKAGK"
FT   gene            476727..477098
FT                   /locus_tag="Balac_0398"
FT   CDS_pept        476727..477098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0398"
FT                   /product="50S ribosomal protein L18"
FT                   /note="COG0256 Ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45781"
FT                   /protein_id="ACS45781.1"
FT                   /translation="MSVKIFGKGKKAALKRRHARIRKRISGTAERPRLVVTRSNRHMVA
FT                   QIVDDNAGKTLVSESTLMADFADFQGTKTEAAKKVGELLAKKAKDAGITTVVFDRGGNM
FT                   YHGRVAAVAEGAREGGLAL"
FT   gene            477122..477826
FT                   /locus_tag="Balac_0399"
FT   CDS_pept        477122..477826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0399"
FT                   /product="30S ribosomal protein S5"
FT                   /note="COG0098 Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45782"
FT                   /protein_id="ACS45782.1"
FT                   /translation="MAEETQNTQATAESSNNDERRGRRNNRGGEGRRGDRRGRREDNHE
FT                   NEMLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAIAKGQLDA
FT                   KKHLFNVPRIRGTVTHPVTGHDHAGTVMLRPAAPGTGVIAGSAVRAVMECAGITDILTK
FT                   SMGSATAVNVVRATVDALKQLEEPEEIAARRGLSVQEVAPDQLLRERAAGIAEARKARE
FT                   EAKAEAAAKDGE"
FT   gene            477826..478008
FT                   /gene="rpmD"
FT                   /locus_tag="Balac_0400"
FT   CDS_pept        477826..478008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="Balac_0400"
FT                   /product="50S ribosomal protein L30"
FT                   /note="COG1841 Ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45783"
FT                   /protein_id="ACS45783.1"
FT                   /translation="MAKLKITLVHGVAHANKKQKATVQTLALRKIGQSTVLEDNSSTRG
FT                   MIAVVRHLVNVEEAE"
FT   gene            478011..478469
FT                   /locus_tag="Balac_0401"
FT   CDS_pept        478011..478469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0401"
FT                   /product="50S ribosomal protein L15"
FT                   /note="COG0200 Ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45784"
FT                   /protein_id="ACS45784.1"
FT                   /translation="MANEETTILQMHDLKPAPGARKDRIRVGRGEGSKGKTSGRGDKGT
FT                   KKRYQVRPGFEGGQLPLYMRLPKLRGFRSPFKTEYQVVNIAALNDLFPQGGEITVADLV
FT                   AKGAVRANRPVKVLGEGEATAAFTLKGVKASASAKSKIEAAGGSISED"
FT   gene            478707..480056
FT                   /locus_tag="Balac_0402"
FT   CDS_pept        478707..480056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0402"
FT                   /product="preprotein translocase subunit SecY"
FT                   /note="COG0201 Preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45785"
FT                   /protein_id="ACS45785.1"
FT                   /translation="MRTLIQAFRTKELRNKILFVLGIIIIYRIGSFIPTPGVDYKVVND
FT                   CVANTTNNAENFIGLVNLFSGGAMLQLSIFALGVMPYITASIVVQLLRAVIPRFEALHK
FT                   EGQSGEAKLTQYTRYLTIGLAVLQSTTILVTARSGALFNYQCNNVIPDASIWNMVVMIM
FT                   VMTGGTGLIMWMAELITEKGIGQGMSILIFLSICSGFLPQLWQIGWGTNGTDGNWTKFA
FT                   IVTVVLLVIMIFVNYVELSQRRIPVQYTRRMIGRKMYGGSSTYLPLKINMSGVIPPIFA
FT                   SSILAIPTLFAQFGNSQQSWVQWVNKYLANTTSVWYICLYALMIVFFTFFYTEITFNPD
FT                   ETADNMKQFGGFIPGIRAGSATSRYLKYVINRLNTVGAIYLLFVALLPTVLIMALKLNT
FT                   QLPFGGTTLLIIAGVGLDTLRQAKAQTEQYQYAGFLFENTDHTEGKAIAK"
FT   gene            480229..480801
FT                   /gene="adk"
FT                   /locus_tag="Balac_0403"
FT   CDS_pept        480229..480801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="Balac_0403"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="COG0563 Adenylate kinase and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45786"
FT                   /protein_id="ACS45786.1"
FT                   /translation="MRLLIMGPQGVGKGTQAKLLAEHYGIPTISTGDIFRANIKNKTEL
FT                   GKKVLEYTSQGFLVPDELTNEIVRDRLAQDDAKNGWILDGYPRNVAQVSALDEILEGLG
FT                   EQLDAVVALTAPTNVLLERMAKRAKEEGRADDTPEAIQNRLNTYDKETTPVLDIYQQRG
FT                   KLVTVNGVGEIDAISEEIVKALDAKLG"
FT   gene            481050..481268
FT                   /locus_tag="Balac_0404"
FT   CDS_pept        481050..481268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0404"
FT                   /product="Translation initiation factor 1"
FT                   /note="COG0361 Translation initiation factor 1 (IF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45787"
FT                   /protein_id="ACS45787.1"
FT                   /translation="MAKDGVIEVEGRVVEALPNAMFRVELENKHIVLATISGKMRKNYI
FT                   RILPQDRVVLEMSPYDLNRGRITYRYK"
FT   gene            481307..481420
FT                   /locus_tag="Balac_0405"
FT   CDS_pept        481307..481420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0405"
FT                   /product="Ribosomal protein L36"
FT                   /note="COG0257 Ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45788"
FT                   /protein_id="ACS45788.1"
FT                   /translation="MKVSPSVKRICENCRVIRRHGRVMVICTNPRHKQRQG"
FT   gene            481559..481936
FT                   /gene="rpsM"
FT                   /locus_tag="Balac_0406"
FT   CDS_pept        481559..481936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="Balac_0406"
FT                   /product="30S ribosomal protein S13"
FT                   /note="COG0099 Ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45789"
FT                   /protein_id="ACS45789.1"
FT                   /translation="MARLAGVDIPNDKRIEVALTYIFGVGRTRAKETLEATGINPDTRV
FT                   KDLTDEQLITLRDYLESNYKIEGDLRREVDADIRRKIQINSYQGMRHRKGLPVRGQRTK
FT                   TNARTRKGPKRTVAGKKKATK"
FT   gene            482013..482411
FT                   /locus_tag="Balac_0407"
FT   CDS_pept        482013..482411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0407"
FT                   /product="30S ribosomal protein S11"
FT                   /note="COG0100 Ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45790"
FT                   /protein_id="ACS45790.1"
FT                   /translation="MAAQKQAARKTRRRDRKSIPVGQAHIKSTFNNTIISITDPSGAVV
FT                   SWASGGDVGFKGSRKSTPYAAGMAAESAARKAMEHGVKKVDVFVKGPGSGRETAIRSLQ
FT                   SAGLEVGSITDVTPQAFNGVRPPKRRRV"
FT   gene            482490..483485
FT                   /locus_tag="Balac_0408"
FT   CDS_pept        482490..483485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0408"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0202 DNA-directed RNA polymerase, alpha subunit/
FT                   40 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45791"
FT                   /protein_id="ACS45791.1"
FT                   /translation="MLIAQRPTLTEESLNPQRSRFIIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSVRISGALHEFTTLPGIEEDVTEILLNIKGIVLTSEYDEPVVMYLRKAGSGE
FT                   ATAGDITPPAGVTIANPDLHIATLAEDGELEIEFTVERGRGYVPAQMNKQDGDEIGRIP
FT                   VDSIYSPVLKVSYKVEATRVEQRTDFDKLILDVETKPAISPRDAVASAGSTLVELFGLC
FT                   RELNTQAEGVEIGPAPVAEQADPGMSVPIEDLNLTQRSYNCLKREGIHTVGELVNHTEQ
FT                   DLLDIRNFGMKSIDEVKEKLQSLGLSLKSSPLGFDTNNLEGGTFFSPEDE"
FT   gene            483570..484016
FT                   /locus_tag="Balac_0409"
FT   CDS_pept        483570..484016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0409"
FT                   /product="50S ribosomal protein L17"
FT                   /note="COG0203 Ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45792"
FT                   /protein_id="ACS45792.1"
FT                   /translation="MPTPKKGPRLASSPAHERLMLANMATSLFEHGRITTTLPKAKRLR
FT                   PLAERLITFAKRGDLHSRRRVMRVIRNKSVVHKLFTQIAEQMEQREGGYTRIVKIAPRK
FT                   GDSAPAAIIELVTEPVSPKKAVVKEAEAATKVAAKEEQTEAAAE"
FT   gene            484238..485014
FT                   /locus_tag="Balac_0410"
FT   CDS_pept        484238..485014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0410"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="COG0101 Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45793"
FT                   /protein_id="ACS45793.1"
FT                   /translation="MPDAGSLRLTVAGRTDAGVHATHQVCHVDVPDQTLGQCVGHMNLT
FT                   PVQALQTRLSRMMPDDIAIHGISVAPAGFDARFSALERTYVYRIADARVPWDPRLKDFA
FT                   WRTDRELDIAQMNAAAALTLGLHDFGSFAIANPGGTTIREVKTAYWQRVPTRPLLGPGM
FT                   GERYHTPAVESGLLCFTIVADAFARNMVRSLVGACVQVGMGKRDVDWFAGKMRVPLREG
FT                   STGPIAPQGLTLEHIAYPADDELAARAERIRAKRTL"
FT   gene            complement(485205..485293)
FT                   /locus_tag="Balac_0411"
FT   tRNA            complement(485205..485293)
FT                   /locus_tag="Balac_0411"
FT                   /product="tRNA-Ser"
FT   gene            complement(485393..486304)
FT                   /locus_tag="Balac_0412"
FT   CDS_pept        complement(485393..486304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45794"
FT                   /protein_id="ACS45794.1"
FT                   /translation="MQTRHRFLSVCARTVAVALTTLAFVGVTACSAPRIAGRSEQEQEL
FT                   GTCERFLETAQSYSNTMGDANIPLYLRYFTASLAQHDWLNVALQCPSQFGDATMRSAQA
FT                   QHFTRLAANHFGFAYAPLTVTKLDTVDSLDLPGEALATIALAEDRAGFAAEVLAGRYDS
FT                   FTPTSANTSSDAEFVRRLASNATLLTMSDNHKEAAARLTMLSKGAQDIRRKVYDTRMLT
FT                   TSEVNATDPATGLRTRTPAIVEMDCAREQLQRIDDLPASDIATAQSQSSDALLQLSLLI
FT                   ATHAVTAFGLGYPSADYALFAS"
FT   gene            486417..487493
FT                   /locus_tag="Balac_0413"
FT   CDS_pept        486417..487493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0413"
FT                   /product="transcription elongation factor NusA"
FT                   /note="COG0195 Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45795"
FT                   /protein_id="ACS45795.1"
FT                   /translation="MKLDLNGIHALAQEQGIDAETVDAALSEALRLAYLKMPHAAKYAR
FT                   VELDPRAGSFTIWARDEIPQEPTEDNPHPAPELGEEYDDTPHDFGRLAASTARQVIQQL
FT                   FRKAEDDRVFGAFSGQRGKLITGVVQQDVKDPANVHVAVGDVEALLPRREQVPGERYRH
FT                   GERIRVYVTTVARGLKGPEIIVSRSHPELVRRLFEREVPELASGAVSIMAIAREAGART
FT                   KIAVRANTPGINPKGALIGPGGSRVRAVMENLGSEKIDIIDWSANPAEFIAAALSPAVV
FT                   SDVQVISEKNQTAIAFINDEQLSLAIGKEGQNARLAAKLTGWKIGIESNSAHAAKLREQ
FT                   AAKAADGTQSGNAEESAE"
FT   gene            487703..490537
FT                   /gene="infB"
FT                   /locus_tag="Balac_0414"
FT   CDS_pept        487703..490537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="Balac_0414"
FT                   /product="translation initiation factor IF-2"
FT                   /note="COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45796"
FT                   /protein_id="ACS45796.1"
FT                   /translation="MAKARVYELAKELGVDSKTVLEKLKDMGEFVKSASSTVEAPVVRR
FT                   LKAAFPKDGGNDSRPSAKKSSTPKSGAPAAAKPAATPAAVAGATPATAAPSAPKPGQRS
FT                   NTSAKPGAHNTRRNEQTPRPGQNGGQRGATARPHAPGKPGANAGGTRNGGKAAPTPHAP
FT                   QHGGNRGGSNNAPKPGANAAQHAPRPGNNPFSRKQGMHTPTPGDIPRPHPMARPTVNNN
FT                   ERRGGGNGRPGQRGGFRPRPGQGGSGAPKPGSWGQHRQGAGSGGGRPGGNRFGGGNGGN
FT                   NFQNNGPSNGPSRGGGRGRGGAAGAFGRQGGKSSKARKNRLAKRHEYEELKAPVIGGVR
FT                   IPTGNGQTIRLRQGASLADLAEKINVNPAALVTVLFHLGEMATATQSLDESTFQILGEE
FT                   IGWNIKIVSAEEEDKELLQQFDIDLESEELQEEADLKPRPPVVTVMGHVDHGKTRLLDT
FT                   IRRTNVVAREAGGITQRIGAYQVTVDLEGEERKITFLDTPGHEAFTAMRARGAELTDIA
FT                   ILVVAADDGVMPQTVEAINHAQSAHVPIVVAVNKIDVPGANPEKVRGQLTEFGLVPEEY
FT                   GGSTMFVDISAKQGTNVDKLLEAVLLTADAELDLRANPDMDARGATVEARLDKGRGAVA
FT                   TVLVQSGTLHIGDSIVAGTSYGRVRAMLDENGKHMKEALPSTPVQVLGLTSVPTAGDLF
FT                   LVAPDDRAARQIAEKRQATERAAQLAKRRKVVSLEEFKKKFAESEIDMLNIVIKGDSSG
FT                   SVEALEGSLMKIEVSDEVGIQVIHRGVGAITQNDVNLASVDKAVIIGFNVRPNRQVADL
FT                   AEREGVEIKYYSVIYKAIEDIEASLKGMLKPEYEEVTTSHSEIREIFRSSKFGNIAGVM
FT                   VLDGEVKRGTKARILRDGVTTFNDLEISSLRRFKDDVKSVTEGYEAGINLGNFNDIEIG
FT                   DVIETFEMREIERK"
FT   gene            490691..491344
FT                   /gene="rbfA"
FT                   /locus_tag="Balac_0415"
FT   CDS_pept        490691..491344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="Balac_0415"
FT                   /product="ribosome-binding factor A"
FT                   /note="COG0858 Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45797"
FT                   /protein_id="ACS45797.1"
FT                   /translation="MQGTNSRAARIAALIQRVIASNMESTLHDKRLKNVTITDVKVTND
FT                   LQLAKIYWTTLSRDGHEEGERKRAKEALNQAKGRLRTMVGAKAGLRLTPQLQFIFDEVP
FT                   GEAHEIEDILSLARKRDEELARMRANAAYAGDADPYRHDDETEEAVEEELDEQEHENKD
FT                   EYTEYPGDVVEVEEFEDFDNSGDDLEHSDDDPVDPVATDPASTIDTVDDHDEDK"
FT   gene            491348..492400
FT                   /locus_tag="Balac_0416"
FT   CDS_pept        491348..492400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0416"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="COG0130 Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45798"
FT                   /protein_id="ACS45798.1"
FT                   /translation="MGTGKRDAKVNGVLIVDKPQGVTSHDIVAAVRAALHTRKVGHAGT
FT                   LDPMATGALVIGVGHATRLLQYIVEHTKTYSATIRFGQRTTTDDADGEFVEREAEAAVL
FT                   PTLEQVREAVANEYTGDIEQIPNAVSAIKVNGQRAYDLAREGRHVELKARRVTVHAFDV
FT                   LGGRQTQAANGTPVLDVDVRVTCSAGTYIRALARDLGNDFHCGAHLTRLRREAVGAFRV
FT                   RDARIVRAHAEARTFVNRDGEEITRNRAVLDCVGEDLAGHLLTMVQAAQLTLPVLAVSE
FT                   AQAADLRFGRRIVAQAPTDDERPAHHHGEHVWAAIGSADGEPEVVAIVERAKHHEFKPV
FT                   TVFAANTGNE"
FT   gene            492408..493694
FT                   /locus_tag="Balac_0417"
FT   CDS_pept        492408..493694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0417"
FT                   /product="riboflavin kinase"
FT                   /note="COG0196 FAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45799"
FT                   /protein_id="ACS45799.1"
FT                   /translation="MDIFRLTPAADGNVAWPTLSTSKKSVVTVGAFDGLHVGHHAVIEE
FT                   TVRQARKLDAYSVVIMFDPRPAFVHAYAKAHAGKDVPAGVHDPEAITGVDARLRMLSRM
FT                   HVDYVLIVRYTIAFSEKSFRFFLGQLVGKLGMRMLVLGEDARMGANLEGDIKKIRTLAE
FT                   ATGVFELEVVTNQGGTVRVPERFTPTAPNEPGEPGDPLEGLGKAERRAWSKKHNAREVR
FT                   NQSSTNVRYLLSQGRVQAANEILGHAHAVEGVVEHGEERGRTIGFPTANIAEPMEGYLP
FT                   VDGVYAGWLVDLGPADEYERDQQQLSGKAADGEAVEAASVTVSDTPVVSHRFSSSRVDS
FT                   RLAAQSPFRWPAAISIGTKPTYSESTGLNERVLEAYALTDEWLDLYGHRVRVEFERFLR
FT                   PQIKFGSTDELVAELKHNVEETKELLGAE"
FT   gene            complement(493706..495181)
FT                   /locus_tag="Balac_0418"
FT   CDS_pept        complement(493706..495181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0418"
FT                   /product="DNA repair protein RadA"
FT                   /note="COG1066 Predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45800"
FT                   /protein_id="ACS45800.1"
FT                   /translation="MAKKTVNYVCTECGWSGGKWYGRCPECGQWGTIEEFHEAPAATGA
FT                   RTPAPGRTSRTPISVPNVQSAAKPITSISTDTVNRLPTGFGEFDRVLGGGIVPGSVVLI
FT                   AGEPGIGKSTLLLETAGNIAKSVAAAHSRTPDGSDSEPHDAHAGTHDSVLYISGEESQA
FT                   QVRLRASRIGAVEENLLLAATTDLSTVLGLIDSVRPALAIVDSAQTIVSQDVDGISGGS
FT                   TQVREVASALIDSAKSLDVPVLLVGHVTKDGSIAGPRTLEHLVDVVCQFEGESQTALRL
FT                   LRAVKNRFGPTDEVGCFDMSGEGIEEVRDPAGLFLSSQNEPVEGTCVTFTLDGHRSLAV
FT                   EVQSLVTNSVLPTPRRAVNGVDPSRIAMLVAVLYRHGGISLLQNDLYISTIAGGQAKEP
FT                   GCDLAITAAMASAALNKPIAKNVCAIGEISLTGQVRPVPRLEYRLREAQRLGFTKAIVP
FT                   ATQKPLKMEGMTLAPATNLKDALAFLHLAKQRH"
FT   gene            495404..495985
FT                   /locus_tag="Balac_0419"
FT   CDS_pept        495404..495985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45801"
FT                   /protein_id="ACS45801.1"
FT                   /translation="MHSLRYVRIVVAVFVMLFVLALVSAFGWPGWAVRTPAKPVAVPTA
FT                   TPSKATVKAKALPGDATALLRAMPDHVSNFARVQADSTDAWADSNPIEEYKLTYSNGND
FT                   KDAVQLTVAQWSDSEKAQGQYTKLTGDLKGSSLANGVVKVNGDVTGNYEVKTAESDDTQ
FT                   ATAVWRNDTVVFSVTGTKNSVVSVYQLFPL"
FT   gene            complement(496318..497019)
FT                   /locus_tag="Balac_0420"
FT   CDS_pept        complement(496318..497019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0420"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="COG0120 Ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45802"
FT                   /protein_id="ACS45802.1"
FT                   /translation="MDKAQQDAMKKEAGIEAAKLVKSGMIVGLGTGSTVRFLVDELGRR
FT                   KQEEGLEFTGVTTSRRTQEQAEGYGIKIVNIDDVDHIDLCIDGADEVDKNFNGIKGGGA
FT                   ALLWEKIVAINSNRIVWIVDASKLVDVIGKFPLPVEVIPFGAMHVIERMKERGYNPTLR
FT                   LDAEGKPVRTDENNYVVDLHLERIDDPAGLNEDLINMVGVVEDGLFLDMVNEVIVGDPN
FT                   GPRTLINPNKA"
FT   gene            complement(497109..498098)
FT                   /locus_tag="Balac_0421"
FT   CDS_pept        complement(497109..498098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0421"
FT                   /product="ribonuclease H"
FT                   /note="COG0328 Ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45803"
FT                   /protein_id="ACS45803.1"
FT                   /translation="MTITVSTDGSALRNPNGPMGWAWADHTDGARDEHAHAGDCAAGGA
FT                   TNGTNQIGELCAVLEALRAHPGSEPLVIESDSQYAINCSSKWVFGWKKNGWKNSKQEPV
FT                   KNAPIIKAIDAEISKRAGKVSFRWVKGHAGNAGNEKVDDLARGFAGDCESGAQEGYLPK
FT                   EGWQALLESPYARDVKVPADAQLLLDGEMDEREYTRLHAAEVDDLEHGEPNLTELGDVR
FT                   TPADSAETDAPADTAAHAAESAADGTDTPAGEPTATAGMQLAPTGLAASGRVTLSPPPN
FT                   SSPYYDGSPRRIHGYIEVDALVQGDGTVDLENARFLMHRRENGQETRQ"
FT   misc_feature    498853..499044
FT                   /note="potential RNA location 498892 ...498979 (tRNA-S and
FT                   potential protein location 498852....499043 overlap by 88
FT                   bp)"
FT   gene            complement(498893..498980)
FT                   /locus_tag="Balac_0422"
FT   tRNA            complement(498893..498980)
FT                   /locus_tag="Balac_0422"
FT                   /product="tRNA-Ser"
FT   gene            complement(499326..500612)
FT                   /locus_tag="Balac_0423"
FT   CDS_pept        complement(499326..500612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0423"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COG0172 Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45804"
FT                   /protein_id="ACS45804.1"
FT                   /translation="MLDIQFIREHPEVVKESQRKRGESVELVDEVLRADEERRSSLKQF
FT                   EEARARQKEIGKQVAKAAPDEKAKLIAQTKELSEQVASFKASADTADEQYTTAMWQLSN
FT                   IVEPQAPEGGEDDYVVMRKVGQIRDFAAEGFEPKDHLTLGEEVAGIDMKRGVKVSGSRF
FT                   YFLRGDVARLQIAMLTMAVDQAQEHGFILAITPTLVRPEVMRGTGFLNSHADEIYRLRE
FT                   PDDDYLVGTSEVALAGMHENEILDLSDGPLRYCGWSSCYRREAGAAGKDTSGIIRVHQF
FT                   DKVEMFVYAKPENSDAEHQKLLAMEEEMLAKVEVPYRVIDTAAGDLGSSAARKFDCEAW
FT                   VPTQGRYRELTSTSNCTQYQARRLNIRERVADGGTSPVATLNGTLATTRWLVAILENHQ
FT                   QADGSIEIPKAMRPYMGGKEVIEPRKWEA"
FT   gene            500784..501941
FT                   /locus_tag="Balac_0424"
FT   CDS_pept        500784..501941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0424"
FT                   /product="hypothetical protein"
FT                   /note="COG1597 Sphingosine kinase and enzymes related to
FT                   eukaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45805"
FT                   /protein_id="ACS45805.1"
FT                   /translation="MGDNQWVLILVCMIAAIIVIVGAVVGIRIALHIRRVETIKNERRR
FT                   DAVHYAFVINPSKPTAGETRAFIERFCTNRGIADIMFIETQLDKDGRACALEALEQGAD
FT                   VVIAVGGDGTVRTVASAMGGTNHAMGIIPIGTGNLFARNMNIPVGDLEAAMLIAISHGS
FT                   YKVDIGRLQLLDHPEEDHAHAFLIIAGIGFDAVMIDDTDPKLKKNISWLAYFVAGAKHL
FT                   FAPKYHASVVLTGANGDQHVREDVEFRTFMSGNCGEIPVFSLMPDASFNDGLLDFEVID
FT                   TNGGIIGWMNLFGDVVHQTITRKAQQSPLSVHSTIDQVQGVSAELQLEKPVPAQVDGDM
FT                   LKPTRHIRFSVDHNALIVRAPGQDAEMTGNLQPVRVDASGKPRLR"
FT   gene            502101..503777
FT                   /locus_tag="Balac_0425"
FT   CDS_pept        502101..503777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0425"
FT                   /product="phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="COG0033 Phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45806"
FT                   /protein_id="ACS45806.1"
FT                   /translation="MVAKNAGLPATPADLIDVDEVVGAYYDVVPDPSVPEQRVIFGTSG
FT                   HRGSSLKTSFNEAHIVAISQAIAEYRKAAGVDGPLYIGRDTHALSLPAWKTAIEVLVAN
FT                   GVTVCIDSRDDFTPTPVVSQAILTHNRAADGTQRFEGPGLADGIVVTPSHNPPTDGGFK
FT                   YDPVTGGPAPADVTNAIANRANELLGDFRNVKRVPFEQAVKSEFVKRFDYREHYVDDLK
FT                   NVIDFDVIRDSGVRLGIDPLGGASVNYWPLINEKYGLNIGVIRPEVDPTWRFMTIDHDG
FT                   KIRMDPSSQYAMKGLVDALNAGAWDKYDLVGGTDPDADRHGIVCPNWGVMNPNHYLAVC
FT                   VEYLFGGNRPDWPEHTGVGKTLVSSSLIDRVAASIGAPVVEVPVGFKWFVDPLFTGEIA
FT                   FGGEESSGMSFLRFNGRVWTTDKDGIIPDLLAAEITGKTGKNPAQLHQEQVDRFGESWY
FT                   SRIDTPTTLEQKQKFAKLDASDVTATKLGGEPIEQILTKAPGNDAPIGGIKVVTKDNWF
FT                   AARPSGTENIYKVYAESFVSPETLDSVLTEATEVVDKALGE"
FT   gene            complement(503899..505458)
FT                   /locus_tag="Balac_0426"
FT   CDS_pept        complement(503899..505458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0426"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45807"
FT                   /protein_id="ACS45807.1"
FT                   /translation="MSIVMIALFAGLGIAMEPKWSVKPLSMHLQVTERSTAIKARGITT
FT                   PQEGTYQVRQTRLRLPISGGKTVNAILREPENAPSGRAACVFVHGAGTGKAEEVYADLA
FT                   NALASAGITTLVQDKRLDNYTPLRRDYDSSAEDYLAGLNLLRAQQGVDARKVGLYAESE
FT                   GTWIASVMTHKDRHIAFQVLTSAPVYSGRQQIAMAATEYLNIIGAPGGVVDIIPRLLSL
FT                   NFAPIGLEYADFNTAEYRDTLTMPLLVNYGTIDPAMPIEQGALQLIGDAHAAGNSNVLV
FT                   RYYAANHQMRTGSSLSLPGLPLDKDYTHNLEDWINAIAAGATEDDWLTPDIAGARPYQE
FT                   YAIPENISSGLVSSVWVLVVLIVICLVSWLLTVVFCIGAFVSRKRVEAKTVDDSGHIVV
FT                   HRFTMLSKVLIITNIVLLPICAAGFLGYFAFTAKAALSLTDEATMLSFGWSMLRLGSLV
FT                   LIVMNSWMWVRMFFFYGPGNIDKEYPKTAMRMASGHTATVALLSVSVLCALVLSSFFGL
FT                   IG"
FT   gene            complement(505549..506169)
FT                   /locus_tag="Balac_0427"
FT   CDS_pept        complement(505549..506169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45808"
FT                   /protein_id="ACS45808.1"
FT                   /translation="MSTRQTIKSIIEREWDQFQHTNNEGGRASCQGNRPMFEVMRASQF
FT                   AAWPQELLTSYLADLREADAGGRNLVTEKYARMMASTAPEIYARDLEPHLPRLSEARIA
FT                   QQERIIKRQLAWAHEFADRYPALGAGMRVFDTAEDSETTTSFETYLRGELATYSQRTLD
FT                   LYERFVRECERRQENLTEQIIANTVRLGGYTNLDEAEAAQRRA"
FT   gene            complement(506199..508331)
FT                   /locus_tag="Balac_0428"
FT   CDS_pept        complement(506199..508331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0428"
FT                   /product="Tetratricopeptide repeats containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45809"
FT                   /protein_id="ACS45809.1"
FT                   /translation="MDDQRDLERMLGNLRQFQSESDASKESEKSPSNAGTSFDADEFLA
FT                   GLDAMFASHTAKDKADEYLQQAMADAENAQDYAGLLTVLNETMGFYRSQGRHQENQWII
FT                   QRAIELALRMGLEGTEAWTTTLINAATSQRAAGNLDQAEDLFEQALDAARRTYGPDDRR
FT                   LAALHNNRSMLFSQTHRRRQAIDELHESLRILEHSSVDAQSDVDIASTCTNLALAMLDG
FT                   EDQPTDAELEEAQSLARRTLDIYQHAGSDSSAHYASALAGAAHVSFASEDYAEAVRQYQ
FT                   RALDVIARCYGEHTDYYRVTAQNLQEAQRKLELTQSTDNPHDSVDDSPAQSTVHTDIHR
FT                   SAVHNASVPSTMQASAQHSTSPRTLAPGTALRVAEPGMALAKAYWQELVKPMIDERYAS
FT                   VKHRIAAGLVGHGSECYGFDDALSRDHDFGPRVCLWLTADDYAEFGERLQADYDALPSM
FT                   FHGVSRSAATPRAQGEGRRDGVFEIAAFFTQLTGMPHAPADDEPHLWLSLDESTLAAAT
FT                   NGRVFQDGLGAFSSARQSFTRMPDDVRLALISRRLGMISQAGQYNLPRMLERGDGAAAW
FT                   LCIEQFADAASSLVFLVNNPASVGYAPYYKWRFAALRRLSARPAMLLTEICGELEQLMR
FT                   LSSAACFGGAGFGEGGKGAAPSIDTVNAIVETICEQITHTLNALGLSDSPQTFLEWQRP
FT                   YVEAHITSPATCLHSL"
FT   gene            complement(508386..509096)
FT                   /locus_tag="Balac_0429"
FT   CDS_pept        complement(508386..509096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0429"
FT                   /product="response regulator of two-component system"
FT                   /note="COG2197 Response regulator containing a
FT                   CheY-likereceiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45810"
FT                   /protein_id="ACS45810.1"
FT                   /translation="MSERERQGIRIAVVDDHEMFRAGVIATLQPYFTIVGQAADVPSAI
FT                   EMIADTQPDVVLLDVHVPGGEGGGGAEILRKSQPHAPQTAFLALSVSDSAQDVGSVIRA
FT                   GARGYVTKTITGNDLIHSIEQVSDGYAVFSPKLAGFVLSAFQGAPLSDGMDASNESAAG
FT                   GDTVAHDAELDSLSTREQEVMRLIARGYTYKEVGAELFISVKTVETHVSNVLRKLQLSN
FT                   RNELTLWAADRHIV"
FT   gene            complement(509389..510849)
FT                   /locus_tag="Balac_0430"
FT   CDS_pept        complement(509389..510849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0430"
FT                   /product="histidine kinase sensor of two component system"
FT                   /note="COG1983 Putative stress-responsive transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45811"
FT                   /protein_id="ACS45811.1"
FT                   /translation="MSQIPEHLAPPLLPAKLPLLRPKQGRVIAGVARGISMHLGVSVAL
FT                   VRIVFVLLACWFGVGALAYVALWIAIPEGNPVAEAARLRGTHSSRNAPLARGNASVGES
FT                   ESPLFVSQTLDSAQDAWYAYTGLEQSTDSPSAKDSVRRTLANASKPAIFAGIGVVLIAL
FT                   PSGLNAVMRFSGSQMLPIVPCLAGMGLPWLNTRARNGQAWLTLVGEGLIFTAFLVFVAQ
FT                   TVARNGAVPFGSAIACGFALLVAAICALIPLLMTLIRNIWQERALKEREEERADMTAHL
FT                   HDGVLQTLALIQLHADDEQQVFTLARSQERELRSWLYQERTTSDRSVSAGLQEIAAQVE
FT                   DTHGKPIEVVTVGDARPSAQTDALLDAARQAMVNAVTHGGEPVSVYCEADRHQVEVFVR
FT                   DHGNGFDIDDIPPERLGIRESIIGRVRRRGGTVEIVSRPDWGTEVRMHMPLEAGFDSSR
FT                   TSDSPTDRPAQSGDPIRPAQSTQSTQST"
FT   gene            510963..513050
FT                   /locus_tag="Balac_0431"
FT   CDS_pept        510963..513050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0431"
FT                   /product="hypothetical protein"
FT                   /note="COG1983 Putative stress-responsive transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45812"
FT                   /protein_id="ACS45812.1"
FT                   /translation="MGNANHNPQQPQGETLGNGQSAGQYGQPGQGQYSHTSYNANTTYN
FT                   TDYENGRPTPNANNGGERPESSFFRWIRESGVQRTNNRVIAGVCGAIAQELGWNVTLVR
FT                   VLMVVLAFMGGTGVFFYGLAWALLPDESDGSILLEDLIHGHWNWSFIGVILCILLSGVL
FT                   VVPFFGFHGAVNVMPILLSALAMYLVIDHGRRRFMRPNSMNGGIGGNGGNTGGYGGPAP
FT                   APPMPPMPNVGERAAGPSMPAQQPGAYPNAARYGMPAAAPQNSGYTQYAQPAQPFRGER
FT                   PNVTQPESQSPAQQSADAGTPTVNMPPVAAGSASAQAFRPAQPQSASQSAYHYTYHYEP
FT                   KDYTYEYRGATKARRKPAGPAVVLLFLGLLIAGMAVVSLICGSAGNGSFSTLFGASRGA
FT                   VLFIGGACLVLGLIIVALGCAGRRTGGLHPFAWTLMFLAVIAMCFGGAVGAANSLSPYL
FT                   AKDYKHVNVGKTLVIDSSKASMETLRKGIAVQGEGYAKSTLTIDLTKYTGHNKAKQVRL
FT                   NDGQTRTTYCPVETIPMTVTDAKVMVKIPYGCSWGFNVSSGMMSTWNSIDAQGGLLATG
FT                   VCSEGDRGNGWDIQAGRSGFQISGAHPDGNGISSWYSMTGDMNELCENVGVDDDMNHAV
FT                   TKNTDPRVKQLAENGYYWPCLTDNAKSVAHTELNISPRLLRNASVTVSYGGDIADAAKK
FT                   H"
FT   gene            513067..513711
FT                   /locus_tag="Balac_0432"
FT   CDS_pept        513067..513711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45813"
FT                   /protein_id="ACS45813.1"
FT                   /translation="MKKQSDSNDAQTPYDDEATEVFAAEGPLDETVGIDERVDLTSTTQ
FT                   MPAADATAPVDMNAPLYAQFAGDTDADSGLGNDGGSDDGGANASSAEPGGEPVGDDLTI
FT                   PMQTTDASHQASTGEGAPRNIPLYQAPPQCKPEPERPKGASAGTIVFGVVVLLFGALTV
FT                   TVGLLMNSSMFSFVEFNRITGYLFAGLGILLSLIAIVMGVSSHWRNKNRGA"
FT   gene            514002..515201
FT                   /locus_tag="Balac_0433"
FT   CDS_pept        514002..515201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0433"
FT                   /product="cystathionine beta-lyase"
FT                   /note="COG0626 Cystathionine
FT                   beta-lyases/cystathioninegamma-synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45814"
FT                   /protein_id="ACS45814.1"
FT                   /translation="MTQLNTKLVHGVPVTDNATGAVNPPIYNSSTYAFESVGSMPRWDY
FT                   ARSGNPTRDFLERQIAQLEHGVRGFAFASGLAAIHAVLSIFAPGERIVVGSNIYGGTYS
FT                   LFNEHFNRWGLVSYPVDTQDLRELEHAIGGHGEQAPAKAVYFETLTNPLLQVNDVHAIA
FT                   EIAHKYGAIVIVDNTFVTPYLQQPLDLGADIVIHSATKYLAGHSDVVAGLVAVANDILA
FT                   ARVYYSQNRLGGVLAPAECDAVRRGIQTLALRLERQQENALAVARHLDEHAAVARVHYP
FT                   GLHGEAVASKGLRGAGGVLSFEVREGVNPADVLNNLQTFRLAVSLGAVESLAEYPARMT
FT                   HFELPRSERLKVGVTDELIRLAVGIEDVRDLIEDLDQALAIATGHAQAPQSLELASLFR
FT                   "
FT   gene            515248..515949
FT                   /locus_tag="Balac_0434"
FT   CDS_pept        515248..515949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0434"
FT                   /product="cysteine synthase"
FT                   /note="COG2873 O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45815"
FT                   /protein_id="ACS45815.1"
FT                   /translation="MAHFSTLAIHAGYDSADCTNGDAAVPPIYLSAAFDMQSAAHGDAL
FT                   SAGAAEGFSYSRMANPTLDVLERRIAALEGGRSAVAFASGMTAVSAALLCAAEGGGRII
FT                   AARNLYGASVDAMDSLFPEFGIETDFVDDINDLALVESLIGPDTRAIFAGSVANPSTEV
FT                   ADVAALASVAHRHGIPLIIDNTVPTPYLFRPIELGADVVVHSTTNSKWMAAVSRSRGFS
FT                   MAPTCSPMCRT"
FT   gene            515925..516122
FT                   /locus_tag="Balac_0435"
FT   CDS_pept        515925..516122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0435"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /note="COG2873 O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45816"
FT                   /protein_id="ACS45816.1"
FT                   /translation="MFTYVPNIGDARSLIVDPARITHREVSPEFRRMSGVDDNLIRLSI
FT                   GLEDTADLIADLEQAIRRAY"
FT   gene            complement(516189..516262)
FT                   /locus_tag="Balac_0436"
FT   tRNA            complement(516189..516262)
FT                   /locus_tag="Balac_0436"
FT                   /product="tRNA-Pro"
FT   gene            516537..518153
FT                   /gene="lysS"
FT                   /locus_tag="Balac_0437"
FT   CDS_pept        516537..518153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="Balac_0437"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="COG1190 Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45817"
FT                   /protein_id="ACS45817.1"
FT                   /translation="MAAPEMSTVERAEMLLNQDEAIFKRVQEGASLDEAVDPSNKEFGP
FT                   LAHPEQVQTRVAKRAMMIKDGINPYPVNLDVTTTIDAVRVKYDGKLEAGAETDDIVGVA
FT                   GRVLFIRNAGGLCFVQLAAGDGTTIQAMLSKKQIGADSLKQFKQLVDLGDHLFVKGRVI
FT                   ASKTGELSIFADEWAIAAKALQPLPTLHKELNEDTRTRKPYIGMIADEKIRNMVRNRSR
FT                   AVASLRRTFDEHGFLEVETPMLQTIHGGAAARPFTTHMNAFDLDLYLRIAPELFLKRCL
FT                   VGGIEKVFEINRDFRNEGVDATHAPEFTMVEAYEAYGNYDTIAKLVKELIQKTAIDVFG
FT                   STKVTLLDGTEYDFGGEWKTMSMYDSLSEALGQQITPETSVEELGAIADRLGVERDEVE
FT                   NHGKLVEHLWEHFYEDKLYEPTFVRDFPVETSPLVKAHRSKPGVVEKWDLYVRGFELAT
FT                   GYSELNDPIVQRERFVAQAKDALAGDEEACDIDEDFLEALGVGMPPAGGMGMGIDRLLI
FT                   ALTGATIRETITFPLVKPLNN"
FT   gene            518304..519365
FT                   /locus_tag="Balac_0438"
FT   CDS_pept        518304..519365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45818"
FT                   /protein_id="ACS45818.1"
FT                   /translation="MNPNENNGAQPSNDLPPYAQPTPAPQPAQGSPSPQGQQPAYANAQ
FT                   SAPQQPQSVSQTPHDAPQFAQNTPQGAPAGTTTVDMKESVNKFADALGKQHLKIGNHEV
FT                   AYGNLVTVVGALLAIIGVFLPFASISAFGVSMSVSLMPHGDGWILLIGAVVIAVLAVLR
FT                   QEIAALTVTIIYTLLVIYEIAAAGSKISQSGYGTLLQLSYGAGMWLLIIAIIVMLIGTI
FT                   FAFYNKQRAKNAQNGAPAMPVQNPAYDASYQDNGWQFGVPAQSDPSNVDNSQWQFGVEN
FT                   PPADAGVQQGTPVAPAPNAAAPVPPAVAHEPFNAAPDASATPAAPAAPAAPAAPAQPTI
FT                   PPASQDPDSQDAQ"
FT   gene            519670..519783
FT                   /locus_tag="Balac_0439"
FT   CDS_pept        519670..519783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45819"
FT                   /protein_id="ACS45819.1"
FT                   /translation="MFDGRISRFGAFWPFGAPATDMNQVVQIVGKASVANA"
FT   gene            520131..521486
FT                   /locus_tag="Balac_0440"
FT   CDS_pept        520131..521486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45820"
FT                   /protein_id="ACS45820.1"
FT                   /translation="MALTSEQQQIVDKATLTRINGWQYLTVEGSPYEIGFEHGYLLTDE
FT                   FKDAIRVYTHMTLETLGMDYSFFVDQAVKLHKDKIPQEYIEEMQGMADGFTAGGFETSL
FT                   DDVIGWNDWMELTGYWWPQVAAEYSNNPPDGPKGSHCSGFVATGSATKDGKPVIAHESF
FT                   DDFWSGQYFNVCESVKPAHGNSFKMQTVPGYIDSMTDFYVTSAGLAITETTIAGFVGYD
FT                   VDGIPEFVRARKATQYANSIDEWVTIVNEGNNGGYANIWLLADANTNEIARYEQGLKHQ
FT                   ELLRTKDGSFYGCNACHNPRIRNLECVDNGYNDTRQQTGARRARFEQLLPQLHGTIDDD
FT                   VAKRILADKFDPYLGYVNASSRNICAHYDVDPQYYADDPHGVWNVPFFPGGSCDGKCAN
FT                   GDDIKALHMWGIFGRADGEPFDADEFMRQHPQWSWQKGYLYDRPSQPWTLFD"
FT   gene            521697..523055
FT                   /locus_tag="Balac_0441"
FT   CDS_pept        521697..523055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0441"
FT                   /product="aminopeptidase C"
FT                   /note="COG3579 Aminopeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45821"
FT                   /protein_id="ACS45821.1"
FT                   /translation="MELTKQDLSQMAEAYKKDAAQQIAEQAVKNNGIHASSEREHVVVT
FT                   ENNFVFSVDVDSEAVANQRQSGRCWMFSALNFLRFHMEKSLKLPKGSFQLSQNYNFFYD
FT                   KLEKSNFFMENIIKYAGSDLNDRRVDFLLATPQQDGGDFDPICALIEKYGVVPLEAMPD
FT                   TAVTKNTSEFNAVLNRVLREDAFKLRKLVREGKSEKEVDDARRAMLSEIYRILCVSFGE
FT                   PPKTVDFEYRDTDKKYHADRGLTPLEFYKKYLGDVKLEDYVGVMNLPVEGMEYGKMYTI
FT                   DMTGEVLGSKRKLHYVNVPIDVMKEATIKQLKAGEPVWFGCDVLQDSDFVKGILSLNLY
FT                   DVQKMFGIKFDMDKGERFQYNQSLPTHAMTMAGVDLDADGKPIRWKVENSWGTTAHGKP
FT                   VGHQGYFIMDDSWFDQYMYEVAVRKEYLPEEYQKALETEPEVLPYWNTFNPEP"
FT   gene            523159..525282
FT                   /locus_tag="Balac_0442"
FT   CDS_pept        523159..525282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0442"
FT                   /product="hypothetical protein"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45822"
FT                   /protein_id="ACS45822.1"
FT                   /translation="MSDKTKSKSGAIVKGAKGSTGNLTTIALIMMNVTVIAGLANDVQQ
FT                   SFYGLSSVTFFLLGGLLFFLPTGLVAAELASGWSQRGGIFRWVGEGIGVFPAVSCLLIL
FT                   WFQTTFTFGSGIPSMSATIGFFTTKYDWAVDFAKNSHTWKVTLPIMIGWLAYYWFCCFL
FT                   ATKGVKTFSKIAQYGVILGTFLPLGVMTILAVVWLCQGHTPAIDMAPSALVPKWEGMST
FT                   LALAAGVFFSFAGIDMNAAHIKDLKKPNKQFPLAIFVSMILALLIFIVGTLIIAMVIPN
FT                   KQINLLYTLFATYRALGATIGFPDLYLVFCWLGMLNSFAALITNLAGPSYMLGQAGRSG
FT                   FLPKFLQNNNKHGMPSRLMYMQMALMTIIAFIVFLLPNVEGFVALITQAITILYLTYYV
FT                   LMFVAFLRLRYQQPNRPRGFKVPGGMFGAWLVAGIGILASVFGIVLAFYPPAQLAAEVG
FT                   SGATYDLIIIGLLAFVFIACVLIYRASRKHDWADPTNQFAPFTWQIEGLKKPSKALSNI
FT                   PTALLSEGQNPMGLPIKKHYDKDEMMKELPTGKDPKQGEVAAALLKKQGITEPSEPAKV
FT                   ALVGDPTVGVKTVSYEPEPVHTNESGDMIPQPTAADVSAAPVPTDAAADARRAEAEAKI
FT                   ASQDAHEYHNEAVALTDEAKDDATLSQDAHHVQVDEAEAHEAQAAVKSIDSINADQAVD
FT                   PTKPEDDPSQPKH"
FT   gene            525400..526893
FT                   /locus_tag="Balac_0443"
FT   CDS_pept        525400..526893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0443"
FT                   /product="carboxypeptidase C"
FT                   /note="COG2939 Carboxypeptidase C (cathepsin A)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45823"
FT                   /protein_id="ACS45823.1"
FT                   /translation="MADNTEAIKNEAGNGEQKKPLEPLPQTATKQYTWTGADGTKINYT
FT                   ATAEMIPVRANDGQLIGHMFMFSQVSDQEDKSDRPVTFCWNGGPGGASYMVNIGGMGAK
FT                   RVKTDGMAHLKGVGEVEDNPYSLLPSSDLVFIDAFGTGYSHVDPNYDAKKVWGVDGDGD
FT                   AFTRGIIAWLTKYDRMNSPHYLYGESYGTMRNAVVYRMLGEHGVGVAGITEQSTILDYE
FT                   PTLSGEDDYYMGMFPVYAATANYFKKAGVGVDQYEWYDKAFDYANNTLARALTLADALP
FT                   ADEMKKIAGEMSEFIGLPADFIEEKGLRIELDTFRKNLLKAEGETTGRYDTRFTTYGYQ
FT                   DVQGDNEFFAGEDPSYDAINAAYLDVYMKMLGDMGFKGYENYEGLSLKVNSSWNWTHQA
FT                   PGTMGSPQVPNVAYDLATALRRNPTSRICVLGGIHDAATPYWNVRHDINKLFLPQALKD
FT                   RIEYHLHSNGHMLYCDEVALAATGPELAAFYDKRHEDKD"
FT   gene            527102..528631
FT                   /locus_tag="Balac_0444"
FT   CDS_pept        527102..528631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0444"
FT                   /product="amino acid transporter"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45824"
FT                   /protein_id="ACS45824.1"
FT                   /translation="MTAATKSQGTPAPNNTGAGGPVTVKRTLSVFDLVVFGMIFMVPIA
FT                   PFSILASVANTSHGMPALAYVIAMVAMLFTAFSFDLMVPRYPSSGSIFVYASDEINGPV
FT                   GFVVGWLMLLQYLITPAVMLIMAGLAIHEYVPAVPVWAWCLIFLAIITVIAMRGAGATV
FT                   MVDKLALVAELIVLLLFFIFGVIYVAKNPSVAHFSFEGFYNPGHFEMGAVMSAVSLCAL
FT                   SFVGFGSVVTLDDQSLDPKHGPSRAMIVIVLILGALYMAMSLLTMCMDPSGKLMAANPN
FT                   NGFYLVAGLAGKWLGVLCAVANALALGIFTSLSGMTAGASLLRVMAKDDALPSVFAKIS
FT                   PKTRVATVATGFVAVLTLALIFIVLPIGMTTGAKISNYGALSTYFMLNIAVIWGLGIKA
FT                   KILEHGKFWRTIIFPLIGAIVTGVIFCSLGGEVLIVGTVWLVLGIIFYYVWTKALHHTP
FT                   DLLSDSRAKGETKAQRIARNAQADAHAKQVAQNVLDQQTAADSMSNESSKA"
FT   gene            528747..529790
FT                   /locus_tag="Balac_0445"
FT   CDS_pept        528747..529790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0445"
FT                   /product="1,4-dihydroxy-2-naphthoateoctaprenyl transferase"
FT                   /note="COG1575 1,4-dihydroxy-2-naphthoateoctaprenyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45825"
FT                   /protein_id="ACS45825.1"
FT                   /translation="MRIPTLMLGIAPVLIGVSAACRVIGMRGADGLPACGILTASSACD
FT                   AGTGRIITLGLLCLLVALFLQIAVNFANDYSDGVRGTDAHRTAAVRQYTVESDFQFLEN
FT                   GATAEEERQARELNGPTRLVAGGVTPRAVLMAAIVNAVLACVCGLAVIVITGYWWLVFV
FT                   GALCVTAAWFYVGGSHPYGYFGFGELAAFVFFGPVAALGTQFVLCGQVNGNGVYGAVVI
FT                   GAVSAAVMAVNNLRDVNTDRESGKRTLAVRIGARAFTVCLCVLIALVMLAMVIPWSVMW
FT                   IHMDSDLPNLSVLGGYCAVLGEIALILLTVVVEFNVAKREYRSAMRNLSWIALAVALVF
FT                   VGLTMSI"
FT   gene            529888..530628
FT                   /locus_tag="Balac_0446"
FT   CDS_pept        529888..530628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0446"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase"
FT                   /note="COG0588 Phosphoglycerate mutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45826"
FT                   /protein_id="ACS45826.1"
FT                   /translation="MTYKLVLLRHGQSEWNKTNQFTGWVDVPLTEKGREEAKNGGKLMK
FT                   DKGVLPDIVFTSLLRRAINTANIALDEADRLWIPVKRDWRLNERHYGALQGKNKTEIRE
FT                   EYGDEKFMLWRRSYGTPPPEIDPNDQYAQNNDPRYAGDPVPEAECLADVVARVEPYWEA
FT                   EIIPELKSGKTVLIAAHGNSLRAIVKMLDGLTEEEIAKVNIPTAIPLVYELDENFKPIK
FT                   KGGEYLDPEAAAAGAAAVAAQGQK"
FT   gene            531276..533402
FT                   /locus_tag="Balac_0447"
FT   CDS_pept        531276..533402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0447"
FT                   /product="myosin-crossreactive antigen"
FT                   /note="COG4716 Myosin-crossreactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45827"
FT                   /protein_id="ACS45827.1"
FT                   /translation="MYYSAGNFEAFAHPKKPEGLENKSAYIIGTGLAALTAAFYLVRDA
FT                   QMPGKNIHVFDKDVVPGGALDGAFIKGEGYVMRGGREMDNHFEVMWDVYRDVPSIEDPN
FT                   VSMLDHYYWLNKEDPNYSKCRATKARGHNAHTDNKFNLSDKGCMEILKLYLASEDELAN
FT                   KKITDYFDDEVLNSNFWLYWRTMFAFENWDSALEMHRYIHRFIHHIGGLPDFSALRFTR
FT                   YNQYESMILPLMNYLKAHDVQFHMGTAVDDVTFAISDHENGPVRNVFTNVSMDEAQRAQ
FT                   AENGAFPRNPYSTPNKKVAKTLVITDLVKNERKTIELTEDDFVFITNGGLVESTTEGDQ
FT                   NTPAGFDPTLKPGNGWDMWNRIAAVDPSFGHPEKFIYDPNLTKWMSATATTLDDTIPAY
FT                   IEKITGRSPFGGHTVTGGIVTVEDSNWLMSWTVNRQQQFRNQPKDMISAWIYGLFPDKP
FT                   GNYIRKPMQDCTGMEICEEWLYHMGVPEEQIEELAKNHCNTVPVMMPYVDAFFMPRELG
FT                   DRPDVVPDGAVNFAFIGQFAEEPRDTIFTTEYSMRTGMEAVYTLCDVDRGVPEVWNSEY
FT                   DVRDMLNAAVKLRDGQPLTTFGRNNVERKAIAFALGRTRGTYIYDMLKVYGAIADPKHP
FT                   VDMKPGMRFDESFNEADEQRLMQHAKEAEAEAFATPCSADAPVAADTVDTVDTVAPAAA
FT                   PDGALEPGENDSAK"
FT   misc_feature    533399..534396
FT                   /note="potential frameshift: common BLAST
FT                   hit:gi|184154213|ref|YP_001842554.1| oxidoreductase"
FT   gene            complement(534589..535959)
FT                   /locus_tag="Balac_0448"
FT   CDS_pept        complement(534589..535959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0448"
FT                   /product="mannose-6-phosphate isomerase ManA"
FT                   /note="COG1482 Phosphomannose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45828"
FT                   /protein_id="ACS45828.1"
FT                   /translation="MYAIRPVPKHYAWGSHRTLQHVFHLDEHETQQPLAEMWFSGHAQS
FT                   PSPIMVDGVEQPLTSMIERNPIDMVGRRGSEEFGPVLPYLFKLICATEPLSLQVHPVAF
FT                   QARAGFNEENRAGIPLNAPERSFKDINAKSEMVVALEPFLAAVGFSTRTFALRNLELLR
FT                   LPVAQRMVEALNSTATQSAGESFVMADEMMPIASAVWSPARKRLFRAFHAAITAQETDP
FT                   QELLDDLQHARSLTEHTRNDLAFDFAIRAAKAFPGDTSSLALLMMNPVRLEEGQSVFLP
FT                   TGTPHAYIYGTAAEIMTNSDNVLRAGLTVKHKDIVNLLQCLDCRTSTPVDPSNSQIATM
FT                   LMRDLAFYKPNVSEYMLAYGQVDVQHEPWPVINALAKRYDSLVRQISGHTPFPHSGPRV
FT                   VVCTQGSVQVISEADSRVLHQGDAVFVPASDGWAHVEAVIDGEGEPQGKYLVASTPF"
FT   gene            complement(536294..537682)
FT                   /locus_tag="Balac_0449"
FT   CDS_pept        complement(536294..537682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0449"
FT                   /product="Signal transduction histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45829"
FT                   /protein_id="ACS45829.1"
FT                   /translation="MPQFTTTVIAVAFILLAVGAVIGLLVLLYDWLAPLISRTTHGVSL
FT                   PDSIGDLVSRLRRRRSRDDEDGDDDDDDELDDEAAALLSILPAASIVVDDSDDVVRANP
FT                   AAYRLGIVNDDVIVDSRVLDAVRKVREHGGKTSLEITTSTPKRFALPEPVDTEEDLKTS
FT                   TVSRPNWLKLVIGRIDEQFVVVLIDDISESVRFSQMRDDFVTNVSEMIIRPSEDLQRLA
FT                   DVLEHGGMSPEQVAQAARDVRRSSAYVDHMVKNLLLLIKAQGDAPNAQSAVLDVREQVE
FT                   VAVNELLPQARQRGITVSITGKGEPKVRGNATAIRAAIGKLVDNAIEYSPDNANVSVLI
FT                   ETTRDTKDALVRVVDRGTGIPLKEQPRIFERFYRGANQNERTQSGVGLGLAIVKHVAIM
FT                   HHGNVQVWSRPGQGSTFSLVLPLVPESAEEAGEISRRRADGNRDGENAPTQAMRNQSTR
FT                   HTSR"
FT   gene            537852..538532
FT                   /locus_tag="Balac_0450"
FT   CDS_pept        537852..538532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0450"
FT                   /product="response regulator of two-component system"
FT                   /note="COG0704 Phosphate uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45830"
FT                   /protein_id="ACS45830.1"
FT                   /translation="MRVIFNEGLKAVADDLDHMARDVRDAIRLAGEALLHQDLDAAQTV
FT                   IDNDASIDDLSTRIMDQCVELLARQNPVATDLRVIVSTMRLATTFERMGDLARHIAESA
FT                   RRTYPNSPVPQNLVPTFAKMQQFLDITGGRLVDMLADRDTAIAEQIIRDDDQLDDLHLK
FT                   IMQYADSAEWEGTNEQLINVVLIARFMERLGDHAVSAARRVVFIVSGFDPTKTPSRDEG
FT                   TDID"
FT   gene            complement(538689..539801)
FT                   /locus_tag="Balac_0451"
FT   CDS_pept        complement(538689..539801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0451"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="COG1932 Phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45831"
FT                   /protein_id="ACS45831.1"
FT                   /translation="MLPADGRFGSGPTKIRREQILDLTNAADTLLGTSHRQRPVKQLVE
FT                   SIREGLAEFFSLPAGYEVVLGNGGASAFWDVVCCSLVSRKAACGVYGSFTKKMAASLSS
FT                   APFLEEPAIYEGDFGTWRLPELTDGVDAYCWAQNETSTGVAAPVKRIAGSVNQGALTII
FT                   DATSGAGALPVDLSQTDAYYFSPQKAFGSEGGLWVAILSPEAIERAEAVKENAAVPGSI
FT                   RWIPPFLSLTSAISNSRKNQTLNTPAISTLVLMESQIRYLNGNGGLDWAVKRCERSANT
FT                   VYSWAEASRYASPYVVDEEARSHAVVTVDLIDAVPAAAVLEALRDNGIVDVNGYRALGR
FT                   NQLRIGVFPSVDPSDVEALTHCIDYVIEHL"
FT   gene            540165..541190
FT                   /locus_tag="Balac_0452"
FT   CDS_pept        540165..541190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0452"
FT                   /product="Surface antigen protein"
FT                   /note="COG3942 Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45832"
FT                   /protein_id="ACS45832.1"
FT                   /translation="MRHAAPKAHKGLGAKSLTNSLFASRTGSHSAQGVRAKQAAAGDAQ
FT                   ALAIDEDLAAKLNEVAPLTRKAIRQTAKAAQRKHNILTSVSLATLVGTAATSMAFMKGE
FT                   GSTVLAAEDPTETTQVHRIADGSASRSDTREALDSATASSETATATSEVSSSSAKVNVT
FT                   IDNGKTVSTTNAGKWGLGGDNSIADSNALSRALANNPKVADLMDEHQGQLPQGFDANHE
FT                   TGDRGNAYPYGQCTWWAYERRAQLGLNTGSHFGNAGSWAVSAGSMGYWVDNTPRNTGDA
FT                   LVFSPGQEGASGVYGHVAVVEKVNPDGSIEISESNVQGVGVISHRTFTSAQARNFQYIH
FT                   F"
FT   gene            541388..541546
FT                   /locus_tag="Balac_0453"
FT   CDS_pept        541388..541546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45833"
FT                   /protein_id="ACS45833.1"
FT                   /translation="MTKPVERIRLHDGHERGLAQWQSVARIGIFQIQGMLDKICPLRAI
FT                   CEENFII"
FT   gene            541661..542470
FT                   /locus_tag="Balac_0454"
FT   CDS_pept        541661..542470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0454"
FT                   /product="Cell wall-associated hydrolase"
FT                   /note="COG0791 Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45834"
FT                   /protein_id="ACS45834.1"
FT                   /translation="MKRSISIATAVVAASLAFTSIAPAATAADSQSGSNYVVSTRSFPK
FT                   VNVAKANFFAEATSTEVDKDSNWGGLGSMDVPQTKSTAEKEAEARAQAEKEGAEQRAQE
FT                   EAAAKAAREQAAAASRGQARESLTDTNANTAQQEAAPAAQPAAAPSVPTSKNGAAIAAY
FT                   AQKFIGAPYVSGGTTPSGWDCSGFVMYVFSRFGINLPRTSGAQAGVGTAVPSLAEAQPG
FT                   DIIANANHAAIYIGNGMIVNALNPAQGTQVTNLSAFGGAAYSIRRVL"
FT   gene            542964..544019
FT                   /locus_tag="Balac_0455"
FT   CDS_pept        542964..544019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0455"
FT                   /product="Universal stress protein"
FT                   /note="COG0589 Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45835"
FT                   /protein_id="ACS45835.1"
FT                   /translation="MNDNTILVGVDGSHASYKATWWAANYAKHMGLSLQIVCAYSLPSY
FT                   AAVSFDATYTSMGDDNAAHNDAQEILSKAKAIADEQGVNAQTLIVTGDPSSVFVELSRN
FT                   YNLIVIGNRGKGGLAERLLGTTSSSLPAYAYCPIVVVPYTDDKDNLLHLNNVITKVAVG
FT                   SDDTKWGLRALQIAADFAANWGAELDVITVVPGNTNLDDPAQKQKFEDVLDARLESICT
FT                   THPDLKIRKSIVAGRAVETLTKASHTHDIVVVGSCGRGGLTGLLFNSTSQGLLQHSASP
FT                   VYVVPRKFVEAEEQRVKTGTASGTETAEVTSLEEFVREVPVERASEETERQIEIDIDPK
FT                   AHEYRQDDNEQ"
FT   gene            complement(544108..544521)
FT                   /locus_tag="Balac_0456"
FT   CDS_pept        complement(544108..544521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0456"
FT                   /product="Hypothetical redox protein"
FT                   /note="COG1765 Predicted redox protein, regulator of
FT                   disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45836"
FT                   /protein_id="ACS45836.1"
FT                   /translation="MSKRIWVERNKDGSWDAFSDDGAHIKFGKGRGQFTPGDLMKIALA
FT                   GCAALSSNFAIESTLGEGKGAKIVVDGTYDADNDSYINFNETLMIDATDADLSPEDVEK
FT                   LKKRVRAHVDKGCTVKHTYEQVTPVRMDIEVRS"
FT   gene            544655..545527
FT                   /gene="thyA"
FT                   /locus_tag="Balac_0457"
FT   CDS_pept        544655..545527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="Balac_0457"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="COG0207 Thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45837"
FT                   /protein_id="ACS45837.1"
FT                   /translation="MPLIQEQLQAIRTQIPPRPDTDIPMPYEDLLRKILMEGNLKNDRT
FT                   GTGTISLFGQQMRFDLAKGFPLLTTKRVFFKGIAYELLWFLKGSSNVHWLQEHNVHIWD
FT                   EWADENGDLGPVYGVQWRSWPAPTADDPDRTIDQISNVLELIKHNPDSRRMVVTAWNPA
FT                   EVENMALPPCHALFQFYVADGRLSCQLYQRSCDMFLGVPFNIASYSLLTMMMAQQAGLE
FT                   PGEFVWTGGDCHIYDNHVEQVLEQLSREPYPYPRMEIRKADSLFDYQYSNFHIADYRYH
FT                   PTIKAPIAV"
FT   gene            545653..546336
FT                   /locus_tag="Balac_0458"
FT   CDS_pept        545653..546336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0458"
FT                   /product="dihydrofolate reductase"
FT                   /note="COG0262 Dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45838"
FT                   /protein_id="ACS45838.1"
FT                   /translation="MESGSSRSGYHEPVPGSAGPEVFEDDWGDDFPKTFSVNLIWAQAN
FT                   DKEGRSGAIGYEGEMPWHLPEDLKRFKELTVSHPVIMGRKTWEALNEKFRPLPNRDNIV
FT                   LSRDRDFRAPGATVVDNLEEALDMARQEAIPDDGLDRSEIWVIGGSQLFNQMLPMASKI
FT                   YMTQVDAKVNADAYAPDLTEALNNGSWKLMENSGWLTPKKPEGIDRYRYLTFERNTGDE
FT                   QAEEE"
FT   gene            546371..546907
FT                   /locus_tag="Balac_0459"
FT   CDS_pept        546371..546907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0459"
FT                   /product="low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /note="COG0394 Protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45839"
FT                   /protein_id="ACS45839.1"
FT                   /translation="MGTKPQPYTVMTVCTGNICRSPMAEIILRHEFEERGLGDRARVES
FT                   SGVSSEEHGNPIDRRAVKVLREHGYDIPPEHFAHRITPNEIAETNLFLPMTASHMGALM
FT                   HMLPLSKRSHVFMYRSFDPNLPDPQPGRESDIDLVDPWYGGQRDFEIAIDQIEEVAPYI
FT                   VDYVEKQLEAQDATR"
FT   gene            complement(547006..548016)
FT                   /locus_tag="Balac_0460"
FT   CDS_pept        complement(547006..548016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0460"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="COG1087 UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45840"
FT                   /protein_id="ACS45840.1"
FT                   /translation="MTVLVTGGCGYIGAHVVHALHEAGEDVVVVDDLSYGKPNRIGNAR
FT                   LYGMDIATPGAGERLAEIMEAENVDSVIHFAARKQVGESVEKPLWYYQQNINGMLNVLE
FT                   GMKEAGVKKLVFSSSAATYGVPPVDVVPEDVEPMVPINPYGQTKLFGEWMARACEQPYG
FT                   IRFCGLRYFNVAGCGPVQLEDPAILNLIPMLFDRLKQGKAPAIFGDDYPTPDGTCVRDY
FT                   IHVSDLADAHIAALKYLDRDERKYDVFNVGTGEGTSVRQIVDEVKKVTGLPFKETVMGR
FT                   RAGDPPHLIGSPERINTEMGWHAKYDVEDIVESAWNAWQANPDHHIDVETWKQTD"
FT   gene            548353..549198
FT                   /locus_tag="Balac_0461"
FT   CDS_pept        548353..549198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0461"
FT                   /product="tRNA (guanine-N(7--methyltransferase))"
FT                   /note="COG0220 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45841"
FT                   /protein_id="ACS45841.1"
FT                   /translation="MTEQNRNLEESGNGGAANNPLHGRKVLSFVRRSARLDARLQRALD
FT                   NYADEYILSDIALSEGSLDPCEGFVFSRDYVQGQWGNDNPLTVEIGSGQGENVVAAAAE
FT                   HPERNFLALEVYDPGVAHTVLLAGKRGLRNLRVAQINAPELFAVMEPGVLDEVWTFFPD
FT                   PWPKMRHHKRRIVQPELARDVHASLGVDGVWRIATDIEDYALHVHEVMDARRDFENLGT
FT                   LTVSLPVEHVGKGNAESAAALPHADFMESERFDGRVLTNFEKKGLAAGRVIHDFAYRAV
FT                   "
FT   gene            549316..549390
FT                   /locus_tag="Balac_0462"
FT   tRNA            549316..549390
FT                   /locus_tag="Balac_0462"
FT                   /product="tRNA-Glu"
FT   gene            complement(549808..550875)
FT                   /locus_tag="Balac_0463"
FT   CDS_pept        complement(549808..550875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0463"
FT                   /product="hypothetical protein"
FT                   /note="COG1434 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45842"
FT                   /protein_id="ACS45842.1"
FT                   /translation="MQADSAMMTLLTWCPLLVGVTFFALTMAFNRRSLWSGFSAFVMLL
FT                   GIGATSIVLLMTASQYVTGSLLGTLALIAISLVAVALLLFPFALGIFLIAEGIRLLRRE
FT                   GLSPANCLSLALGVLICSDLLVFPAIVASVHNDAVNWVFGVLSACTFYFSAQLAIYCLS
FT                   SALNLIHFGKARNIAQILVLGSGLFGETVPPLLQKRIAKGIEIQRQDPHARLILSGGQG
FT                   AGEDVPEGVAMKAWALAHGADPANTVCEERSRNTRENLLFSRNLFADPNGKTAIVSTGY
FT                   HVFRALLLSKQLHMNAVGYGSKTPWYFSLNALLREFIAYVSMTRKWQIVILVVLLTPFW
FT                   VSGVAGLVQAIQHLA"
FT   gene            551022..552017
FT                   /locus_tag="Balac_0464"
FT   CDS_pept        551022..552017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0464"
FT                   /product="putative 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45843"
FT                   /protein_id="ACS45843.1"
FT                   /translation="MGQTLDNKALVIGVASSALFDLGESDQIFREEGVEAYERYQNEHL
FT                   DEPFRPGVAFPFISKLLEFNSVFDGDDQGVEVVVLSRNSPRTGLRVMNSIEHYGLDITR
FT                   SVFRSGISPFEYMKAFDMALFLSADDADVREAVAEGFPAGCVLPLSDSGNRGDGTAAEA
FT                   THVHESGEELRVAFDFDGVLAGDSAERVFREAQVSDPANALEKYNEHEADLANRPIEEG
FT                   PLKRLLEGINILQNAAREYREANPAAQTPNLRVALVTARSGKAQKRAVNTLEDWGLTVD
FT                   DAFFLGGLNKAPFLNRMQPDIFFDDQMGNLDRYTLSIPSVHIPFGAHNGE"
FT   gene            552271..552696
FT                   /locus_tag="Balac_0465"
FT   CDS_pept        552271..552696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0465"
FT                   /product="hypothetical protein"
FT                   /note="COG3642 Mn2+-dependent serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45844"
FT                   /protein_id="ACS45844.1"
FT                   /translation="MPFLQPNDKVQAEIRDYRRLCELGIRLPAMLDIDIAKERILKEYI
FT                   DGPTVYNLVLTDQMDDSYVDQVREMAKRLQSHRLNIDYFPTNFVVENGLVYYIDFECTA
FT                   YTRERSFDGWGVTYWSKTPEFLRFVAAHAPHAPAAAQ"
FT   gene            552722..554269
FT                   /locus_tag="Balac_0466"
FT   CDS_pept        552722..554269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0466"
FT                   /product="hypothetical protein"
FT                   /note="COG3593 Predicted ATP-dependent endonuclease of the
FT                   OLD family"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45845"
FT                   /protein_id="ACS45845.1"
FT                   /translation="MRLTSLSIANHSRVTDFRIDVRRHLVLVGTNESGKSSILRCLDLV
FT                   LGKSTADLYATVTAADIREPQLPFTIAVELENDGMHTCMRFEAALDADGETVHISRTMG
FT                   DDGHVVTAADLARIGWVYLSDSFPSNRETQHEIVDELLETVQLEQEEAVFEAVADQYAR
FT                   LLHSSPALLALRKRIADALTSALPMRCNPNNLMFVPGSKLNRNPFSDVHLQLRMHGKQR
FT                   GLWEQSGGLRSIYTVALYDLLDEHVHIVGVDEPETHLHPTSQRNLARLLKEGASQKILA
FT                   THSPDIIGEFEPDQIVVVRANGGVVQPRRDFLSEDDKLLLHMWVRDRLEPLTAEHVIVV
FT                   EGVTDRALVEHCANVTGRNLDAHGVVLLEAGGCREMPAWQRVFGEHGFRVPLTQLVDED
FT                   AQGDLAHQYHVRAGELESKLVFVSHVDLEAEYIRALGVDLAYEALSQSNLFRPAETKSL
FT                   RTARQQGTLNESMLADFCRMRANKTRAVLAVLPRISAKRARRIDSVQRLLTSVIGLA"
FT   gene            554403..554765
FT                   /locus_tag="Balac_0467"
FT   CDS_pept        554403..554765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45846"
FT                   /protein_id="ACS45846.1"
FT                   /translation="MVSRTIGTRCRSLLAAVGALTLCVALGACGARHDERAAEGRSQVA
FT                   PSPTPSQTAQERTRGTDSLLSADLIEQIRQLDGNSDPQTTRSVFAGILFNGPGHESPGG
FT                   PGRGATPDATRTSRCA"
FT   gene            554756..555559
FT                   /locus_tag="Balac_0468"
FT   CDS_pept        554756..555559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0468"
FT                   /product="cutinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45847"
FT                   /protein_id="ACS45847.1"
FT                   /translation="MRVITVRGTNEQLNGGMLGPLAQQIASASPGHIQVTPLEYAASVE
FT                   PGTQADGVNLLMSTLNGQAEQCPAQHTVLLGYSQGAMVVGDALSAPDVRPNEDNGYTLS
FT                   DRASENVIVAELFGDPRFNSETSYDVGDFTKGTNGVMGARGPHELDRYASRTQSYCNYD
FT                   DPICQTYGSRKGHREYATNGLRDQAHTRRAAVNRRMRMHMRNIWRAHVRGISWNTYRCT
FT                   EREPWQAMRSSARIAGNRSPSTRRATPTSCSRCGGRNSTANSNHA"
FT   gene            555508..556920
FT                   /locus_tag="Balac_0469"
FT   CDS_pept        555508..556920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0469"
FT                   /product="hypothetical protein"
FT                   /note="COG4487 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45848"
FT                   /protein_id="ACS45848.1"
FT                   /translation="MQQVRGQEFDRELESRLKLAEDDKAKAVELARQKANSELQQAKAS
FT                   KDAEISELKAQLAAFEDRQKLAVSEAVGDVEKERDELRHEVERLKSDAESERELAKANL
FT                   EAEKAKAAAEKDVRIQQLQSQLDNVQTSKQLEIAEQVGKVERECDRLRGELSTAKMQQE
FT                   LELKSVREQYEVQLRDREDEIERLRDFKTRLSTKMVGESLERHCQDEFNKVRMGSFPNA
FT                   YFEKDNDARTGSKGDFIFRDYDGPEDDEGRTEFISIMFEMKNENETTATKHRNEDFFKE
FT                   LDKDRREKGCEYAVLVSMLEEDSDLYNQGIVDVSYRYPKMYVIRPQYFIQMITLLRNAA
FT                   RGTLEYRRELAEMRAQNIDITNFEDKLNEFKSGFERNYELASKKFQTVIDEIDKSIDHL
FT                   QKTKKALLGSEDNLRIANKKVQEVTVRRLTYKNPTMQEKFKQARAVRDEEKAIGKVPEV
FT                   GIELAEDTGVER"
FT   gene            557034..558608
FT                   /locus_tag="Balac_0470"
FT   CDS_pept        557034..558608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45849"
FT                   /protein_id="ACS45849.1"
FT                   /translation="MADVRSELAQLRPVYETGVLRMLLHKYSDIYIAMLRACFDPLTAE
FT                   VPQERLLARMREAIGELAADGTYTPREGEDDMMAARRILKELKAEDAGDYAWVADSIDR
FT                   RQHRLMCRLTQRAHRAIEALATLQQRTVSLSGAQVNSIIMEIESARKQLTVNVEERIEL
FT                   LEREIEERRHQIDNLKAHGIGQRPTREQVSDIINVVYNTLRGVPVDLRELVITERDNGD
FT                   ALRRRIDDGSMSSNDMLTFYHEEYERTYRLSDEGRRFNDAFQVMYAPQSREELNEALQD
FT                   ISNSEWLHGEADDLMSVVNREFEDIYDGIDDVRHQIRVTDESVKLLVRQQTDMQFRTMS
FT                   RQLAKLFTQLGESVHAKGRYDIGTATTSLLTLPTRARETPVKTAAPELQMQADDGIAQV
FT                   DLNGIVAAGGPRIHHMIELVAAHPVLIDDAGDALADSVVDIAASFNELPADERRESEIV
FT                   GFLSYLGSASPAGAAGNSDGGQIPVPRESLWHCVTTDGRTRVWRTCALFVPGQVLKDFL
FT                   DDTMVED"
FT   gene            558610..559419
FT                   /locus_tag="Balac_0471"
FT   CDS_pept        558610..559419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45850"
FT                   /protein_id="ACS45850.1"
FT                   /translation="MAMDDSTGQGIAGDANLGMVSKVLSAEYEEGVADEAGMADLANVH
FT                   ALFDGDIGDMPAPAREAAIALKRNRSISGDMYHQALDYMEHVRRSLNNDMLVPVIDTYY
FT                   EVMYAEPITADEYGIRSLKTRASLSAREAVMLAALRRKVLDYENVGAAAADWLISKEEI
FT                   VNTMSTGAGPLAGRNSEEAVQAQVDRLIGSAKNNGFLAPVEDDEGMYVITKLVPVVLNP
FT                   ERIAAWLGADDASTAQPEPDGTGDDSDGSGHTGQDEHPEDDDMEALF"
FT   gene            559416..562913
FT                   /locus_tag="Balac_0472"
FT   CDS_pept        559416..562913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0472"
FT                   /product="hypothetical protein"
FT                   /note="COG4913 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45851"
FT                   /protein_id="ACS45851.1"
FT                   /translation="MSETSDIYASIELMPPHWALASRQLVNWGSYDGYHVFEPSTAGND
FT                   TVTLLTGQSESGKSTLVDAQVSLLYPANAAFNKASNAGRSDRSDYSYLLGLRGIRNNNG
FT                   HDEPVYLRGRSGNGEPYAVWGAIVDHYVDTANSGALWIAKFMYLPADGAPESMVKLYVV
FT                   SGYAIDPRLMDAHREERFSVPLIKQVYPGVTVYNYAKQFHEDIWKRFGLTESACRLLHR
FT                   MQASDAPSQLDDIFRKGVLNEPRAVEFGKLAIDDYEQFAENFSSMERTRKRVRQLEAIA
FT                   SEFAEYESAERGVRELSTIAPEQGDSARIRTQWLDDRIHADITEVLPEYEQHATDCSAS
FT                   AQAAKERAEQMREQADSLNRQLQGMGGDEISRLEDRIRDAQRRQREVLGRRELLASRFS
FT                   ASGEALPESRGQWDALVAEYTQFESEYQQRKTELHGLQYPLIDAQKKAEQRTKALEKDL
FT                   ERKRQSKTRISSDMDEARNMIARATGLSPQELPYAAELMDVGEENEEWRTAMNVAYRSL
FT                   ATVILVDSCHENGFAAKVSQIPQEALPRRNWRFVDTSVHVEAEEREGWLSSKLTFNVES
FT                   PFADWLRARVTEARYDAWCVEAIDDTNETTRQVQRDGQIKEGRKGSHGTKNMPAVIGFV
FT                   TDAYLRDLEADIAEARKTRDAATRDLEQYDVQLNALEQRHSLAQTLQDHAWNDIDAYGV
FT                   EEEIASLQQRVDELEQNPELAQLNATLKVQQQEMAKANSACYAAEDKLKRANAAVRSTR
FT                   QWLEAYDRRTQSVERRPLNEACGRLLERGYLAYFGESTQSANERMGRILGLDGQSCTSL
FT                   GGHVRENEACAKHVRELLGTLAQTVGRQVKELATQRDNRKRSCEASMRSYLDQYASGDE
FT                   RVSAEVENERYFRKDLEELKPGVIGDEATNVEYMNSLDKMLQDLVQLQTMLKLDQQRIT
FT                   EQIGKINHLLERYPFGARGGRLSIVVQVHRPDAKFTTALTGQIGRINAFKANDEHDVER
FT                   CRKLFAGLAGLIEMLRGSFDEYAGNGRGNANLDPRKRSRFFGSVTNPDGVVESINSTGG
FT                   GSGGYLQELTSFAYGAALMYLLATDNATEPSYATVFLDEALIKADGQYTRRALSVLPGL
FT                   GFQVIVSAPESKTGEIMGSASKVIVARKDQASGRTTLMQGDLLGDADGDESSMGERSE"
FT   gene            562910..564130
FT                   /locus_tag="Balac_0473"
FT   CDS_pept        562910..564130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0473"
FT                   /product="hypothetical protein"
FT                   /note="COG4924 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45852"
FT                   /protein_id="ACS45852.1"
FT                   /translation="MTDTATLKTPADVRGDVARIVQRELFAAESPWPRTIHIPWPKETQ
FT                   LVADVAGVHAANNALKEFAARFGCQTDFISRKMGTAVSLVAHIHVPDEATALAIAGPTL
FT                   RRPRERVLARAAQLEQRCHVDHALAMDVVRRLNNESDVDFGLFVEAAQWFGRHWAEVPG
FT                   LTAREIPLPGFSAKWLAGSRSRRRAAICTVLGVDRLPLRERPGEVRYRYMDQRFAAEPD
FT                   RVATSVQCVPERPVSLAVIVENKDTYQAMGPIDGAVCVFGSGFAVNRVPELLPWLAGDG
FT                   VRVVYWGDIDAAGFEILSGLRASGVACESVLMDRMTYAEYERFGTTRDAASHEIRCGEP
FT                   KHGLHLSPEEYALYRDLCTGELAVPRIEQERIPIAEFMRLISAGRSDGSDGARADQCHS
FT                   QSLRTPK"
FT   gene            complement(564498..564890)
FT                   /locus_tag="Balac_0474"
FT   CDS_pept        complement(564498..564890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0474"
FT                   /product="hypothetical protein"
FT                   /note="COG3189 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45853"
FT                   /protein_id="ACS45853.1"
FT                   /translation="MHSKRHTLCVMAMIQLKRAYAPAEPDDGYRILVDRLWPRGMSKAK
FT                   EHLDLWMKQIAPSTDLRKAWNHNPNTILEFAESYRRELDANPAVEQLEQILADHPVVTF
FT                   VYGARDPLVNHARILRDYVEERQKVQ"
FT   gene            complement(565133..566650)
FT                   /gene="lacS"
FT                   /locus_tag="Balac_0475"
FT   CDS_pept        complement(565133..566650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacS"
FT                   /locus_tag="Balac_0475"
FT                   /product="galactoside symporter"
FT                   /note="COG2211 Na+/melibiose symporter and related
FT                   transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45854"
FT                   /protein_id="ACS45854.1"
FT                   /translation="MTTNKFQAGAGQTASSAASSDMLRSTTPKTARHGLIRQRAAFAFG
FT                   NLGQAAFYNAMSTFFMTYVTTALFARTDKAVAARMIALITGLVVAIRIAEIFLDPILGN
FT                   IVDNTRTKWGRFRVWQFIGGIVPSVLLVVVFTGLFGLVNVNTTWFITLFIVTFILLDVF
FT                   YSARDISYWGMIPALSSDSHERSVYTSLGTLTGSLGYNGITVVVIPIVSYFTFKFTGEQ
FT                   GEGQPGWTAFAIIVALLGLITAWTVAFGTRESSSELRKQDSHCGPLDAFKAIAHNDQLL
FT                   WTALSYLLYAIANVATTGVLFYQFTYVLGMPQRFAIAGVIPVITGLVTTPLYPLLNRVI
FT                   PRRWLFAGGMGLMILGYALFIAAPRNLSVVLVALILFYLPAQTIQMTAILTMTDSIEYG
FT                   QLKTGQRNEAVTLSVRPMLDKIAGAFSNGIVGFVAVAAGMVGSASAADMTSANIHTFTT
FT                   WAYIVPSAGIVLSLIVFLLTVRIDEKRHAQIVRELETQLADSANTER"
FT   gene            566960..570163
FT                   /gene="lacZ"
FT                   /locus_tag="Balac_0476"
FT   CDS_pept        566960..570163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="Balac_0476"
FT                   /product="LacZ"
FT                   /note="COG3250 Beta-galactosidase/beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45855"
FT                   /protein_id="ACS45855.1"
FT                   /translation="MNEETLQEVAEEKATEPPRNDVPSTDGALRSEEPTAAWLTDPRVF
FT                   AVNRLPGHTDHNCADDQSGALKQHLDGEWAVKVVPSHLDRLPTEGLDEHWQHAHLPPEF
FT                   ASRSFADGDFTRVQVPGCLEMQGLMRPQYVNIQYPWDGHENPQAPSVPTDNLVALYRRA
FT                   FTADDRVGEALSRGERVSLTFHGAATAIYVWLNGVFVGYAEDSYTPSEFDVTEALHAGE
FT                   NLLAVACFQYSSASWLEDQDCWRFHGLFRDVELEVRPHAHVRDMLAHADWNVDAQCGEL
FT                   AVELDLDGAWCAANVELRLSTWEEHADGAALLWSATVESAPKIRYATTCEQVLPWSAEQ
FT                   PNLYVLEAVVRDANGRVLETARTRIGFRHVEIRDGVLVLNGERIVFHGVNRHEFDARRG
FT                   RSVTEEDMLWDVRFMKRHNINAVRTSHYPNQTRWMELCDEYGLYVIDEANLETHGSWNL
FT                   PGDTADGVSIPGDDVRWQPACVDRVESMVRRDRNHACVVAWSLGNESYAGDVIRAMGNR
FT                   CRELDPTRPVHYEGVTWNREYDDISDFESRMYAKPDEIREYLESDPAKPYISCEFMHAM
FT                   GNSVGGLGEYVALERYPQYQGGFIWDFMDQALWQRLDDGTERLAYGGDFGDRPSDYEFS
FT                   GDGIVFADRTVSAKAQEVKAQYAGVRLEPDGRGVRVTNTNAFQGTSGTVFVARMLLDGR
FT                   EAWSKSYEFEVAAGSARSFDIGFPDVHSLPDGGVMHEVVYEVSQQLAHDTAWAEAGYEI
FT                   AWGQAVVRPHASGRSGSKMNDAFDDDNLQIVTLGRWNAGVRVGQREILLSRTHGGVISL
FT                   RDGEREYVIRVPKLLTFRPLTDNDRGMSSGFDRVQWFGAGRYARVVTGVGQVYRDELTG
FT                   DLCGEYWYELADGAQTQVPIRYRIDSQLRMHIELEYTGCAGAPSLPAFGLEWMLPKQYE
FT                   NLEFYGRGPAETYRDRKRAKLGIWNTTAQADMAPYLVPQETGNHEDVRWAYVFDADCHG
FT                   LLVEADDSLALSLLPHSSLEIENATHQNELAQPRHMFLRLLAGQMGVGGDDSWGAPVHD
FT                   RYLLPADEPLKLAVTISML"
FT   gene            complement(570266..571261)
FT                   /locus_tag="Balac_0477"
FT   CDS_pept        complement(570266..571261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0477"
FT                   /product="LacI-type transcriptional regulator"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45856"
FT                   /protein_id="ACS45856.1"
FT                   /translation="MVTRKDIAEQAGVSQSTVSRLLNGDPTLKVKADTRRRIMRTAAEL
FT                   GYRAFTSRSIAVLNVPPQFDELQDAYFQSLQTELRKVAAEQGTTLTFFDSIDSLIAHAD
FT                   DHDGFVATGPTSFQRTDLAHLRDALRYGVFIDTNPAPDWFDSVRPDLSQTMLDALDTLL
FT                   VDGYTCIGYIGGVGSIMGLHNHTEDIRSLAFSDWSKRLGLPNEQYIYADGPFTVSNGRA
FT                   LAARLLTDHPDDLPNALVIGSDPMAVGVLQAFAEAGVRVPTDIAVVSVDNLPIAQYTAP
FT                   PLSSYAIDLHELVYAALTTLTDAIARDRHVRRHVLLSTELVRRESLPSKS"
FT   gene            571695..572303
FT                   /locus_tag="Balac_0478"
FT   CDS_pept        571695..572303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0478"
FT                   /product="alpha beta hydrolase"
FT                   /note="COG1011 Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45857"
FT                   /protein_id="ACS45857.1"
FT                   /translation="MPITDVVFDYCGVLLDWRPELTMEGKVDTSTMRRLLDHADPYGFW
FT                   HYDLMSDLGWSEEQVLRDFARHHPHDVALNHAMQLYFANYTRAFAGMVDGMPELLRTLH
FT                   ERGYRLWGLTNFSTPFVTLAHREFPALRLLLDTVVSSEVRCAKPDARIYEIAMERFGID
FT                   PAHAMFFDDKYENAKAASESGMHGVQFLSADQAMQAILG"
FT   gene            complement(572430..572825)
FT                   /locus_tag="Balac_0479"
FT   CDS_pept        complement(572430..572825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45858"
FT                   /protein_id="ACS45858.1"
FT                   /translation="MAEDKTSDELTERDIEDLNDPDDNPDVADADATEHNLRRAVIICF
FT                   IVTSVMCLCINIVVLLMLQRKGKLDKAAANLDEFKENMQHLASDKSRQIARNKDVRKAM
FT                   DTISQHIREIPSEAQSAVTRVRDSLAK"
FT   gene            572972..573562
FT                   /locus_tag="Balac_0480"
FT   CDS_pept        572972..573562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45859"
FT                   /protein_id="ACS45859.1"
FT                   /translation="MRLCRAFLQYALHMTANDTLGSPYSSPDPNEHGDNPYVGDPGYSQ
FT                   VPQQAYTAQYATPQPNYTQQYPPQGAYGYPMAPVDQWNGMCIAGFICSFFFPLVGLVLS
FT                   IIALVQINKTGEKSRGMAIAGIVIGGISTALALIAIIMVICGLAIGLGALAETGWDDYE
FT                   YHYDTHSDYSQFDEVGADYLAHIRSVDQLMKTA"
FT   gene            573559..573732
FT                   /locus_tag="Balac_0481"
FT   CDS_pept        573559..573732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45860"
FT                   /protein_id="ACS45860.1"
FT                   /translation="MIFHADGITVIRETDSCGVWPKGRAPFRLRVCGLPYGIGIVHECF
FT                   GMGAECVEGGGL"
FT   gene            573742..574242
FT                   /locus_tag="Balac_0482"
FT   CDS_pept        573742..574242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45861"
FT                   /protein_id="ACS45861.1"
FT                   /translation="MTNYQPNYDSNNPYGRGLSEPPMQQEPNQTPFAQPQYGDYGAQGN
FT                   AQQPYAQPQYGQYARGSGQQYGQPDYTQNMSNYAPYGQCNQSQYGNGYSPEPTTWNGLC
FT                   IAGFVCSFLVPIVGLILSIIALTQINRTGEKSRGMAIAGIVISVVIWLFSFIFMASGNS
FT                   IFF"
FT   gene            complement(574340..575683)
FT                   /locus_tag="Balac_0483"
FT   CDS_pept        complement(574340..575683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0483"
FT                   /product="MalE-type ABC sugar transport system periplasmic
FT                   component"
FT                   /note="COG1653 ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45862"
FT                   /protein_id="ACS45862.1"
FT                   /translation="MKFSTRAIAFLGATAMLIPLAACGGGSSNSGQPSQESNVKEIDVW
FT                   AWDPSLKQIAADYEKKTGIKVNLKNVGTNTKEYTQLDNAIEAGSGAPDVAQIEYYALPQ
FT                   YAIKGNLLDITDKTSGYEDFYNPGPWSSVQIDGKVYALPIDAGPMAFFYNKEIFDKAGV
FT                   DGEKIKTWDDYYEAAKKIHALGDEYYITSDSGDAGFFDSMTWLAGGKPFQTTNNGKDVT
FT                   INLTGDNGVKEFEKFWQKLLDEKLLDTKTVGWSEDWFKGMQDGTIASLLTGAWMPGNLV
FT                   NSAPAAAGKWRVALMPTPNGEKANAENGGSSLAVLKSSPKAQAAYDFIEYVAHGDGVKT
FT                   HVETGAFPADKASLEADYFKNATTIKNSDGKEIDYFGGQKYNEVLAQASADVLTGYQFL
FT                   PFEVKARGVFGDYLGKSYTGNQPLSEGVAAWQKALIDYGKEQGFTMKE"
FT   gene            complement(575929..578016)
FT                   /locus_tag="Balac_0484"
FT   CDS_pept        complement(575929..578016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0484"
FT                   /product="beta-galactosidase"
FT                   /note="COG1874 Beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45863"
FT                   /protein_id="ACS45863.1"
FT                   /translation="MSASTQHRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRL
FT                   MKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLT
FT                   SAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGN
FT                   EYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGG
FT                   EGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDW
FT                   AHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMEQSTSAVNWREINPRKE
FT                   PGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADL
FT                   DTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVT
FT                   ADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHT
FT                   EGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLAT
FT                   FEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAG
FT                   DVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFR
FT                   R"
FT   gene            complement(578058..579038)
FT                   /locus_tag="Balac_0485"
FT   CDS_pept        complement(578058..579038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0485"
FT                   /product="sugar ABC transporter permease"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45864"
FT                   /protein_id="ACS45864.1"
FT                   /translation="MTTTVSTDIQNTRNARRIERDRQRRIAQDERAERKRSRKNGFTNV
FT                   ANPRKSTLLTIVCAVFAIYCLFPFLYILINSTKTQADFTSTFGLGFGKTFALWDNIKTV
FT                   FTYQDGIFGRWFLNTLFYVIVGAGGATLLAIMGGYALAKFRFPGRKAVFAVIIGAISVP
FT                   GIALAVPQFLLFAKLGLTNTPWAMIIPSLISPFGLYLMWIFSEQAVPTELLEAARVDGA
FT                   SEARTFFTVALPLLSPGIVTCALFTIVATWNNYFLPLIMLKDANWYPLTIGLNQWKDQA
FT                   STAGGQAIQNLVITGSMITIIPLVVAFLLLQKYWQSGLAAGAVKE"
FT   gene            complement(579058..580026)
FT                   /locus_tag="Balac_0486"
FT   CDS_pept        complement(579058..580026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0486"
FT                   /product="MalF-type ABC sugar transport systems permease
FT                   component"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45865"
FT                   /protein_id="ACS45865.1"
FT                   /translation="MTSTTKSPGTAGTPDAAAIAANAVTTGGSARVNKHHADWRGWKFL
FT                   WPFALVFVFVFIIPILYAIYISFFQTKMIGGTQFVGFDNYIKLFHDPHFWSSVGRVTIF
FT                   TVVQVPIMLCLAALMALALDSMKLHGTKFFRISTFLPYAVPAVVSTLIWAFMYGAKYGL
FT                   VGSLNAWFGTHIDVLAPSVLLAAIGNIVTWEFTGYNMLIFYSSLSTIPHSLYEAASIDG
FT                   ASEWQIVKSIKLPELKGSLAITVIFSIIGSFQLFNEPSIMQNMVPGNTITTYYTPNMYA
FT                   YNLSFSGNQSNYAAALAIVMAIITMAIAYAVQLRSMKDQMK"
FT   gene            580313..581311
FT                   /locus_tag="Balac_0487"
FT   CDS_pept        580313..581311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0487"
FT                   /product="LacI-type transcriptional regulator"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45866"
FT                   /protein_id="ACS45866.1"
FT                   /translation="MKDVARLAGVSSQTVSRVANNSSEVKPETRLRVERAMEELGYRPN
FT                   YAARALKHGSFKDVGVVLFNMTSYGDSHILNGVVDAAREHGYATTIRSFEQGCPATLQS
FT                   AIDQMKTLPVDGVVFILEQQVADFNTFVPSVELPVVLVSEEPSDHCPTIDSDQYGTSVV
FT                   LVDYLLAKGHRNVYHIAGPSYSVAAQSRRRGWEDALRQQGIVPPSVYIGDWEADSGYQA
FT                   GLALAHERDCTAVYAANDQMAYGCILGLREAGKRVPEDVSVVGVDDSLQGIVPRLELTT
FT                   MREKFNELGREAFGMILAQCNGDKLPVGVKTVIPSVLVERGSVSEVEDRGA"
FT   gene            581502..581578
FT                   /locus_tag="Balac_0488"
FT   tRNA            581502..581578
FT                   /locus_tag="Balac_0488"
FT                   /product="tRNA-Asp"
FT   gene            581612..581688
FT                   /locus_tag="Balac_0489"
FT   tRNA            581612..581688
FT                   /locus_tag="Balac_0489"
FT                   /product="tRNA-Asp"
FT   gene            581713..581788
FT                   /locus_tag="Balac_0490"
FT   tRNA            581713..581788
FT                   /locus_tag="Balac_0490"
FT                   /product="tRNA-Phe"
FT   gene            complement(581933..582958)
FT                   /locus_tag="Balac_0491"
FT   CDS_pept        complement(581933..582958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0491"
FT                   /product="glycosyltransferase"
FT                   /note="COG0463 Glycosyl transferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45867"
FT                   /protein_id="ACS45867.1"
FT                   /translation="MLKVSIIIPAWNEKERIVDCLDNATRQTVMPHEVLVVDNRSTDHT
FT                   VEIVERYIAEHPDLPVKLLHQDEEQGLIPTRNYGLNHATGDILGRVDADCMLKPDWVEV
FT                   VRGIFTEDAEAMGATGPVTYYDMPAHKIALRGDDSVRRHTYRADGGQVLLFGSNMALRA
FT                   SAWKLIHDEVCLDKEDVMHEDIDISLHLLGRGLKTVYSGRMICGISARRMDTSFKSFRN
FT                   YMRRFKNTFAAHPEHWRNHKSERTLYLMYPWLHAMFPIYRQYLESKDINPAVRIWFREQ
FT                   AKLARKEGDPLADLPGIEKFVEETPTDIPGLEEIDENTAFDPDGAPQSEDSSITGTTTA
FT                   Q"
FT   gene            583089..584678
FT                   /locus_tag="Balac_0492"
FT   CDS_pept        583089..584678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0492"
FT                   /product="Hypothetical permease"
FT                   /note="COG0628 Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45868"
FT                   /protein_id="ACS45868.1"
FT                   /translation="MSEESKRKLDVASLFPSKGDPRRPPEWYGRALFYAVIAVYLGWFV
FT                   FTSYGKITYIVFDIVIALFLALAVEPLVIRLIRHGWKRGVASVTCLAGLLVIVIVLMAL
FT                   FGNMFVQQMISMVKGLPDLYNQFAAFVDAKTHFKLPEMNDLGGEIMKNIKGSWVTDFAG
FT                   QAVSTTMGVLGQILNLTTALMVAFYISIAGPKLRRSVCQWIAPRSQRRFLMVWTVVQDQ
FT                   ISGFLFSRSILAAINAACMSVFLMIIKVPYWLPLALFCGIVSQFVPTLGTYIGGALPVL
FT                   FAWGERGIGYAIGVVVFITVYQQIENLVLSPKISERTMDLNPCIAFLTVLFFGSIFGAA
FT                   GAFLALPITASIQVLLKVAMKRYPLVDMPLMSDPEPNKKSKMVEAADAINEHVIKPVSD
FT                   HMPRQAKGSSAHVSFDDDHIQYLREQMYGSDREDDAASGHAHSESEESPTMAIPKHLLE
FT                   RHAGEGLQHKPRRGVPGKGESQNEVDIVRKTDTAESSTPVESERTDSDGAKPSAAATTT
FT                   GTKPKNPRSQWS"
FT   gene            584678..585964
FT                   /locus_tag="Balac_0493"
FT   CDS_pept        584678..585964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0493"
FT                   /product="hypothetical protein"
FT                   /note="COG1215 Glycosyltransferases, probably involved in
FT                   cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45869"
FT                   /protein_id="ACS45869.1"
FT                   /translation="MAILDVLDLLLVIVGGVSIAYQGFCILVSLFAKPVTFPAAPMDKR
FT                   YAVLISARNEEQVVGNLIRDIQSQSYPSKLIDIWLVADNCDDGTAQLARDLGCHVVERF
FT                   NQQQVGKGYALTYLLNAMIDSKASDQYDAFFVFDADNRLDKHYFEEMNKAYQSGFRILT
FT                   SYRNSVNLSENWVSSGSALWFIRESRFVSASRMWLGNSCHVGGTGFMFSQEVMRRNQGW
FT                   KFHLLTEDLEFTMDSVLHGDRIGYVGSAILYDEQPVTFAQSWRQRLRWSKGFLQVFRYY
FT                   GPALVRRAIQERDFSSIDLTLFICPFTVLAIIRVLLGTIFAACGFISWSSQGAALFNWM
FT                   LGVVSSMVFMMVLAGLTMVVERKQIGASNRELFAYALSFPIYILSYVPISFQAVFAKAQ
FT                   WKPIEHQGSSGAEDPRIREQDREERAMAS"
FT   gene            586187..587047
FT                   /locus_tag="Balac_0494"
FT   CDS_pept        586187..587047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0494"
FT                   /product="ABC-type multidrug transport system ATPase
FT                   component"
FT                   /note="COG1131 ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45870"
FT                   /protein_id="ACS45870.1"
FT                   /translation="MQQPIAAPGPVPADPSMAVSIRGLYRRYDDKVAVNGLSLDIPTGS
FT                   FYGLVGPNGAGKTTTINMMTGMLKPDAGMVLVLGKDVWHDVNAVKREIGLMPQPDQIFD
FT                   RLTGRQLLVYSGMLRSMPRAEALERSNDLMHAFDLLDAADKPVFDYSAGMTKKICLATA
FT                   MIHSPRVLVLDEPFEAVDPVSSSNIRDILSAYVSTGGTVIISSHVMSMVERMCTHVAVI
FT                   NKGQVVAAGTVDQVAGGEDLDERFLQLVGGRHDTMHLDWLNGGVHAADEAVSVPQDDHQ
FT                   NGGQA"
FT   gene            587068..588765
FT                   /locus_tag="Balac_0495"
FT   CDS_pept        587068..588765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45871"
FT                   /protein_id="ACS45871.1"
FT                   /translation="MEAPRDAQVTPMNRDAGGERPNIVTTMVRLRWSLMFAAMRKSPWQ
FT                   VVGYVLALLMALGIVVGAGLAAFALTGGAVEWNEAAFAVLRVVMVNAGTVGIIFAALIQ
FT                   LLLIGESSTMSAQKFSLFGIGDRTLTAGLYLSAFTGLPATCAFLSLLCASRLYVGYGTG
FT                   AVLGGVLSAALTVMVAMCFSKAALSLASQLTRTERGKNTLYILVTLLVVVAAQLPNIYV
FT                   NTHTEEDFSAIDVNGLVRLTDVVGWLPFGWSLGLPFDAARGNAAACIARVALALVFCAL
FT                   CFAASVWCIRRERLQGEPQSNVRRERSIGAFNWMPDSASGAISARLFISLKRDPRQAMQ
FT                   YVLPVLFIVIFALQSHGESMVVWQCFLWMGLMMLIGESNGIAYDGRAYAMEQIAGVPGR
FT                   VDRWGRTRVYLAYLAIFYVLCALLTYALTGDWRTPAGVMRGITCTVVGFGVVLISLGSA
FT                   EFFSTFLMYPVPSIRKPFSSPQGRAMAQGLFPFAFMLATCVMALPTGIVAIVLAATGHW
FT                   GMNWVLMPVSLANGVLFLWLGVWLGGKILDARGLKVLATLDNFASLQQ"
FT   gene            588794..590266
FT                   /locus_tag="Balac_0496"
FT   CDS_pept        588794..590266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0496"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="COG2027 D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 4)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45872"
FT                   /protein_id="ACS45872.1"
FT                   /translation="MGRKQTAGRHATNGTRRIRARRALTVAITALVTLGCCGAYVWADI
FT                   ADKAPGILTNAAVQPHIAEPQGHLLTADAPFIANADTSRAIDAGEAAKLIDALRAKNGV
FT                   GPDVSAIIMQADGTVVADHAADVAREPASTMKTLTSLAAASVLDMGDTLPTQTFLLQAE
FT                   QGTDTVVIKGNGDMLLGAGDSDPDHVNGRAGLLTLAKNTAHALKQRGVTKVNLQYDDSL
FT                   FGADRTPTGIEANNPDSLYYTPVSSMAIDGGRQWNGANPRNPDVFESYPALSQNTAADV
FT                   TAIFRNLLGAQGITIVNAEPTQTTVSADRTPIAEVESAPLAMVMAFMLRHSDNTLAEEF
FT                   GRLLALSTKQENSPAGATAAVRNELRTLGIDLTGLQMADCSGLTPGSRLTANTLAQVQA
FT                   RNLDVGGAVAAAEGLSIPGLVGTAANRLASTQAAGLTRVKTGSLQEVSSMTGNVSREQG
FT                   GVAAFAVIVNNPEDFEATRTAINEFVAGLAAL"
FT   gene            590329..591459
FT                   /locus_tag="Balac_0497"
FT   CDS_pept        590329..591459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0497"
FT                   /product="tRNA(Ile-lysidine synthetase)"
FT                   /note="COG0037 Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45873"
FT                   /protein_id="ACS45873.1"
FT                   /translation="MKAAIGEMRDVLKAHGLGQQSKEFSAHGEHKPHDDAPFVFVACSG
FT                   GRDSLALAACAQVVCAAWGIRCGAIIVDHHLQDASHKVAQQTAQTCRDLGLEPVLIVDV
FT                   QVKERGQGIEAAAREARYAALVGTARRWHATAVLLAHTKDDQAESILIDLIRAAGTDAF
FT                   AGMPQTQLFDDVLVLRPLLGITRAQTTRICEDEGLEYWDDPTNGDAVPLETALPASYPL
FT                   RSRVRHDLMPYLSAFAGCDMVDRLARTARIARRDVEALNQEAERALAQTVEFEGNMRDL
FT                   QADRLADDKLGANIDARALERWPEAIRYRVIARTLAACGLAYASRHVAAVDKLVSQWHG
FT                   QGKVALPSKYSAKRKAHVIRICEDITHANRRCAKRN"
FT   gene            591428..591991
FT                   /locus_tag="Balac_0498"
FT   CDS_pept        591428..591991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0498"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /note="COG0634
FT                   Hypoxanthine-guaninephosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45874"
FT                   /protein_id="ACS45874.1"
FT                   /translation="MRIVDVQNEIDHELITHDEIMKRIQEAADQVSEDYKHTLPLLVCV
FT                   LKGAANTMTAFAQAMSIQVELDYMSLSSYGAGTSSSGTITVRQDLSRDVRGRDVIIVED
FT                   IIDSGRTLDWLVNELKSRGAKSVEIFALLEKPARRVIDVDVKYKGFEIPDEFVVGFGLD
FT                   YDERYRNLDSIAVLKPEVYEGAVQ"
FT   gene            591988..594084
FT                   /locus_tag="Balac_0499"
FT   CDS_pept        591988..594084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0499"
FT                   /product="hypothetical protein"
FT                   /note="COG0465 ATP-dependent Zn proteases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45875"
FT                   /protein_id="ACS45875.1"
FT                   /translation="MTYPNQPGNNSGGRNNRPNPFNPFGDNSNKPRNNGGPNGNNNAPR
FT                   SFWQRPWLYIVLIVLILFFIFQAFLGNNTQTINTQDGMNILNSQASDVESATIVDNTQQ
FT                   VQLKLKNDFKKNDPQTGRERNYGKDVQFYYTTAQQAQVVRAVEKANPSQGWTATMHSTS
FT                   MWTYLLSSVVPFLIFFALIWFLMSRMSSSAGGMLGMGGKKSAKLADGQIPKTKFSDVAG
FT                   EEAAVQEVEEIKDFLKDPAKYKALGARIPRGVLLYGPPGTGKTLLARAIAGEAGVPFYA
FT                   MAGSDFVEMFVGLGASRVRDLFDEAKKNAPAIIFIDEIDAVGRKRGSGMGGGHDEREQT
FT                   LNQLLVEMDGFDNDTHLIIIAATNRPDVLDPALLRPGRFDRQVAVEAPDLEGREEILKV
FT                   HAKGKPFVPDIDLHSVAVRTPGFTGADLANVLNEAALLCARVGAQLIDNRAIDEAIDRV
FT                   MSGPRRRSRGMALDELRNTAYHEGGHALVAAALHNTDPVTKVTILPRGRALGYTAVMPT
FT                   EDRYSQSRNELLDQMAYAMGGRTAEEIVFHDPTTGASNDIEKATQIARQMVGLYGLSSQ
FT                   LGAVKWLDSNDDQGLDGLRPREYSDATAEMIDEEVLKLIETAHTEAWQILTENREVLDE
FT                   LVSRLLVKQTLNEKELKEIFANLKMAPKRKVWLSNPNRPDSDKPPVAIPEALKKSAGLP
FT                   QQEF"
FT   gene            594170..595039
FT                   /locus_tag="Balac_0500"
FT   CDS_pept        594170..595039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0500"
FT                   /product="Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45876"
FT                   /protein_id="ACS45876.1"
FT                   /translation="MTTVDCSGIDLGSNEDDMRVWTADVSWVIDDDQLVDAEDLAAHVA
FT                   AIGQMMLGVPVEQLAERIAAQLANQSVFRSVTVTVHMHWKAPLRTFEQLSATVTANRQS
FT                   SANPSAAAANTGGEESASTHDGALPVDPSYRDAVISLHSAALNAEQLFREVIVTLDSMP
FT                   GNQVDGISPLYFVGSLNGTDGHAAVIKLSTAMGVRQLNQVLDALHTTHEGAVQLSVVAT
FT                   GKVGDESLHAPKGAADHHLGAAVLEPWAAMDPNASYNGDPLAYLLAMAPDSAQVGVESE
FT                   RWVMGGGR"
FT   gene            595036..595653
FT                   /locus_tag="Balac_0501"
FT   CDS_pept        595036..595653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45877"
FT                   /protein_id="ACS45877.1"
FT                   /translation="MKARRTPWWWYVIAMLVGLLAGMGISHLEETRGLGLAGIPYLASA
FT                   VMVVVGFIVLYLAWQVHKYTTTDPKKRAQLKPMDSERCVNTLIVSKALAIAGALLAGWY
FT                   GGQIVMLYDRFEAPFFRHIVIECIIAVIASVIDMVLGIISEGLCQLPPNMGPEHPKVVR
FT                   KRREERLARFTNRASGLPMQAAGHHAGNNGADESDKWEKPCN"
FT   gene            complement(595720..596625)
FT                   /locus_tag="Balac_0502"
FT   CDS_pept        complement(595720..596625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0502"
FT                   /product="Acyl-CoA thioesterase II"
FT                   /note="COG1946 Acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45878"
FT                   /protein_id="ACS45878.1"
FT                   /translation="MASDTKTPLQRIVDVLKLGEPSQYRDHTYINGESMYFPTGRVYGG
FT                   QVISQSLIAASKTVPEDRLPHSIHGYFIAPGDIHQDLLFDVENLRDGHSFSARRVNVTQ
FT                   SQGSILTAIASFQTKDQPGVEYFDPMPADVPDPESLPSSVDLMKPYADQSDYAKYYATT
FT                   SPFDIRYISSPIVLGPDEESHRLDTGKQMLWMRAMGEIEVSQTFHRALLALGCDQVMLE
FT                   PILRRAGLTLLTPGISFASIDHSMWWYRDIDVTKWHLYVQDTPTAAHGRGLSSAKVYSQ
FT                   EGDLVACMVQEAMIRVPQTD"
FT   gene            complement(596863..598539)
FT                   /locus_tag="Balac_0503"
FT   CDS_pept        complement(596863..598539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0503"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45879"
FT                   /protein_id="ACS45879.1"
FT                   /translation="MAEFIYQMINARKAYGDRVILDNVTLSFLPGAKIGVVGPNGMGKS
FT                   TLLKIMAGLDTVSNGEAQLTPGYTVGILQQEPPLDEDKTVGENIKMAFGDVAAKVARFN
FT                   EIGEEMANPDADFDSLMEEMGKLQTEIDAANGWDLDSQLEQAMDALQCPDPDTPVSVCS
FT                   GGERRRVALCKLLLEAPDLLLLDEPTNHLDAESILWLEKFLHQYPGAVIAVTHDRYFMD
FT                   NVAEWICEVDRGQLYPYKGNYSTYLETKAKRMEIQGAKDAKLAKRLKNELEWVRSSPKA
FT                   RQAKNKARLERYDQMEQEARNSKKLDFSEIQIPPGPRLGSTVLEAEHIHKAFGDRVLID
FT                   DLSFTLPRNGIVGVIGPNGVGKSTLFKTIVGLEPLSGGDLKIGDTVKISYVDQNRAGLD
FT                   PNKNLWEAVSDGNDFIEVGGVEVPTRAYVASFGFKGSDQQKLTGVLSGGERNRLNLALT
FT                   LKQGGNLLLLDEPTNDLDVETLESLENALIEFPGCAVVISHDRWFLDRIATHILAWEGD
FT                   DEHPANWYWFEGNFQAYQENKIARLGEEAARPHRLHRKLTR"
FT   gene            598707..599135
FT                   /locus_tag="Balac_0504"
FT   CDS_pept        598707..599135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0504"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45880"
FT                   /protein_id="ACS45880.1"
FT                   /translation="MQRTIVTDTSFLSRPSDPADPADPLDAAIAQDLKETLAAHREECV
FT                   GMAANMIGEPKRVIAFVDEGLGSAITVMFNPQITAADGEYDACEGCLSLHGERHTPRFR
FT                   RIEVDYTTRKGRARHATFTDWTAQIIQHEIDHCNGVLI"
FT   gene            complement(599167..600453)
FT                   /locus_tag="Balac_0505"
FT   CDS_pept        complement(599167..600453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0505"
FT                   /product="O-acetylhomoserine (thiol-lyase)"
FT                   /note="COG2873 O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45881"
FT                   /protein_id="ACS45881.1"
FT                   /translation="MGEHVDTICVQGGYQPGNGESRTPPIIQATTFKYTSSEQMSRLFD
FT                   LSETGYFYTRLQNPTNDTVAAKICEMEGGVAAMLTSSGQAANFFALFNICNEGDHIVAS
FT                   SAIYGGTFNLINVTMRKMGITCTFVNPDCSPEELEAAFQPNTKAVFGESISNPALIVLD
FT                   FDKFAKAAHSHGVPLIVDNTFPTPINCRPFEYGVDIVTHATTKYMDGHGSCVGGAIVDS
FT                   GNFDWLAHSAKFPGLCTPDDSYHGVVYAKDFGKAAFITKATAQLMRDFGSTPAPINSWI
FT                   MGMHLESLGVRMERHCANARAVAQFLEDDPRISWVSCPELPTDRYHALAEKYMPNGTCG
FT                   VISFGVPGGREKVSAFLDHLKMISIATHVADARSCTLYPAGTTHRQLTEEQLEEAGVGV
FT                   DLVRLSCGIENPDDIIADLRQALDAVFGE"
FT   gene            600741..601373
FT                   /locus_tag="Balac_0506"
FT   CDS_pept        600741..601373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0506"
FT                   /product="Hypothetical membrane protein"
FT                   /note="COG4721 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45882"
FT                   /protein_id="ACS45882.1"
FT                   /translation="MSTGITQSPRPSSSRFRWTPADIALGAALGVGCGLVFWGFNFAYT
FT                   PISSVLGSILPGIASVLHAVWYFSGTLAVLILRKPGAAVYVNVVGSAVEMLLGNNFAFG
FT                   FVFISAILQGVFAEIPFAATRYRVFNLPMAVLSGLCTALEYGFYLLFFRYQGVALLSPR
FT                   GIVHMISELVGGALIAGVFSWLLFVAVAKTGALDHFASGRAVHVREE"
FT   gene            601655..602563
FT                   /locus_tag="Balac_0507"
FT   CDS_pept        601655..602563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45883"
FT                   /protein_id="ACS45883.1"
FT                   /translation="MDDKTIMYAGNEAGSQTELINPNEIAAMGRRPPTSHRRQPDDDDR
FT                   GFYRRLAVTCVSILAVLAVLIAVIFGIGRHRQSIIAAKRTECERSLVGLDDKVVAYQDL
FT                   VGGDGELASKIADVDVKDMTVVKQLDIEMASESPATVNCDVSSVEEFENRIAQAKASSQ
FT                   WYDEHTASLRSAIQAVNESRHAKQAEDAHASLEEVLRNADNILTSAQGHVTDEAVWDDL
FT                   SKLIGEARNRSGETDMGRIGTLMDDLNARMDAVERSNRENLRQEEQARAEAERKAQEAE
FT                   QKRKEAEAKAKAEEEKNKDKH"
FT   gene            602650..602723
FT                   /locus_tag="Balac_0508"
FT   tRNA            602650..602723
FT                   /locus_tag="Balac_0508"
FT                   /product="tRNA-Met"
FT   gene            complement(602801..603649)
FT                   /locus_tag="Balac_0509"
FT   CDS_pept        complement(602801..603649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45884"
FT                   /protein_id="ACS45884.1"
FT                   /translation="MYGIDADSFLRCAHSYGMNWGDRTLNVIEKGQATAGIRLTLVILC
FT                   VLNQISDAKLRLADILDFTDPADSIRITPDISTPSRTLQRILRGRPVWFYGSPERPGNV
FT                   DRAQREHEVRRSRDADNLTPPPPTCTEEQAMARLDVDLQTLRGWCNALFGMSLDETAHM
FT                   RAQASADSTPELEAHAIVEEIYQDHVRKVKYSMRNCTTWSNSSINLMPTDELDRLEDDL
FT                   SQMEDCLMKFMALRHISFVRDKRAYDADPRNTGPYAFQPDSDIWVDIDEPEDGTLGAEE
FT                   S"
FT   gene            604071..604280
FT                   /locus_tag="Balac_0510"
FT   CDS_pept        604071..604280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0510"
FT                   /product="50S ribosomal protein L31"
FT                   /note="COG0254 Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45885"
FT                   /protein_id="ACS45885.1"
FT                   /translation="MQQGIHPDYHKVTVTCSCGNTFETRSTAKGDHMTVDVCSKCHPFY
FT                   TGKQKILDTGGRVARFEKRYGKKN"
FT   gene            604574..605926
FT                   /locus_tag="Balac_0511"
FT   CDS_pept        604574..605926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0511"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="COG2115 Xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45886"
FT                   /protein_id="ACS45886.1"
FT                   /translation="MAGLWDIDKIEYVGRTKGLQEGLGFQYYDADKVVAGKKMKDWLRF
FT                   GVAWWHTFDAPLTDPFGDGTAQRPWDGKYSDPMDNALAKVDYAFEFFTKLGAEYFCFHD
FT                   RDIAPEGDTLRETNANLDRVVDKIEENMQSTGVKLLWNTSSLFTNPRFVAGASTSPFAD
FT                   VYAYAAAQLKHSLEIGKRLGAENYVFWGGREGYENLWVTDMKREQEHMAKFFHMCADYA
FT                   KQIGMDAQFLIEPKAKEPTTHQYDFDAATACNFLRAYDLIDVFKLNLEGNHANLAGHTY
FT                   QHEIRVARDNGVLGSLDANQGDMLLGWDLDEFPTNLYETTSVMWEVLDEGQIGPHGGLN
FT                   FDAKPRRTSFSAEDLFRAHIAGMDSFAAGLLVADKMHQDKYIEDLVANRYGSYDSGIGK
FT                   SIDDGTATLESLNDYAIDMPQSEIIASTHPDHLEDVKATINNYIIDALANA"
FT   gene            606331..608013
FT                   /locus_tag="Balac_0512"
FT   CDS_pept        606331..608013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0512"
FT                   /product="alpha-L-arabinofuranosidase"
FT                   /note="COG3507 Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45887"
FT                   /protein_id="ACS45887.1"
FT                   /translation="MTATTATMDITNPVLRGMYPDPSWMWDERGERVALVNSSFELVPG
FT                   LPIHVSDDIANWELAGNAVDEAMAQRLLIPFVLDSGGLYAPTLRMIRGKYVIACTVARI
FT                   DLDAADAAGVDPESIEAARTSQGNFIIEADALEGPWRGPYWIEGAEGIDPDIFEDLDGS
FT                   VYWTQTRPAVRPRWEGQTEVWTQRIDPETWRLCASHDADGDYGKTVLWTGYGVEAVWAE
FT                   GPHLYRIGDWVYLMTAEGGTSFDHSEMTMRTWAPDGLGPAIESLQGQAHADGTEPRAPR
FT                   ADERSVVGRYARLFHPCKKNPFLTHRHLGLEERVQCVGHADLLHHPRLGWWVACLGSRE
FT                   TPTADHGALSFLGRETFVAPVEWQHDPAQWSLESNGPAQRRTDDPGWPVLAGGAGRLAQ
FT                   TLRIDAADGTLLDMRIGPCESQAVVDARMPFTVGEGEAAAVRADGVVYRRMPEDRCVVL
FT                   CPPRGTVRIRQDSRHTLSVATDGASVQWALGEGPERREGMVPISEGEPGSVMLVFDKGM
FT                   ARVVVAQSAEQAWEAPAVEVIDVAPLSTEWSGGFVGCLVGCEA"
FT   gene            complement(608026..609030)
FT                   /locus_tag="Balac_0513"
FT   CDS_pept        complement(608026..609030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0513"
FT                   /product="LacI family transcriptional regulator"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45888"
FT                   /protein_id="ACS45888.1"
FT                   /translation="MSEPKVRLADIAKDTGYSLATVSKALNGRSDISDEARAAIDRALK
FT                   ATGYQRRGQKTAGQRYIEVVFQDLDTIWALEVLRGVLRETRHSPDISVITTESGTRQHP
FT                   DDDWITGMLRRKPFGVIFIFANLTEREKGRLQDNGIPYVIFDPSGEPSNDDFSVQADNW
FT                   AGGVLATRHLLALGHTRIGIITGPEEMMCSRARLDGYTSALAEQGIELDPELVTEGDFT
FT                   TEGGYAQAMALLENPNRPTAIFAGSDLQAMGVYEAARQNRLRIPEDLSVVGFDDVQTSA
FT                   FLGPALTTVRQPLHDMAAVSTRMLIDTAEGRPTQHHVILPTTLVVRNSTHDLH"
FT   gene            609361..610638
FT                   /locus_tag="Balac_0514"
FT   CDS_pept        609361..610638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0514"
FT                   /product="putative sugar transporter solute-binding
FT                   protein"
FT                   /note="COG1653 ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45889"
FT                   /protein_id="ACS45889.1"
FT                   /translation="MKLKTFAAATLAVATVIGMSACGGSESSSDDKTITFWHNASAGEG
FT                   RQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEM
FT                   IDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVS
FT                   DVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHD
FT                   FSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGV
FT                   LKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEK
FT                   KNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNA
FT                   AVVNMLSGQGSPEDIVKAMQDAAQKG"
FT   gene            610747..611805
FT                   /locus_tag="Balac_0515"
FT   CDS_pept        610747..611805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0515"
FT                   /product="putative binding protein-dependent transporter"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45890"
FT                   /protein_id="ACS45890.1"
FT                   /translation="MTEMNDAVAVGRPVAETKKRGGARKPSNGKGRRNLEIFILSAPAI
FT                   ILFCCFVILPIILGAYYGFYQWKGFGTPAENGKFVGLQNYIVALKDPNFQQAILHTFEI
FT                   VIGSLVIQGPLAILFALLLNQKFKGRGLIRTLIFVPYVVSEVIVGTGWSLLLQKKGAVN
FT                   QILESLGMHGVDWLANPKVAIWTLLLLISWKYIGFAVILMLAGMQSIPEELYEAAKVDG
FT                   AGFWQIQKSITLPLLAPTLRIWVFLSMIGSLQLFDLVYIIWGQYVSTTAGVSTMATYMV
FT                   REGRGAGNYGYGSAVALIIFVISLIVALTYQHFVLNRDLDGALTEKKASKKRKKRQTAE
FT                   DEALAVAMEGVK"
FT   gene            611807..612676
FT                   /locus_tag="Balac_0516"
FT   CDS_pept        611807..612676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0516"
FT                   /product="putative binding protein-dependent transporter"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45891"
FT                   /protein_id="ACS45891.1"
FT                   /translation="MSAATAYSKNNGFHKSSKTPWGNPVVYFFSLVLVAICVVPVLYII
FT                   FGGFRTNAQITNNPAGLPNPWVISNYKEVITSDIFWTELVNSLIVGICTMVGVVVLGIM
FT                   VSYVIARYRFRYSALMYALFSAGLMFPMTVGITPLYLMIRNLGLSNSLAGIILPQIAFG
FT                   LPQTIIILVPFLQSIPMELEEACLLDGCSRLGFFWRMVIPLSMPGVATTGILTFVGSWN
FT                   GYMLPLFVLSDESKYTLPLGVQMFSSQHSVDTARVLAFTSLAMLPALICFTIFQKKIVG
FT                   GLTGAVKG"
FT   gene            612754..614379
FT                   /locus_tag="Balac_0517"
FT   CDS_pept        612754..614379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0517"
FT                   /product="Beta-xylosidase"
FT                   /note="COG3507 Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45892"
FT                   /protein_id="ACS45892.1"
FT                   /translation="MKIENPVLPGFNADPSMIRVGDTYYIANSTFEWWPGVRLHESKDM
FT                   VHWRLLPSPLNRRSQIDMRGNPSSGGVWAPDLSYADGKFWLVYSDVKIVNGAFKDCTNY
FT                   LVTAEDIRGPWSEPIRINGVGFDASLFHDDDGRKYLVQQTWDFREYNHPFDGITLTEFD
FT                   VETMRLRPETERTIWRGTDVKLVEGPHLYKINGMYYLFCAEGGTVWTHQEVVARSSTLD
FT                   AMSFEGSPYDPFISNFDTPRSYLQKQGHGALVDTPSGEWYYASLCARPWHHENESVTDP
FT                   RGWCTLGRETSIQKVEWTDDGWPVVVGGHGGQRVVEAPQDAIETEAPADHSQHDDFEAS
FT                   QLALDWNTLRVPFDESMGSVGGGTLTLRGQGSLCNLFDLSLVARRWQAFDFDASVGVRF
FT                   DPTNYRQMAGLTNYYNDLCWSWAFVTWDEKRQCRVIEVAQNDFNTYTSFLRDRAVPVPD
FT                   DVETVWLRTRVRTQTYGYDYSFDGEQWHDLGVELDAKILSDDYVNQRYGGFFTGAFVGL
FT                   AAVDLSGYDATAEFVDFDYRELSE"
FT   gene            614485..616410
FT                   /locus_tag="Balac_0518"
FT   CDS_pept        614485..616410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0518"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45893"
FT                   /protein_id="ACS45893.1"
FT                   /translation="MTLTMPKLLDDGCVLQSGRPVNIWGWCTPGERVSVRIGECAGETI
FT                   SAADGGWQVRLDALDPGGPYAFEVIGDGATVRRSCYAGEVFLCSGQSNMELSMQWVHPY
FT                   YPSEFQRQDDPLLRQFKVVDRYDFSGPVRDHEEASWLGCAPETLGQFSAVAYFFGRMVR
FT                   QWLHVPVGLLNVSLGGSPIEAWMDAASLDDCPEALEELDPYLGDGVAEARSEESLAAVA
FT                   GWMEELQARRIPADKLHWRHVDLPARFEDCGLPGFQGMLELRRTVVLPPYCEGAEGTLR
FT                   LGAWADIDETYINGINIGGRPNQYEPRDYRIPAGMLHTGANEIVVRLVCNAGSGRVTEG
FT                   KTMTLQVGDEVHDVSGLWRLAVVASMDRPCPSEDFVRWRPTGLYNAMLAPCFRFPVRAA
FT                   LWYQGESNTGTRAAQYGKLLATMIDLWRERWHDPHMPFLIVQLPGISIDCIEDGGWPLV
FT                   RVGQWAVGQQVPDVKTVVTLDAGEPNDLHPHDKKLVASRLFDAACALLYGGDNVQPMVE
FT                   RIEERDGMLCVSYATVARQGANPVPCTPLTLDGGDPGEFEFVWRDAMCAVPAPATVEGA
FT                   EVCIPLPERRPDILRYAWRNNPSRGLLVDGRGTPMPPFAYDLKRGAMIEPSVRAGGDVD
FT                   AGTGRA"
FT   gene            616647..617810
FT                   /locus_tag="Balac_0519"
FT   CDS_pept        616647..617810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0519"
FT                   /product="esterase"
FT                   /note="COG2272 Carboxylesterase type B"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45894"
FT                   /protein_id="ACS45894.1"
FT                   /translation="MDPAIPLDEDCLYLNIWTPALRGSGADARLTGESLPVMVWIHGGA
FT                   YQCGCAMEKEFDGTALARQGVVVVSVAYRLNVFGFFSHRWLQEKAEEGAPYANFGWLDQ
FT                   QAALRWVRRNITVFGGDPTRICVFGQSAGAASVLAQCCAPSNAGLFSRAIMQSGAGLGY
FT                   FNATLCSLESAQSTGARLMRRLGVENLDEARDVDAQTLFEGASRLEAPEGVDDAAWPMM
FT                   VNWVPCVDGVFMPRQERDLILDGQTKNIDLVVGDTQDEFMVSDGQGHQVRAGREGNRRL
FT                   IAAWQHGGGRAPYYYHFDVPMPGDDAGSFHSSDLWFVFGTLGSCWRPMRGCHVELSQCM
FT                   SRYWTRFAAMGDPSGPGLVHWDRTDMHGDRFLHLGFPVEMRSGHRGA"
FT   gene            complement(617823..619382)
FT                   /locus_tag="Balac_0520"
FT   CDS_pept        complement(617823..619382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0520"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase"
FT                   /note="COG3507 Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45895"
FT                   /protein_id="ACS45895.1"
FT                   /translation="MSVVQNPILNSDFPDPDIIRVGHTYYMASTTMHFMPGCDILRSFD
FT                   LTHWEPYGHVYRTLGHTGAYMLDDDQDLYGQGMWAPSLRWHNGRFHVLFSANDTHTTHL
FT                   FTARDARGPWRHHIVRGFYHDPSLLFDDGRVFIVHGNTALRLTEMDADLSGPKAGGLDR
FT                   VLVQDLPNQDLGYEGSHLQRHDGRYYLFTCHFARGHRKTEDCFIADSLDGEFRGRCILD
FT                   DDLGYHDQGVAQGGMVDTPDGQWYAFMFQDRGALGRTPVLMPMHFDTDGMPVLGVNGRV
FT                   PAYVESAPSAEPHHHYAPLNGDDDFRYTPDSRGTIHLAPYWQFNHTPHDETWSVTARPG
FT                   AFRITTSRVSATMLRATNTLTQRTTGPRCAAEVTIDASGLMEGDIAGLCAFQGCYAYAA
FT                   ITRRQGSWHAIMAERNALHPDNTAERHYDEIPVEVESLPLPSPQVTFRLEIDYTDMRDT
FT                   ARFLVRTDAGWIPIGHPHRLWFKLDHFTGCRFALFTQATQHVGGHADFMRFRYHDASDM
FT                   GA"
FT   gene            complement(619472..621001)
FT                   /locus_tag="Balac_0521"
FT   CDS_pept        complement(619472..621001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0521"
FT                   /product="xylulose kinase"
FT                   /note="COG1070 Sugar (pentulose and hexulose kinases)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45896"
FT                   /protein_id="ACS45896.1"
FT                   /translation="MEPMLVAGVDTSTQSCKVRVTDARTGKLVRFGQAKHPDGSTVDPQ
FT                   AWWEAFLEASEQAGGLDDVSAIAVGGQQHGMVILDEQGRVIRDAMLWNDISSAPQAVEL
FT                   IDELGAAPAADGEPEDRHARGISRWVRAVGSSPVASYTLTKLRWVSEHEPQHAARIAAV
FT                   CLPHDWLSWRIAGFGPVDPGEDAHLDALFTDRSDASGTLYFDAASNTYRRDLLARGLQS
FT                   AAADEPAPECLQAAARIVLPAVLGPQEAAKVKASPSIAGGAVDGGCIIAPGGGDNAMAA
FT                   LGLGMAVGDVSVSLGTSGVAAAVSERPAYDLNGSVSGFADCTGHFLPLACTINASRILD
FT                   AGRAVLDVDYEELTDLALAARPGAGGITLVPYFDGERTPNRPDATATLSGMTLRNTNRA
FT                   NFARAFVEGLLCSQRDCLELIRSLGAAIERILLIGGGAKSRAVRTLAPTVLGMEITCPA
FT                   TDEYVAIGAARQAAWVLSGVDDAPDWPISIDAVQTGTPTPQVYDAYVQARG"
FT   gene            621188..622423
FT                   /locus_tag="Balac_0522"
FT   CDS_pept        621188..622423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0522"
FT                   /product="NagC-type Transcriptional regulator"
FT                   /note="COG1940 Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45897"
FT                   /protein_id="ACS45897.1"
FT                   /translation="MATLKRINQDDLRNHNLSVVLNQVLRSPQPLSRADLAKATGLTKA
FT                   TMSLLVSLLIEHGVLREGVPLVQAVYGRPSTPLIIAGGRVCGIGIQINTDGYGYTVLDL
FT                   DGSTVAERWVDRDLHEVDADEIFADLDAMLLDQEQTLREQGYILAGTGIALPGLVTEDA
FT                   HLIVARNLGWENIDLMQYDVIKRLNVVAGNESNMAATAHLPGYATQVHDEGMVGPDGSF
FT                   IYVSTDIGIGGAIVRDGKVVDGGHGFAGEIGHLSVQLDGPQCRCGRHGCLEVYAGRRSM
FT                   VERAGLASGDAAASQQAIDMFTQAVFDGAEPMHNVYLKAFGAMVSAIVSTINLSDVDTV
FT                   IIGGCWAQLSAEERERMQAEVQRQILARDKVEAHILLTRDMRRPALIGAAQIGLRKFVD
FT                   NPLAYLTADSVA"
FT   gene            622552..622764
FT                   /locus_tag="Balac_0523"
FT   CDS_pept        622552..622764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0523"
FT                   /product="50S ribosomal protein L31"
FT                   /note="COG0254 Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45898"
FT                   /protein_id="ACS45898.1"
FT                   /translation="MQQGIHPDYHKVTVTCSCGNTFETRSTAKGDHMTVDVCSKCHPFY
FT                   TGKQKILDTGGRVARFEKRYGKKSA"
FT   gene            622973..624070
FT                   /locus_tag="Balac_0524"
FT   CDS_pept        622973..624070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0524"
FT                   /product="peptide chain release factor 1"
FT                   /note="COG0216 Protein chain release factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45899"
FT                   /protein_id="ACS45899.1"
FT                   /translation="MASEEFPAAKTALEEYENIERQMGEQEVWSNPDKMRKLGRRQAQL
FT                   GTIVNAYRTWLNIRNDLDAAQEMAGEDPDFAQEAKRLESELPEAEEKLRTALIPRDPDD
FT                   ARDVIMEIKAGAGGEEAALFAGDLLRMYMRYAEKRGWGVTIQSENSTELGGVKDVQMAI
FT                   RAKGNPSPEEGVWASLKYEGGVHRVQRIPVTESQGRIQTSAAGVIVFPEADEDDDEIEI
FT                   DPKDLKIDIFMSSGPGGQSVNTTYSAVRMTHIPTGIVVSMQDEKSQIQNRAAALRVLKS
FT                   RLLAMKHEQEAAEAADMRHSQVRSLDRSERIRTYNFPENRIVDHRTNYKAYNLDAVLDG
FT                   DLQAVIDSDIQADEEQRLASQQQQQ"
FT   gene            624131..625045
FT                   /locus_tag="Balac_0525"
FT   CDS_pept        624131..625045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0525"
FT                   /product="Methylase of polypeptide chain release factor"
FT                   /note="COG2890 Methylase of polypeptide chain release
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45900"
FT                   /protein_id="ACS45900.1"
FT                   /translation="MTTDQLIHRCAEYLREAGVDTPEHDVKLIMADVLGCSPSDVESAA
FT                   IMRTDVRALCAKYGRDDDAELVHTFKHMVCRRHAREPLQYIVGHAPFRYLDLKVGPGVF
FT                   IPRQETELIAQDAIEWVTRHGIYSPRIVDLCAGSGALGLALATEIPGAQVWGVELSPQA
FT                   AVWTRRNITQISRTYPDITANYHLEIADATCPITLAHLDGTVDVVVSNPPYVPQSQVPQ
FT                   QPEVRDFDPSLALYGGSSDGMLIPEQIIRRAYALLRPGGLFLMEHDISQPDRTVAFARA
FT                   SGFSDARTGADLTYRPRYLVATK"
FT   gene            625175..625843
FT                   /locus_tag="Balac_0526"
FT   CDS_pept        625175..625843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0526"
FT                   /product="Sua5/YciO/YrdC family protein"
FT                   /note="COG0009 Putative translation factor (SUA5)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45901"
FT                   /protein_id="ACS45901.1"
FT                   /translation="MADVRSADEQTLADARRIIADGGLVVIPTDTVYGIACDPCNAAAI
FT                   ARIYAAKHRPADKALQVIMPDLSVLPKLGLALPTPLDALARRFLPGAFSPIAVADDDSP
FT                   LLTVRVDDSGARTQGIRVPDSEVTLRVLRAIGPVAASSANRSGNESAQTVDEAVAALGD
FT                   SVDLYIDGGPTVSHTASTVVAADPDAPDGIVILREGRLEADAVRRAVREEARHGGTAGQ
FT                   "
FT   gene            625840..627000
FT                   /locus_tag="Balac_0527"
FT   CDS_pept        625840..627000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0527"
FT                   /product="undecaprenyl-phosphatealpha-N-acetylglucosaminyltransferase"
FT                   /note="COG0472 UDP-N-acetylmuramyl
FT                   pentapeptidephosphotransferase/UDP-N-acetylglucosamine-1-
FT                   phosphatetransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45902"
FT                   /protein_id="ACS45902.1"
FT                   /translation="MRAYIFIAMVAMVATYLYTPLIRHLAIQLGAVGEVRARDVHTVPT
FT                   PRMGGVAMLLGFITAMFFASRLNFLQGEFRQNHQAWVVMAGAAMICLLGVADDVWDLDW
FT                   MLKLAGQLLISVFVAWGGLQIISLPIGGLLTASPMISIAITALLIVVSINAVNFVDGLD
FT                   GLAAGIVAIGGIAFGIYSYVLSRQQVSYASMATLVDVAMVGICLGFLLHNWHPAKLFMG
FT                   DSGSMLLGYLITCASIIITGRLDPATINTSAYVPAFMPILLPVLVLFLPVLDMLMAITR
FT                   RLRKGQSPMHPDRMHLHHRMLRIGHTVQGAVLILWGWAALIAFSSMFLLFFRFVDVLIG
FT                   FVVLAVLLTIATLYPYFKRMGPGAHSNDGVLPKSNAPKHVQESGRA"
FT   gene            627370..628824
FT                   /locus_tag="Balac_0528"
FT   CDS_pept        627370..628824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0528"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /note="COG0516 IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45903"
FT                   /protein_id="ACS45903.1"
FT                   /translation="MLLLPNETDVIPSEVDTSTHLTRNITMKVPVLSAAMDTVTEADMA
FT                   IAMARNGGIGVLHRNLSIDDQAAQVDVVKRSESGMITDPLTVNPDATLADLDKLCGKFH
FT                   ISGLPVVDHDNKLVGIITNRDMRFIASEDYDHLRVKDVMTKENLVTGPSDISKKDAHDL
FT                   LAKNKIEKLPLVDGEGHLTGLITVKDFVKTEQYPDATKDGQGRLRVAAGIGYLGDAWQR
FT                   ASALMEAGVDVLVVDTANGEAKIALDMIRRIKNDSAFNGVDIIGGNIATRQGAQAMIDA
FT                   GVDAVKVGVGPGSICTTRVVAGVGVPQLTAVYEAAQACRAAGVPCIADGGIHYSGDIAK
FT                   ALVAGASSVMLGGVLAGTEEAPGEKVLLHGKQYKLYRGMGSMGAMAPRGKKSYSKDRYF
FT                   QSDVTSTDKIVPEGVEGEVPYRGPLGAVLYQMIGGLHQSMFYIGAHNIAEMSEKGRFIR
FT                   ITDAGLRESHPHDIVMTAEAPNYSGR"
FT   gene            629019..629672
FT                   /locus_tag="Balac_0529"
FT   CDS_pept        629019..629672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0529"
FT                   /product="oligoribonuclease"
FT                   /note="COG1949 Oligoribonuclease (3->5 exoribonuclease)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45904"
FT                   /protein_id="ACS45904.1"
FT                   /translation="MVDANDALTYSPETSRMIWIDCEMTGLDIFHDELCEVSVVPTDFE
FT                   LNVLDKGIDLVIKPSEAAVAHMDDFVRAMHTRSGLIDEWENGLSVQEAERQVIDYVQQF
FT                   IPQGVKPLLAGNSVGSDKKFLDRFMPNLMEHLHYRVIDVSTIKELARRWYPAVYENRPP
FT                   KNGGHRAWADIVESLDELRYYRAAIMAPEPGPDTVQSKRIAEQIVATSVMNEAE"
FT   gene            629744..630592
FT                   /locus_tag="Balac_0530"
FT   CDS_pept        629744..630592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0530"
FT                   /product="hypothetical protein"
FT                   /note="COG0561 Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45905"
FT                   /protein_id="ACS45905.1"
FT                   /translation="MAEVEWTEIKEPQDIKLVVADMDATLLDADGQIPAGFWPMLDRLN
FT                   QKGVTFVPASGRQYQTLQQMFSRSVRPMSFIAENGNIVSLDGNVIETHTVSRDLVKQVI
FT                   DICDKAAETGEYNIGLVVCGLNAAYIQRTDEEFIAEVSKYYAKVEPVNNLREVLDYVDE
FT                   KFLKLAIFDFEPAEPMAKDLLAGIEQPYEYVLSGKHWADIMDSRVSKGDGVVVLQKALG
FT                   VGVDETAVFGDYLNDVPMFEHARYSFAVANAHPQVRAAAAYIAPANTEEGVIRVVDRIV
FT                   R"
FT   gene            630633..632102
FT                   /locus_tag="Balac_0531"
FT   CDS_pept        630633..632102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0531"
FT                   /product="helicase"
FT                   /note="COG0507 ATP-dependent exoDNAse (exonuclease V, alpha
FT                   subunit - helicase superfamily I member)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45906"
FT                   /protein_id="ACS45906.1"
FT                   /translation="MKQSEALEIMLAGASAFLTGAPGAGKTYVLNRFVQAKREQGSTVA
FT                   VTATTGIAATHVDGQTIHAWSGIGVADSLTDSLIKTIRTRRRKQIKSTDVLVIDEISMM
FT                   HAWLFDMVDEVCRIIRKDSRPFGGLQVVLSGDFFQLPPVGASRRNTAMTPTPEYVSMRE
FT                   RYAQAGKNPEGFVTESFAWDALDPVICYLDEQHRQDDGQLLRVLTDIRGDMVSQIDKDI
FT                   LITRYQVPLEEGKQAVSLFPQNRQADLVNERQLAQIDGDEHEFFAEARGQANLIERLKR
FT                   NMLAPEHLVLKKNAVVMAVRNDAEGRYVNGSLGMVIGFLKDARGGWPIVEFENGNVVTM
FT                   KRADWEMMDGDDVLASVSQVPLRCAWAITIHKSQGMTLDSAIMDLSRTFAPGMGYVALS
FT                   RVEKLDGLYLNGVHNRMFNVSADAVLLDDALRAGSARAAAQLAEQGADSFSHRSPDHAV
FT                   LGATGESGAAESTQTLFDALDEFGGTGEPAF"
FT   gene            632203..632634
FT                   /locus_tag="Balac_0532"
FT   CDS_pept        632203..632634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45907"
FT                   /protein_id="ACS45907.1"
FT                   /translation="MKHSAMYIISGIGALVLFVAFLFYTSAPVNLVGWFKLSDLLTIIG
FT                   GLMFIIPFYIVSVRRKMRDNAPNPWAWQYLPVIGMVLMVIGLIFPNGKLTVGVIDLCDV
FT                   LYLFGCVFMLMIFVYPFGSVNEEMLESDVDERVDDDARQ"
FT   gene            632739..634556
FT                   /locus_tag="Balac_0533"
FT   CDS_pept        632739..634556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0533"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="COG0442 Prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45908"
FT                   /protein_id="ACS45908.1"
FT                   /translation="MTKALRMSTLFLRTLREDPADADVDSAKLLQRAGYIRKAAPGIWT
FT                   WLPLGLAVLNKIEDVIREEINGIGAQEVHFPALLPREPYEATHRWEEYGDNIFRLKDRH
FT                   EADYLLAPTHEEMFTLLVKDMYSSYKDLPVTLYQIQTKYRDEFRPRAGLIRGREFIMKD
FT                   AYSFTVDEEGMRQAYMDERGAYERIFQRLDLKYVPVFAMSGPMGGSASEEFLAPMPIGE
FT                   DTFALAPSGKAWNVEALHTPAVEAVDCSQTPDATKRATPNARTIDEMIAFANAEYPRED
FT                   GRDWQASDILKNVVIAVKHAEDDEHDEPWRELVVVGIPGDRTIDMKRLEAQFAPAELEE
FT                   ATEDDLKAHPELVRGYIGPMGFGPQARGDDGTAETLRYLIDAHVAEGSAWFTGADEEGV
FT                   DYYDLVYGRDFKADDVVEAVQVRDGDMSPDGSGPLSFERGVEIGQVFQLGLKYSEALDL
FT                   KVLNQNGKTVPVWMGCYGIGVSRVLACIAETHHDDKGLAWPMNIAPAQVHVMATGKDEA
FT                   AFEAAERLVDELSANGIEVLYDDRRKVSPGVKFKDAELIGVPIIAVAGRDTVNNGTIEV
FT                   RDRDGSNSENISVDSVAQVIVDRVHEALK"
FT   gene            634786..635508
FT                   /locus_tag="Balac_0534"
FT   CDS_pept        634786..635508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0534"
FT                   /product="hypothetical protein"
FT                   /note="COG0629 Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45909"
FT                   /protein_id="ACS45909.1"
FT                   /translation="MALQQGAVTITGYLGADPQQYGRNPSRPACTFRLGSTRRYQDRNG
FT                   VWQQLPTTWLTVKAFRGLAANIMQSLHRGDPAIVTGLLNTEQWRDEQGVDHSRLVLEAS
FT                   NVGLDLNYVVTMSMRTPREGYTGQQAPSQMASDEQGSPMRPQTQQATSAAPQSTLSRSS
FT                   MAPGDDGGNPVDPFNQMPPDCLSPDAAASMPQQGDQRDAALEPLVGNGMPPQDLEHGCA
FT                   TDTTNSRKEVRPEDQDEF"
FT   gene            complement(635598..637667)
FT                   /locus_tag="Balac_0535"
FT   CDS_pept        complement(635598..637667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0535"
FT                   /product="M13 family peptidase"
FT                   /note="COG3590 Predicted metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45910"
FT                   /protein_id="ACS45910.1"
FT                   /translation="MQSGIDPASFSAVISPKDDLFRYVNGPWIDTYRLPDDRSSYGSFN
FT                   RLSENAEEQIRDILETDSEEASKSKALYHAFLDTDAIEAAGIEPIRADLIAIDEARTKE
FT                   GLIDVLGRLSPFGGPDLFGFSVFGDMNHPETNVLYLGQGGIGLPDEAYYREDHHEQIRQ
FT                   EYVSMVAKQLRNAGYADDEEKAQDLAERFLDVETRIASHHWDNVKTRDPQATNNPTTFD
FT                   ELKAMFIHFDIERWIKAVQESYDTSHAARTMPVDMLGAFANIIVDEPSFVTGLDGFWAA
FT                   ASLDDLKLWARVHVIIDNASMLSSVFDKTNFSFYGQVLSGTKQQRDRWKRGVSLVNGIC
FT                   GEDVGKVYVKLHFPESSKKRMQELVSNLIQAYHISIVNSDWLGEETKRKAIDKLNSFEP
FT                   YIGYPDDWRDYTALDVHADAPLMDNMRAAAVYEFGYQVSKSGKPVNKGEWLMNPQTVNA
FT                   YYEPTRNIIVFPAAILQPPFFNPQAEDAVNYGGIGTVIGHEIGHGFDDQGSQFNGSGKL
FT                   EDWWTDEDRKHFKQLTQALIDQYDEFVPVQLREKYADEPDKMPHVNGSLTIGENIGDLS
FT                   GVNIALKAYAFALDEQHGLPVDASPSGIEGALEMSPEIDGFSGLQRFFLGYAQIWRTKM
FT                   RDELAEQYLQIDPHSPAEDRTNGIARNVNLFYKAFGVTDNDRMWLKPEERVRIW"
FT   gene            637928..638548
FT                   /locus_tag="Balac_0536"
FT   CDS_pept        637928..638548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0536"
FT                   /product="hypothetical protein"
FT                   /note="COG3247 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45911"
FT                   /protein_id="ACS45911.1"
FT                   /translation="MSEPNPQYQNQQYNQSPFRLFEGMLPTGAKNLVRGTYGVIGVAAL
FT                   ALGICLLVWPGITLKVAAIVLGIYFLISGVVRIVSSLVEMGLPAGWRILGVLIGIILVI
FT                   GGIVIFKNVTMSTAMLAIMFTLIVGICWIMEGVMALAESWSVPSSGWAIAYAIISIIAG
FT                   FVLLCMPMASTLWLIIFGGCAMVVMGICAIVRAFTFGRVKKNN"
FT   gene            638699..639502
FT                   /locus_tag="Balac_0537"
FT   CDS_pept        638699..639502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0537"
FT                   /product="methionine aminopeptidase"
FT                   /note="COG0024 Methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45912"
FT                   /protein_id="ACS45912.1"
FT                   /translation="MIELKTPQEIEEMKPAGHFVGSILNELREKTKVGTNLLEIDEIVH
FT                   KRIADRKGAQSCYVDYAPDFGTGPFAHYICISINDAVLHGVPYDYTLKDGDLVSLDLAI
FT                   SVDGWVGDSAISFVVGKDKDPSDLRLIKSTEEALAAGIAEAIPGNRLGDISHAIGEVAA
FT                   EYGYPVNLEFGGHGVGHIMHGDPHVPNDGKAHHGYKLRPGLVIAIEPWFMKTTDEIFQD
FT                   QRDGWTLRSVDGSRGAHSEHTIAITENGPIVLTAREGDPLSKLYN"
FT   gene            639727..641019
FT                   /locus_tag="Balac_0538"
FT   CDS_pept        639727..641019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0538"
FT                   /product="citrate synthase 1"
FT                   /note="COG0372 Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45913"
FT                   /protein_id="ACS45913.1"
FT                   /translation="MGEAHLHVEADEFKLPVVKATAGPDGIVMSSLRNNNWVSLDPGFL
FT                   TTAQCESRITYIDGEHSILRYRGYPIEQLCEQSDFLEVSWLLRNGELPTKAEYNRFVED
FT                   INHHTMVGEDFRTFMGSFPRGAQPMSVMASAINALAAFNPDTTDISDPEQLDEAAMIIM
FT                   AKARTVVSYILRRRRDEPMLYPDYARGYVDDFIRMCFAVPYERFESDPLYVHAFGRLLI
FT                   IHADHEQNCSTSVVRIAGSAHANLYSAVAAGINALSGPRHGGANEAVLRQLMAIRDSGM
FT                   SVKQFVEKAKVEGSRISGLGHRVYKSYDPRAAIAKHYLEKIMENKATLKLLPGDEQLFD
FT                   VALQLEDIALNDDYFVSRNLYPNVDFYTGLIYRAIGFGPSMFTPLFALGRIPGWIAQYR
FT                   EMLADPMTKIGRPRQVYTGAVLRDYVPIDER"
FT   gene            complement(641041..641520)
FT                   /locus_tag="Balac_0539"
FT   CDS_pept        complement(641041..641520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0539"
FT                   /product="hypothetical protein"
FT                   /note="COG1576 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45914"
FT                   /protein_id="ACS45914.1"
FT                   /translation="MNIDIVCVGKVKERYLRDAIDEYRKRLSRFAKVDVIEVADEKTPE
FT                   HASDTLNAQIKEKEGERILKHLRDGAFVVALAIEGDQLTSEQLAARIAQWGLHGVSHLQ
FT                   FVIGGSLGLDPRVLRRANMPLSFSKMTFPHQLMRVILLEQIYRAFKINAHEPYHK"
FT   gene            complement(641629..642612)
FT                   /locus_tag="Balac_0540"
FT   CDS_pept        complement(641629..642612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0540"
FT                   /product="hypothetical protein"
FT                   /note="COG2171 TetrahydrodipicolinateN-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45915"
FT                   /protein_id="ACS45915.1"
FT                   /translation="MTQSRSAWGWGLASIDAAGNVLDVWYPKLTLGEAPAAKPNHGFGN
FT                   LVHEGEDLRGVRRMPVFTVSRLDDPVVDAPDAYLRLHLLSMRLAKPNTLNLDGIFGALN
FT                   NVVWTNYGPFAVDDFAQRRLAVMQGNAGAGMPGMRAEVNVLAIDKFPRMLDYVVPTGVR
FT                   IGDGDRVRLGAYLSEGTTVMHAGFVNFNAGTLGTCMIEGRVSQGVVVGDGSDVGGGASI
FT                   MGTLSGGGKLRNSIGEHSLLGANAGIGISLGDNCVVEAGLYVTAGTKIEVWDKEKAAAG
FT                   VALDVVKGADLSGKNNILFIRNSLTGAIQARPRKTGIALNDALHKN"
FT   gene            642920..643051
FT                   /locus_tag="Balac_0541"
FT   CDS_pept        642920..643051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45916"
FT                   /protein_id="ACS45916.1"
FT                   /translation="MKKQDNTEGRQTRRSYNATRIVAIVVVCAMLVGFAMPLIFAGL"
FT   gene            643205..644338
FT                   /locus_tag="Balac_0542"
FT   CDS_pept        643205..644338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0542"
FT                   /product="peptide chain release factor 2"
FT                   /note="COG1186 Protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45917"
FT                   /protein_id="ACS45917.1"
FT                   /translation="MAEFDYSQAISDARAKYESIALALDTDRLKSQEAELEQQASAPGL
FT                   WDDSEHAQKVMSQLSACQSQLKHLSSAASRLDDVATLIELGQEENDADTLHEAQTEIES
FT                   IQKDLDQMEIETLMDGEYDSRSAVVTIRSGAGGVDAADFAQMLLRMYLRWAERNGYKAK
FT                   VMDTSYAEEAGIKSATFQIDAPYAYGRMSVEGGTHRLVRISPFDNQGRRQTSFAAVEVV
FT                   PLVEATDHIEVPDSEIRVDTYCASGPGGQGVNTTYSAVRITHLPTGIVVTMQDERSQIQ
FT                   NRAAAMAVLQSRLLVLRHEEEAKKKKELAGDIKASWGDQMRSYVLHPYQMVKDLRTGCE
FT                   TSQTQAVFDGDIDEFIQAGIRWRHEQRLEAAAEEANE"
FT   gene            644384..645712
FT                   /locus_tag="Balac_0543"
FT   CDS_pept        644384..645712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0543"
FT                   /product="FtsE-like ATP binding protein in cell division"
FT                   /note="COG2884 Predicted ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45918"
FT                   /protein_id="ACS45918.1"
FT                   /translation="MALISMEHVSKIYPNAKRPALQDIDLEISRGEFVFLVGASGSGKT
FT                   SLLRLLLREEEATSGEIRVGGYDLRRLPNRQVPQYRRSIGMVFQDYKLLNNKTVWENVA
FT                   FALEVIGTSRSTIKSLVPKVLKTVGLTGKENNYPRELSGGEQQRVTIARAYVNHPQLLL
FT                   ADEPTGNLDPTTSLGIMEVLDAISRTGTTIVMATHNEEIVNSMRKRVVELNKGSIVRDE
FT                   KNGSYDSAMYFPDEQVAAMSHAAIKAEVGIGAVAGSETGAVIEPATNQQKSHSGKHERD
FT                   ERATTMVDSVNEILQSEHSNEGIARLAQSVHAGKTGRYGEAFADVEQTLTWGGGLSLEE
FT                   LAEQEGIDTSKTREVSTAAKADASMEQDSGKAWGTVTLEEPRGEADSTGNASAGKTTPV
FT                   EQTQAMAPVTKEIEPSTPPMPPSPPKGRHSRPRTPDEPNKDEE"
FT   gene            645716..646639
FT                   /locus_tag="Balac_0544"
FT   CDS_pept        645716..646639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0544"
FT                   /product="FtsX-like protein involved in cell division"
FT                   /note="COG2177 Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45919"
FT                   /protein_id="ACS45919.1"
FT                   /translation="MRFRFILSETWTSLRRNVPMLLSVMLVTFISFLFIGASLLTQAQI
FT                   TKAKGDWYDKVEVVVWLCPDGNSQSANCSTGKAATTAQINELQKVIQQELPNDVSQVTF
FT                   MSREDFYNNSFVKQYPKGEYQGRTLTAADMQDSLWLKLKNPENYRVVSEVLSNRDGVEE
FT                   VVDQRQIFEPVFAILNRATVATGGLAVIMVIAAIMLTGTTIRMSAASRREETEIMRLVG
FT                   ASNWTIRLPFILEGVIASLAGSLLSCGALALFVKVFVTDWLAKSVTWIPYVDQTTVWLV
FT                   SPILIVGAMVLSVLASSIALRRYLKA"
FT   gene            646865..648208
FT                   /locus_tag="Balac_0545"
FT   CDS_pept        646865..648208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0545"
FT                   /product="Surface antigen"
FT                   /note="COG3942 Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45920"
FT                   /protein_id="ACS45920.1"
FT                   /translation="MSTYTPQAYADTYSDLVNAQNSHAQSKQREAALREQLAGVNSDLA
FT                   DKIVELDDLNNNKIPAAQAKVQQANSDAAAAKSEADAAAERLKAAEKDKADLEAKIKQT
FT                   GEDYDDAHAAVAQSARESMHGSDTSDVMSVMTGSKDTKDFIKSMQSRDALARNEANAAS
FT                   DAAVDLNTSMNRADRLKAIEKRVEQCKNDADQKSAAAQSAATQAQQEKSSLDKLRAAGE
FT                   STRADLENQKSSLTTQAAQQAAQTVMLQSEIDAKNQQWAAEQAAAAAQVQEPEPQGTVE
FT                   APAAAAPQPSVPQQTQTPSQPAQTQRPSTPSQPSTPPTPVVTRPSTGGQGTSNGDYGNA
FT                   YAAGQCTWWAYERRKQMGIGTPSYLGNGGQWWSTAPSYGLRVDHSPQVGAALSFLPGQE
FT                   GASSPWGHVAVVEQVNGNSILISESNVAGLYTITYRTLYNPGRFWYVH"
FT   gene            648607..649098
FT                   /gene="smpB"
FT                   /locus_tag="Balac_0546"
FT   CDS_pept        648607..649098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="Balac_0546"
FT                   /product="SsrA-binding protein"
FT                   /note="COG0691 tmRNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45921"
FT                   /protein_id="ACS45921.1"
FT                   /translation="MAKKEQSNEKMIAQNRRARHDYEIEDTYEAGLALTGTEVKSLREG
FT                   RASLAESFISIDKRGEVWLEGANIPEYLNGTWNNHAPKRKRKLLLHGAQIDKLRRQIQA
FT                   KGYTIVPLQLYFNEDGRAKLKIALARGKKEYDKRQALREEQDKREALRMMRYKNMHARG
FT                   "
FT   gene            649177..649416
FT                   /locus_tag="Balac_0547"
FT   CDS_pept        649177..649416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45922"
FT                   /protein_id="ACS45922.1"
FT                   /translation="MQGKCMRAGEAYAAEVYAGEVCGTEEMTHGFVRNLGRSLRIVVPF
FT                   YADWQRELCVGDATFERLLPDYEIPRVPKRADNM"
FT   gene            649463..650392
FT                   /locus_tag="Balac_0548"
FT   CDS_pept        649463..650392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0548"
FT                   /product="ABC transporter solute-binding protein"
FT                   /note="COG0834 ABC-type amino acid
FT                   transport/signaltransduction systems, periplasmic
FT                   component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45923"
FT                   /protein_id="ACS45923.1"
FT                   /translation="MKNTWKATAAFAAIVLCAGMSACGTSDASDSGKSSGTSSSSAAAS
FT                   FDPSTVETDETIAALVPDYVKKDGKLTVGTDTTYAPAEFIGEDGKTAVGYDVDLTKAIA
FT                   KVMGLEPETAVSEFDMIIPSIGSKYDIGISSFTVTPERQEAVDFVTYYKAGSTWVTQKG
FT                   NPDKVDTKDLCGVKVAVQTGTTQEEELNKMNEQCKADGKKAIELQTFAKQTDVTTAVVN
FT                   GKAAVFYADSPVAGYAIEQTDGALAPLGADEGVTEEGIIVKKGDKQMDEAVQKAVQKLM
FT                   DDGTYQKILENWGVSSGAIDKAEINPTK"
FT   gene            650607..651542
FT                   /locus_tag="Balac_0549"
FT   CDS_pept        650607..651542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0549"
FT                   /product="ABC transporter solute-binding protein"
FT                   /note="COG0834 ABC-type amino acid
FT                   transport/signaltransduction systems, periplasmic
FT                   component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45924"
FT                   /protein_id="ACS45924.1"
FT                   /translation="MFGNAQSTMKKVAAFALGAAVILGSAACGTTDETQTAAKDSQNAT
FT                   SIVDSVKKDDKIAAMLPQKIAESGKLTVGMEMTYAPAEFVAEDGKTPEGYDVDLAKALA
FT                   KTLGVKADFISSSFDSIVPSVGSKYDLGITAMTITEEREDSVDFVSYYKAGSMWVVKKG
FT                   NPDKVDAKNLCGTKIAVQVGTTQEEDANKIKEQCAADGKAAVEVMPSKQQTDAATNVVT
FT                   GKADVFYADSPVAGYAISQTDGQLEELGEVEGTIKQGIAIKKGDTQLAEAVQAAMQHLM
FT                   DDGTYMKILKAWGVESGALDKAEINPKDLS"
FT   gene            651739..652725
FT                   /locus_tag="Balac_0550"
FT   CDS_pept        651739..652725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0550"
FT                   /product="permease protein of ABC transporter system"
FT                   /note="COG0765 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45925"
FT                   /protein_id="ACS45925.1"
FT                   /translation="MPHHVEHDSEGLPIPNRIKAKPVKRPGQIVAAIIVVIFAAMIVKG
FT                   LITNPRFEWNVVWKYLFNERVLEGVGYTLLLTVISMVVAIVLAVVLAVMRKSVNPVLRG
FT                   VSWFYIWFFRGTPVYTQLVFWGLFAVLIPRLSLGIPLTSVEFWSIDSQAIITAFNAAWI
FT                   GLALNEAAYLAEIVRAGLDAVDPGQEEAAKALGMKRSMIMRRVILPQAMRIIIPPTGNE
FT                   TIGMLKTTSLVLAVPFTLDLQYATNAIANRIYKPIPLLLVASIWYLFITSILMVIQSML
FT                   EKHFGRGFQARPVGPKGKQPPLPGKTDGEPKDDVNKTNQAEFMGYTA"
FT   gene            652753..653607
FT                   /locus_tag="Balac_0551"
FT   CDS_pept        652753..653607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0551"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1126 ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45926"
FT                   /protein_id="ACS45926.1"
FT                   /translation="MSEATRKTKSNSDESTATQTPKASVATDIAAAIPAVEAKQVHKAF
FT                   GDLHVLKGIDLTVEPGTVTVILGPSGSGKSTFLRLINQLETITGGEIDVDGEMIGYKKL
FT                   PNGELQTLNDKEIARQRAKLGMVFQKFNLFPHMTALENVMEAPVHVLHMPKAEARKLAI
FT                   KELERVGLGERLDYYPAQLSGGQQQRVAIARALAMKPEIMLFDEPTSALDPELVGEVLN
FT                   VMRSLANDGMTMIVVTHEIGFAKEVADQIVFMDGGVVVERGTPDIIDHPKEERFQDFLQ
FT                   HVL"
FT   gene            complement(654082..655017)
FT                   /locus_tag="Balac_0552"
FT   CDS_pept        complement(654082..655017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45927"
FT                   /protein_id="ACS45927.1"
FT                   /translation="MRRNRVVEQLLDSAQHGHRCAYACNRNERVALARRARSGELNQVF
FT                   RNCYVRPDYWDSLRPAERTWHICRTVNQYNPGVVFAGKTAATLLGFPLSHAVHDGTIVC
FT                   AARRNWTSERTQHIYTDMDSAISMQGLLVTNPAHTLVDCALLLPFEETLPMFDSASTTH
FT                   FKQIMEVMGTMSRDVSPVLRLLHFADPRSESGGESKARAVIIVLGFVVPELQISFFDPV
FT                   TRKTYRTDYLWRLADGRAIVGEFDGMEKYVNPQMVGSKTIEQRVLAERERDEALRRCGV
FT                   SQIVHFSYNDVMHPDQLRRKLEQAGVPYVS"
FT   gene            complement(656514..657200)
FT                   /locus_tag="Balac_0553"
FT   CDS_pept        complement(656514..657200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0553"
FT                   /product="response regulator of two-component system"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45928"
FT                   /protein_id="ACS45928.1"
FT                   /translation="MYTNMNPDSEPWNIALVDNDALVRSYLETYLGGLPEFNICWSMQS
FT                   GRDAVEAYHHSIACTNCVPDLIVTDLSMHGMSGFELCATIRFENDHTPILGCSSYMIEP
FT                   YERDAVNNGMQGLLLKNELAQLADGMRTLLSGQPLLKSNGMPYETPQQAHERLLMQGKP
FT                   AIMSMSPNEQAVMELCSEGLSTRTIAEETGDSESTVKTYISRAMRKLRAKSRAEAVASW
FT                   SRKTKL"
FT   gene            657536..659362
FT                   /locus_tag="Balac_0554"
FT   CDS_pept        657536..659362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0554"
FT                   /product="D-fructose-6-phosphate amidotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /note="COG0449 Glucosamine 6-phosphate synthetase, contains
FT                   amidotransferase and phosphosugar isomerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45929"
FT                   /protein_id="ACS45929.1"
FT                   /translation="MQGLERLEYRGYDSAGVALVAPGMDRVRVRKKAGRLSNLVADIES
FT                   DPLPEATVAIGHTRWATNGVPNDVNAHPHSSMDGRVAIIHNGIIENASQLRLDLQAEGY
FT                   RFVSGTDTEVAAKLLGKIVDAVIAETGGPDLFEAVRRLGRMLEGAFTILAIDCRQPGVV
FT                   VGARHDSPLVVGLGEGENYLGSDVAAFVAYTRTAMEIDQDQAVMISAGGVTVTDFDGNV
FT                   VEDPTVFEVDWDASAAEKGGWDSFMDKEIHEEPAAVQRTLIGRLDDTGSINLDEVRIDE
FT                   HDFTMIDKIIVIGCGTASYAGLVAKYAIEHWVRIPVEVELAHEFRYRDPILTPRTLVVA
FT                   ISQSGETMDTLMALRHAREQGSKVLAICNTQGASIPREADAVLYTHAGPEVAVASTKAF
FT                   VAQITATYVLGLYLAQLKGTVFRDEIRQTLDSLKAMPAKIQWVLDTQPDRVQRAAEQLQ
FT                   DAQSFLFLGRHVGYPVALEGALKLKEIAYTFTEGFAAGELKHGPIALVDEGEPVVFIVP
FT                   PARGRNTLHAKVISGIEEVKARGAYIIAVAEENDKDVERYADMIFWRPECPTLMSPLVD
FT                   IVPLQLFAMDMARQKGYDVDKPRNLAKSVTVE"
FT   gene            659380..660108
FT                   /locus_tag="Balac_0555"
FT   CDS_pept        659380..660108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0555"
FT                   /product="23S RNA-specific pseudouridylate synthase"
FT                   /note="COG0564 Pseudouridylate synthases, 23SRNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45930"
FT                   /protein_id="ACS45930.1"
FT                   /translation="MIEEPHIPFDLTVVYENERIIVVDKPHFLATTPRGMWYRETALMR
FT                   LRERYREPNIIPAHRLDRPTAGIVVFVRDPAARGAYQMLFQEHRTRKCYECLAPIRPLA
FT                   TPRTGTVVHGSPPRIWPLVRRSRIRKTRGVLCAQEIPGQVNAETAIELEALHARMSARM
FT                   GMSIGVYRLLPRTGKTHQLRVHMNSLGLPIVGDDFYPRIEERAYDDFSQPLQLVARSLA
FT                   FTDPFTGDPLEFSSKIELGI"
FT   gene            660146..660547
FT                   /locus_tag="Balac_0556"
FT   CDS_pept        660146..660547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45931"
FT                   /protein_id="ACS45931.1"
FT                   /translation="MNAQIWYVVLLSVTVIAALIGTSIVLGQSKNGPGEDHYIDLDPQM
FT                   QGEPYATPVIVGDDGVTRQKDIVHDIKQMPDDTAIVDVLYAGSKKGSKDDTKAEHMTMK
FT                   KVDVRRLGLKPGTTVTLHVVDGAITLIER"
FT   gene            complement(660554..661312)
FT                   /locus_tag="Balac_0557"
FT   CDS_pept        complement(660554..661312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0557"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COG1521 Putative transcriptional regulator, homolog
FT                   of Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45932"
FT                   /protein_id="ACS45932.1"
FT                   /translation="MILAVDIGNTNIVIGLMEGTETVDTYRITTRSNHTSDEYGLMILQ
FT                   FLQLSNSSPDDVQDAIISSVVPKVMHSFISSMIKFLGIDPMIIGPGIKTGMNIRMDDPR
FT                   SLGADLLADCAGAYTTYGGPVLVIDMGTATTYNYVDEKGAILAGLITTGIGTAAAALAS
FT                   NTAQLPEVQITRPKSILAANTKDAMQAGLYYDCLGGIERTITQFREELDTDFKVVATGG
FT                   MSRIFDCPLIDIVDPTLIFKGMASIYAKNV"
FT   gene            661482..663233
FT                   /locus_tag="Balac_0558"
FT   CDS_pept        661482..663233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0558"
FT                   /product="ABC-type dipeptide transport system periplasmic
FT                   component"
FT                   /note="COG0747 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45933"
FT                   /protein_id="ACS45933.1"
FT                   /translation="MTEPKNGLQNNNEPKPQNADNASASENKAGNASAASTDASLQAHE
FT                   KSGNTHSGWKGWVLGAIAVIIVAAIVFAVVNHTRAGKESAIQTGTPAQTVTIGLKLAPT
FT                   NLDIRNTAGSSLDQVLIGNVYEGLVSRNEENKVVPALAKSWEVSDDGLTYTFHLNKGMH
FT                   FSNGDELDADDVVWSIQQLEEKQYHDADALRNFKSISAPNADTVVITLTKPYSQLLWAL
FT                   SGRAGLVFDKDAKYVAKTQAVGSGPYKVAKFTPNNSIELVADENYWGSNKPKTKNIVIR
FT                   YFADDNAAVNALKSGDVQVLAPITYALAESALDARIETKSSDSNGTEHSKESGDPTSRF
FT                   VVKVGDGTDKYVLAMNNAKGKATADKKVREAIRYAIDHDQLIASRGGVDAKLGGPIPSL
FT                   DPGYRDLSSKYPHDIEKARELMKQAGYSADHPLKLTLTYPNTYGTELGEQLRSQLKEAY
FT                   IELKVNVVEFSTWLQDVYTDKDYDLSMVDHNESHDFSQWTRPDYYYGYDNRKVQQLYEE
FT                   AMGATNDDERDAKLAEAAQTVSEDAAADWLFNYRVATAMGKGVEGFPLNMNQTFMPLAQ
FT                   LTYTPTK"
FT   gene            663273..664235
FT                   /locus_tag="Balac_0559"
FT   CDS_pept        663273..664235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0559"
FT                   /product="peptide ABC transporter permease"
FT                   /note="COG0601 ABC-type
FT                   dipeptide/oligopeptide/nickeltransport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45934"
FT                   /protein_id="ACS45934.1"
FT                   /translation="MKYVLRRIAMFLVALLAISLIVFLMLRVLPGDIAAVMAGTNSPPE
FT                   RVAQLRAQMGLDKPLPQQYFEWVGGLLHGDFGMTMLTGQPVASVVASRAAITFPLIVLG
FT                   MLVALLFGIPLGYLAVRTTNRAAKALFQTIAIIGGAIPALWGGLLLILLFARGLGVFEV
FT                   FPAQGFPSRGWTDPSRALLSLVLPALTVGMIVGATIMRYTRSSLQTIASSGYVEMAMAC
FT                   GMTRRQALWHVGMRLAMPQLVSVIGLTFAEMVTGVMVIENLFALPGIGTGLVSDLGHRD
FT                   LIAVQSELFMLAAFFLVIGLLVDLTHRALDPRLGEGSNE"
FT   gene            664228..665112
FT                   /locus_tag="Balac_0560"
FT   CDS_pept        664228..665112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0560"
FT                   /product="peptide ABC transporter permease"
FT                   /note="COG1173 ABC-type
FT                   dipeptide/oligopeptide/nickeltransport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45935"
FT                   /protein_id="ACS45935.1"
FT                   /translation="MNRQSVRTHFRRVGIVVSTMWSRGTGRFSLIVLGLWVLVSLVSLF
FT                   WTPRSLWQTDGYNVWAKPSREHWLGTDGTGADVLSWLMAGSRTNLAIVVLTVCFALAFG
FT                   LLLVSLMVSHSTLLANGTVVAIDALISIPTVLIALMLAVPLGASILGIVLACGFGYGLN
FT                   LARVARPQAMLSARSLYVESALSNGASAARVFFTHVLTNIRPVVTVQCSLAAGTAVLAE
FT                   TGLTYLGVGVPSGVPSWGYSLASSVKFITIYPLTVVWPGLIVTVVVMALNLFGDALHDA
FT                   ADPLSNPRLRRVS"
FT   gene            665109..665906
FT                   /locus_tag="Balac_0561"
FT   CDS_pept        665109..665906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0561"
FT                   /product="peptide ABC transporter ATP-binding protein"
FT                   /note="COG4172 ABC-type uncharacterized transport system,
FT                   duplicated ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45936"
FT                   /protein_id="ACS45936.1"
FT                   /translation="MSVDLQSVNVSIAGRQIVRDVCLQIRDGQRVGLIGSSGSGKSMIA
FT                   RAIMGLLPQDTQLSGSINVNGTQTVGMNDVQLARLRGAAMGMVFQNPAASLNPLLRVRE
FT                   QIELPLKLHYDLPAQDRAERVANMAAKVGLPADVLDRFPHQLSGGQQQRVSIATALITS
FT                   PRLIIADEPTTALDSITQQQILELLVGLVDEAGASMLFVTHDFSVLASATQYCYVLREG
FT                   SIVDAGRTDALLADPADEYTAMLVTAARALSLHVDGSGGANHD"
FT   gene            665899..666687
FT                   /locus_tag="Balac_0562"
FT   CDS_pept        665899..666687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0562"
FT                   /product="ABC-type oligopeptide transport system ATPase
FT                   component"
FT                   /note="COG1123 ATPase components of various
FT                   ABC-typetransport systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45937"
FT                   /protein_id="ACS45937.1"
FT                   /translation="MIEEQQKPAALQANAAVKSFGRGRGRHQVLFDVNVEVWPGECLGI
FT                   IGASGSGKSTLTRIMFGLEQPDSGDVLFNGVSILGASGRAQLRSLRAASGIVYQNPFAS
FT                   LDPRWTAGRSIAEPLRLAGERDERGIGGQVSRAMELVGLEPSEFMGRYPMDMSGGQAQR
FT                   VAIARAVVKDPQVMLADEAMSAIDVAARMQILDAFAAIRERDPNMAMVLVSHDLGVVQN
FT                   IADRIVVMHEGRVVESGPSAQILEQPQQEYTRLLIAAASL"
FT   gene            complement(666777..667952)
FT                   /locus_tag="Balac_0563"
FT   CDS_pept        complement(666777..667952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0563"
FT                   /product="cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="COG0626 Cystathionine
FT                   beta-lyases/cystathioninegamma-synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45938"
FT                   /protein_id="ACS45938.1"
FT                   /translation="MTRADTNYAHDGIATRAIHAGQEPDALTGAVSTPIYMTSTFKQDG
FT                   VGGLRGGYDYSRSVNPTRTSFDEQLAAVEGAAFSMSFSSGLAAIDVLLRATMRPGDSIL
FT                   IGNDVYGGTYRLLSKVFVPWGVELDVVDATDVAALNAALGAKSYRYVWVETPSNPLLGI
FT                   TDIALTAQLAHEHGTKVVVDNTFASPILQHPLADGADAVVYSTTKYIGGHSDVVGGAVL
FT                   VNDPEVADAVAFLQNAAGAVPSPFDSWLDIRGLKTLGLRVRKHSANALEIAQWLERRPE
FT                   IERVWYPGLESHPGHEIAARQMHGGFGGMISVQLAGGPEAAQRFASSTRLFTLAESLGG
FT                   VESLIEVPAAMTHASVSGTTLEVPANLVRLSIGIEDDGDLIADLEQALQQL"
FT   gene            complement(668029..669048)
FT                   /locus_tag="Balac_0564"
FT   CDS_pept        complement(668029..669048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0564"
FT                   /product="cystathionine beta-synthase"
FT                   /note="COG0031 Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45939"
FT                   /protein_id="ACS45939.1"
FT                   /translation="MAIHTTVAELIGNTPLVELHNVTDGVRAKIAVKVEYFNPGGSSKD
FT                   RIAERIIGAAEREGKLRPGGVIVEPTSGNTGVGLALVAQQRGYRTVFVLPDKVSETKRA
FT                   VLRAYGAEVVVTPTDVEPDDPRSYYSVSDRLAREIPGAFKPNQYSNLNGPRSHYETTGP
FT                   EIWEASEGGVTHFVAGIGTGGTISGTGRYLKEVSNGAVTVIGADPEGSIYSSPANVHGY
FT                   DIEGVGEDFYPSAFDQTIPDAVEQVTDGEAFLMTRRLAAEEGLLVGGSSGMAVAAAVRY
FT                   AREHDLDESATVVVLLPDSGRGYLEKIFNDDWMIEHGYADIVARTSRPSLVDGVLLEV"
FT   gene            complement(669434..671392)
FT                   /locus_tag="Balac_0565"
FT   CDS_pept        complement(669434..671392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0565"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="COG0514 Superfamily II DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45940"
FT                   /protein_id="ACS45940.1"
FT                   /translation="MTNEREENSALATLRKYFGYESFRPGQAELINAILEGRDVLGVMP
FT                   TGSGKSVCYQIPSLLLHGITIVISPLISLMRDQVDGANEIGIPAAFINTTQTPDEQQQV
FT                   FDAANAGKVKLLYVAPERLETARFRAFATHADIALFAVDEAHCVSQWGQDFRSSYLAIG
FT                   EFIDSLPDRPTVAAFTATATERVRRDIVNLLGLRNPLVMVTGFDRTNLYFDMLKLNTRE
FT                   KANWIAHYVAEHADESGIVYCATRKETEALAQTLNIMVPQLRKAQGSQMEDGPIAAAYH
FT                   GGMPANVRERAQRDFVTDTVPLVVATNAFGMGIDKSNVRYVIHHNMPESIEAYYQEAGR
FT                   AGRDGEPSRCTLLWNESDIVTRRRLLDMADRNERLTPEEQEVVRRSKRQLLDAMIGYCR
FT                   TTDCLHDYMTRYFGESNGTERSADGHCIGGCVNCESTFETVDVSAVARAISMCVHDLGQ
FT                   HYGMGKVVQVLRGSKAQDLANRGLDAAPTYGRLSEVNEAKIRDVLNQMVADGFLVVSEG
FT                   RLPLVQFGPRAAETVAPTFRYEIKKSERKSKSRSSGGDAKSTKLSAGERAAAGLGANTG
FT                   VDAELFEHLRALRMQIAREIGKPPYIVFSDRALRDMAERHPHTSKEFLEVNGVGANKLE
FT                   RYGKRFMEVIRIFDNAS"
FT   gene            671694..672614
FT                   /locus_tag="Balac_0566"
FT   CDS_pept        671694..672614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0566"
FT                   /product="hypothetical protein"
FT                   /note="COG2852 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45941"
FT                   /protein_id="ACS45941.1"
FT                   /translation="MSFEESDSLTRLREASEEAARECRRFRAEHRFGLVYVFGMTRALR
FT                   LAGVEIPRIDLSAHPRLSEQRMQLVVRNKNLEPRVRAQDANHMLAVYVWDAPMDFACLG
FT                   DDLIFTSPICTWAMLARFLSLEELIVLGDSILRRNTVHRQYSQADFKNYLIALRAVKGR
FT                   RAPRGIVKCERALTLMRPGTDSSRETKLRLCIVQHGLPMPMINHRIRAINGNVYYLDLA
FT                   YPDAKIAIEYDGMFHSGQWLHDSDRRNAIEASGWVFIQVTKTSLSDHSHRLMLVRRIAH
FT                   ELEMRTGIHYFVDAQTPLAELVKRR"
FT   gene            complement(672787..673344)
FT                   /locus_tag="Balac_0567"
FT   CDS_pept        complement(672787..673344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0567"
FT                   /product="hypothetical protein"
FT                   /note="COG1670 Acetyltransferases, including N-acetylases
FT                   of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45942"
FT                   /protein_id="ACS45942.1"
FT                   /translation="MPTLHTERLVLRPWRESDAATLYEYAKNPNIGPIAGWPPHQSIEE
FT                   SLDVIRNVFDGPEDYAIALADDPDTAIGAISLKLAGNSDFFPANDTTQAEMGFWIGEPF
FT                   WGNGYIPEAARELLRRGFENLGLSAIWCAYYEGNTKSARTQEKIGFEPIRVTQNVPVPL
FT                   LGETRTEHVNRMTREQWETLIA"
FT   gene            673625..673753
FT                   /locus_tag="Balac_0568"
FT   CDS_pept        673625..673753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45943"
FT                   /protein_id="ACS45943.1"
FT                   /translation="MRSILNMILGLDNTMSGVPVTTMNSAVTLSLMNDGADARVNN"
FT   gene            complement(673885..674088)
FT                   /locus_tag="Balac_0569"
FT   CDS_pept        complement(673885..674088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45944"
FT                   /protein_id="ACS45944.1"
FT                   /translation="MREPDSREVLRMALGTVVFAVITVVLTGFQNGWHSLTTVRGVLDV
FT                   LVPTLLWFVGMLIFHLIRHPRM"
FT   gene            674623..674943
FT                   /locus_tag="Balac_0570"
FT   CDS_pept        674623..674943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45945"
FT                   /protein_id="ACS45945.1"
FT                   /translation="MHGLPSGFTEFANGEVLAQSHCHVEVRVAAAGLWLCRVPCVVLMR
FT                   GTSYLLFAAAVVVPVYCLVFWLLTGSYHPSTIAAFLLVEWLCVGVGVYMLRSVRSLDDY
FT                   AK"
FT   gene            675085..675426
FT                   /locus_tag="Balac_0571"
FT   CDS_pept        675085..675426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45946"
FT                   /protein_id="ACS45946.1"
FT                   /translation="MTQGMENRTMAQCEGADDKCNICPVRSWVQQHRTLLIVCFGVLGV
FT                   LLLLMLGSRKTVLNIANQPSQAGGNAAKVMVIDNHGFSMFQWLTIGNGSNNRPTNSGNT
FT                   SNCANAKRD"
FT   gene            complement(675450..675833)
FT                   /locus_tag="Balac_0572"
FT   CDS_pept        complement(675450..675833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45947"
FT                   /protein_id="ACS45947.1"
FT                   /translation="MRQSLEQVDPQLIAHTLDEGSATDRIDLLDVLYELMERKLYPNKE
FT                   KLDDDEHTKVAWALEDGAYSVTRIRHDSLLFHALFRHFNGNEKALTDALAPSIIDELSA
FT                   DLYALMTPEMLAQRIASLLARNA"
FT   gene            676003..676404
FT                   /locus_tag="Balac_0573"
FT   CDS_pept        676003..676404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0573"
FT                   /product="putative pyrophosphohydrolase"
FT                   /note="COG0494 NTP pyrophosphohydrolases includingoxidative
FT                   damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45948"
FT                   /protein_id="ACS45948.1"
FT                   /translation="MEEPKLIKVVGAAIIKDGKVLCAQRGAGKSLAGYWEFPGGKIEAG
FT                   ETPQQALQREIEEELLCEIDIDKKVCTSDYLYDFGNVQLTTFLCHLIEGMPRLTEHECI
FT                   EWVEPSQMPRLRWAPVDHDAVTRISGMAF"
FT   gene            676457..679582
FT                   /locus_tag="Balac_0574"
FT   CDS_pept        676457..679582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0574"
FT                   /product="superfamily II DNA/RNA helicase"
FT                   /note="COG3886 Predicted HKD family nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45949"
FT                   /protein_id="ACS45949.1"
FT                   /translation="MSSQFQADNTFVRQSQSATEPLESADHGIVDGVLSGLIRQNDLAQ
FT                   ERFVPKLISNQPGSTMGDAIREELRESETFDISVAFVSENALKSMYQSFLDHAENSEKT
FT                   NRIITSTKNYFNTPKAFKELLKLQREANVEVLIWEQQSTEGVSANQPFHPKGYLFTRRM
FT                   EEGDRSYYNLYVGSSNLTSFALQNQREWNLRVSSTGEAQLIEQVREELADQVSQSVPLT
FT                   DAWLAQYEEEFRNYTPPRTQILRQTRTARIEPNAMQRDALANIRKLREEGERKAVVISA
FT                   TGTGKTYLSAFDVRQFQPKRMLYVANRDTILKSARESYQRVLGCDEGELGLLTGNSKQH
FT                   DAKYVFATVDTLRRHMMEWYEPDDFDYILIDEAHHSGANNYRSVIDYFSEADFMLGMTA
FT                   TPERTDNFDIFTLFDHNIAYEIRLQKALDENMLCPFHYYGVHEFLGADGTRVDATEGIS
FT                   KKDKQQIQYSLEELTEPSRVQYIIRKLEQYGSYDQPVTGLVFCSGVEEAERLSELFNQQ
FT                   TNQQAERNYRTVAISGKTAGRDVEGAIDRLESGDLDYIFTVDKFNEGVDIPAINQIVML
FT                   RNTESSIVFTQQLGRGLRKFPHKTCVTVIDFIGNYENNYLIPVALYGNAGDSDSARKNM
FT                   QRESIGLSSISFDEISRKQVLKSLDTASWSDMRMLRDKYSVIRNELGRIPMLTDIYRHD
FT                   PSLVMTMAQKANSYYDFARDTEAMLSRKGHDEGFADALVPIDTQGEQWLKMATEVLLVA
FT                   IRPQELVILDELIKSCAGGSVSLIPTEQLRETVARRFPASYHTAAQFESALSVLDWSFF
FT                   DASTKKSYGERALIERIGDGICLAPEFIAMLKNNATFHRFFVDNVRTGLKRFEDLLEEA
FT                   AKTGHSLQDDRGFVYEHRYKMFEVERLLGWSKQINGSSVGGYLLPKDEKSMPVFIKYAN
FT                   SQYADRFLNPQEMHWYSKDRRSTASREIKWMEEGKGNEEWSENHFIPLFVMRKADAEKL
FT                   KMYYYVGRVGSYSNLHETKRDNDGESIGLVEMDLRLTKPLSTELYQHLTGDA"
FT   gene            680207..680563
FT                   /locus_tag="Balac_0575"
FT   CDS_pept        680207..680563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0575"
FT                   /product="hypothetical protein"
FT                   /note="COG3177 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45950"
FT                   /protein_id="ACS45950.1"
FT                   /translation="MDDLFAWWDNNDISDSVIDDIIRFHYRFLALRPFAQGTGRMSRLL
FT                   LLLQLIARGVLHEPILTMSIWLEGNIAEYRTCLDEAILRGNEQPLLMFFHDGFSDCAGA
FT                   ACNSVVSHSDSYRM"
FT   gene            680996..682963
FT                   /locus_tag="Balac_0576"
FT   CDS_pept        680996..682963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0576"
FT                   /product="type I restriction-modification system protein"
FT                   /note="COG1479 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45951"
FT                   /protein_id="ACS45951.1"
FT                   /translation="MRKVCIMQIMAETKSLEELMPMRGNNAYIIPEYQRYYSWGEEQIE
FT                   QLFNDIQQEDPGYYVGNLLVTNHRDSESTVDVIDGQQRLITLSLFLLAVWEHATKFMDE
FT                   PQKDSGKYISEEQEELIGLRRDIKRQLLLEEKSRMPRLQLLEPDSNGYQALLGVVFGER
FT                   PVKIWHRTLPKRYKYISQKLFADEFRTPEELQSFYNKLNSIITLRVKVTGLEDALTVFS
FT                   SFNSKGKPLTLLDLLKVEFIRAGNEYLHQDSDEVLRSWDRLMSEFSDQQGNTNDAAVTQ
FT                   FLLNNYDAFENDSRSSVTKGKALRYYQRLIDGKYKKGEDYLRTMVRRAQTFAQIVMPER
FT                   AASEHREITERLSKLGKLESTQLYPLLFFLLENRSWLDLDAKRLSTLLDAMVAFYVRRN
FT                   ITLVPKSSNIRAMMLDYIREIQSKKLKGDDVVRCIVGKLGALPQINDDAVRSALLESGM
FT                   YDKNKNTTRFLLIELERRLPGSDLFNKATPDNLDEYDNKTPRWTIEHILPEGANLPEWW
FT                   KEAISPDDPSNAGEIQEQVVHMLGNLTLTPYNSNLKQLPFAADPPYQEGEANYVRSKRD
FT                   YRRDGQFVGLRENLKLNSSLTEPRQPIDEKRDWTAADIKRRTAELADAIVELFDFPEVE
FT                   APGDSAVESHLSKVTDPKAS"
FT   gene            683202..683714
FT                   /locus_tag="Balac_0577"
FT   CDS_pept        683202..683714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0577"
FT                   /product="putative prophage protein"
FT                   /note="COG3600 Uncharacterized phage-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45952"
FT                   /protein_id="ACS45952.1"
FT                   /translation="MLASDVARHIVAHYGDAWFLTNLKLNLLVYWCQVGALRDAGAPLF
FT                   ADEIAVGECGPVIPAIWAEYEAFGSRMIRLRDEWQVKALGENTESLVASVMRELGWLTA
FT                   ADLLNLSNHPDGAWNAAREQGYESISVSHIAGSADMRREVSERTLAACVDGVERKYPNA
FT                   LRLLEHS"
FT   gene            683732..684226
FT                   /locus_tag="Balac_0578"
FT   CDS_pept        683732..684226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0578"
FT                   /product="hypothetical protein"
FT                   /note="COG3654 Prophage maintenance system killer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45953"
FT                   /protein_id="ACS45953.1"
FT                   /translation="MGNAEDGAEPIALDGKQMRMDALAESVFEVYVETIRGTGLDITPT
FT                   APAAVDERILGRVQSVLGSTFLTFFGITPRERYADVFEQISDFASRFAKDHIFPDGNKR
FT                   TAVKMALAILAMHGWNVRADDAEEPERNELYQWVQSIVTGRCDAGELAAFLRGHAVRLE
FT                   D"
FT   gene            complement(684223..684702)
FT                   /locus_tag="Balac_0579"
FT   CDS_pept        complement(684223..684702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0579"
FT                   /product="hypothetical protein"
FT                   /note="COG1247 Sortase and related acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45954"
FT                   /protein_id="ACS45954.1"
FT                   /translation="MSNLTIRHANAGDIDAIMELLRQVNDVHAHGRPDLFIEGKTKYTP
FT                   TELAQIIADDSRPIFVATDTDSTLLGYAFCMDENHAGANNLQPVRTLYIDDICVDERAR
FT                   GKHVGTELYDHVLDYARAHGYHNVTLNAWAANPAAVKFYESLGMSVYRYGMEQIL"
FT   gene            complement(684769..685566)
FT                   /locus_tag="Balac_0580"
FT   CDS_pept        complement(684769..685566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0580"
FT                   /product="hypothetical protein"
FT                   /note="COG3752 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45955"
FT                   /protein_id="ACS45955.1"
FT                   /translation="MTFLIIFLVALAVSAVGFHRYIWFISIGYGFSIAAIGTALLIMFG
FT                   VRHELTAVTAIMAALLVVYGLRLGGYLLAREYRSSSYHKVMQQAIDNGNNVKLPLRLLT
FT                   WVGCALLYACEASPIAFRLQNHAGTDAVAIVGAAIMGVGIILESAADLTKNRFKQQHPH
FT                   RFCDVGLFRMVRCPNYLGEIVTWTGVFVSGVTILDGAWQWIAAIGGYLCICWIMFGGAR
FT                   RLELRQNKEYADDPQYRHYSEHTPILIPFIPLHSLSNAKWLIG"
FT   gene            complement(685674..686687)
FT                   /locus_tag="Balac_0581"
FT   CDS_pept        complement(685674..686687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0581"
FT                   /product="glycerol dehydrogenase"
FT                   /note="COG0371 Glycerol dehydrogenase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45956"
FT                   /protein_id="ACS45956.1"
FT                   /translation="MAKEVRKYIEDYDHPVIITGVKSADAFLDYTGEDEFFAPVLRYDG
FT                   SSSERNARELAEQAKALDADAIIAIGAGKLSDTAKNVAEMMDVDLIIVPTLACACAAYS
FT                   PYSVDYDDEHRFLGVPVHPRNSVALLVDSAMIAQTPPEKFIGGIGDTIAKFYESDPVFA
FT                   QADDLTVFDQLSRQSARLVRDTLLSESEPALDALNQGAYDDPHVRTLIDTIIGIAGTVG
FT                   GFGGVRARESGAHTVHDGLTRIPGSAETMHGEKVAYGVLVQLITEGKEDEARDLLPFYN
FT                   KIGLPHSWKQMNLPFTDENLKTVADFAADPGSPFHAAVPDVTADQIIDAMRTVEAF"
FT   gene            687068..687568
FT                   /locus_tag="Balac_0582"
FT   CDS_pept        687068..687568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0582"
FT                   /product="S-ribosylhomocysteinase"
FT                   /note="COG1854 LuxS protein involved in autoinducer AI2
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45957"
FT                   /protein_id="ACS45957.1"
FT                   /translation="MADEPNTQSKPVVESFQLDHTKVKAPYVRYIDTETGPNGDVISNY
FT                   DLRLVQPNENAIPTGGLHTIEHTIAVLLRERIPGYIDCSPFGCRTGFHLLTWGEHSTED
FT                   VAKALKESLEFIANEATWDDVPATTIESCGNYRDHSLFTAKEWAKDILAQGISSDPFER
FT                   KVV"
FT   gene            687681..688205
FT                   /locus_tag="Balac_0583"
FT   CDS_pept        687681..688205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0583"
FT                   /product="Histone acetyltransferase"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45958"
FT                   /protein_id="ACS45958.1"
FT                   /translation="MQDATNRRFRHATMKDYPQMERIYAHARELMARNGNPTQWGNAFP
FT                   KPQTVKEDIREHRAILLADTLGGKERILAQFALCPGLDPTYAKIEGAWLDNDSYVTIHR
FT                   IASSGLVRHAARDCIEWCLKHYGNVRVDTHPNNKAMQHVLESCGFARCGLIQLIDRTED
FT                   TTRIAYQRHEW"
FT   gene            688281..689648
FT                   /locus_tag="Balac_0584"
FT   CDS_pept        688281..689648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0584"
FT                   /product="alanine racemase"
FT                   /note="COG0787 Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45959"
FT                   /protein_id="ACS45959.1"
FT                   /translation="MVCMSVSALEEWQFSSEQGERNYNQALREYPAQVIVDLAALRDNM
FT                   RHLVDITNREGGPTEVMGVVKADAYGHGLVPSALAALAGGATWLGVAQAREALALRNAG
FT                   IGVDRARVLTWVNNPLHAPYDDLIAADVDLSVATLTAIQKIAEAARAVGKPARVHIKVD
FT                   TGFGRNGFTLAQIDSAIDLLLPLVDEGVFEIVGQWSHLAVADAPAVGEFVEKTDEQIRV
FT                   FEEFTSRLHARGIEPRIRHLANTAATLSRPEIHYDLVRPGVALYGYEADPAMGTPSKYE
FT                   LRPAMTLQAQLSSVKNVGAGEGLSYGRVYVTDEPTSAAIVPVGYADGIHRSASGFNEAG
FT                   SKHVNKPGAPVRVMTRDGARIFHVSGRVCMDQFILDLHGDAENMGVHIGDTVELFGPGR
FT                   GEDYLEPTADDWARAADTISYEIFTCLRNRVPRLYANAFEVLDETDLGKLDQSTLL"
FT   gene            689758..691839
FT                   /gene="dnaG"
FT                   /locus_tag="Balac_0585"
FT   CDS_pept        689758..691839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="Balac_0585"
FT                   /product="DNA primase"
FT                   /note="COG0358 DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45960"
FT                   /protein_id="ACS45960.1"
FT                   /translation="MAGMIKKEDIERVRNAADLYDIVSATVALKPSGVGAYVGLCPFHD
FT                   ERTPSFNVRPSVGSWHCFGCGRGGDVFRFVQEQENIDFREAVELLADKYHIELHYENAG
FT                   GANDSHRGTKRARLLEANEEAQKFFVSQILTEEALPARKLLAGRNFSQQDCARFGCGYA
FT                   PQGWDNLVRHLADKGFTQQEMLDAGLARQGARGIYDYFRGRATWPIRDSTGRTLGFGAR
FT                   KLYDDDSIAAKYINTPDTQLYHKNQVLYGIDLAKPQIVKKRQVVIVEGYTDVMAMHLAG
FT                   VDTAVATCGTAFGEEHAKIVRRLISDDSLGGVQLTGPLRVEGEPLSSRIVFTFDGDAAG
FT                   QKAALHAFGLDSSFQTQTFVAVADNNLDPCDLRIERGDDALRALVVNARPLYDFVIDVA
FT                   IGKFDTQYGTGQMGAVKAVAPLIARIKDKSLLDLYTRKAARRIGIDLTILQREVQSARR
FT                   AQHVPNEDAYASRQRGYDRNYEREREQPPMNEARMREIERGNARSQHFHRIDDNVFITE
FT                   MQFMATLVQIPRAVNAELFKALTVHCFSTPVFQTMFEAVEAAGGLPEPGTSPGQWLHAL
FT                   TKAGGPLLAPVITELAVMNLPLPQNMANGNAAQTGQQEPGSQSAQPMPEASAEQRQYAN
FT                   QLTASLIDTGYMRRIGILRQQASRATNTHDQIRLFGAITEVERERKDLQSQIFGSAAG"
FT   gene            692054..693247
FT                   /locus_tag="Balac_0586"
FT   CDS_pept        692054..693247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0586"
FT                   /product="transport protein"
FT                   /note="COG0471 Di- and tricarboxylate transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45961"
FT                   /protein_id="ACS45961.1"
FT                   /translation="MRHRVGAFLRGETILIVATLLALISCFIVPPDWHYREYVHVSTIA
FT                   QLICLMLVVCGLQRVGVFRIIGAKLLEHVDTARGLVLTFISLTFFSSMLITNDVALLTF
FT                   VPFALAVLKMAKMEDRAILVCTLMTIGANTGSMLTPIGNAHNLYFKALTGMSTGHFLAV
FT                   MGPYTAVSAAMLIAITCIVFRGRRLEGISGMDSKSIEHGVLAPDSTKPQPDEIHVTGYG
FT                   AGYGGWRVIVYAITFIVCVLAVGDLIPLWVMCVVVFAVMMVCDRRSFRHADWGLPLTFI
FT                   MFFIFIGNMRRVPEFAQLAQQCVGVHPLGVSILFSQVISNVPTSLLLAGFSNAYVPLII
FT                   GTNLGGLGTLIASMASLVTYKHFTKMYPNQKGKYLKEYTSFCALFVLVLFGLSCILE"
FT   gene            693425..693498
FT                   /locus_tag="Balac_0587"
FT   tRNA            693425..693498
FT                   /locus_tag="Balac_0587"
FT                   /product="tRNA-Arg"
FT   gene            complement(693549..695396)
FT                   /locus_tag="Balac_0588"
FT   CDS_pept        complement(693549..695396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0588"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /note="COG1154 Deoxyxylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45962"
FT                   /protein_id="ACS45962.1"
FT                   /translation="MTHDLLSQVLSPSDVKLLDPTQLDALCAQIRETLVEYGKRYGGHI
FT                   GSNLGLVEACVALHVVFESPLDKIVFDVSHQSYVHKMLTGRAEAFRRAELFGTVTGFTN
FT                   PGESEHDHFVLGHTGTSISLACGMAKERDMVRAAGGTAQTNNVIAVIGDGALSSAIAFE
FT                   GLNNAAEQGGNMIILVNDNEMSIAENHGGMYATLAAMRESHGRGERNLFRDFGLDYRYV
FT                   EHGNDVHELIRAFEEVHGIDHPVVVHIHTTKGLGLDAEDAAQGVCEGRCEANHWQNPLS
FT                   RADSSLGARKYYGGLAMASLERRFATEPGLVVISPATPGSNGITQDFRERAGAHYVDTG
FT                   ITEEHAVAFASGIAKAGGRPVVATSATFFQRTFDQLQQELALNDTPVTLLSFGAGLSDA
FT                   DNTHSGAFDIAMFGNIPGLTCLAPTSRRMFLDMLGWSTSARNTHPVVIRVPGDTILKDE
FT                   RAGELDPEASLAPQKTDLLKPWFGYDVVSDGTDVAVLGLGNAFATAHAVVERLADSSPA
FT                   IAATLINPLQFSSLDEQTLRSLAEDHRVVVTLEDGQLEGGWGEKITAFYANMMPDCTMR
FT                   VLNFGADKEFTDRTPLAELNSRYGMTVESICSRIHGLLD"
FT   gene            695656..696153
FT                   /locus_tag="Balac_0589"
FT   CDS_pept        695656..696153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0589"
FT                   /product="phosphoribosylaminoimidazole carboxylasecatalytic
FT                   subunit"
FT                   /note="COG0041 Phosphoribosylcarboxyaminoimidazole (NCAIR
FT                   mutase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45963"
FT                   /protein_id="ACS45963.1"
FT                   /translation="MTANKPQVAVIMGSASDWETMRYACEMLDRFEVPYMKQVVSAHRT
FT                   PELMGEFAHNARANGLKIIIAGAGGAAHLPGMVAAQTTLPVIGVPVRSHALSGWDSLLS
FT                   IVQMPGGIPVATTAVGNSGATNAGLLAVSMLSMNDERLADALQAYRDELKEKVEQSNAE
FT                   LI"
FT   gene            696137..697288
FT                   /locus_tag="Balac_0590"
FT   CDS_pept        696137..697288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0590"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   ATPasesubunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COG0026 Phosphoribosylaminoimidazole
FT                   carboxylase(NCAIR synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45964"
FT                   /protein_id="ACS45964.1"
FT                   /translation="MPSLSDETGGQITRLLPGATIGIVGGGQLGRMMALAAKYMGFRIG
FT                   TLDPTPDCPTAQVADFQIVADYDDQDAIHELAERSDVLTYEFENVDADALDAVRDIVAI
FT                   PQGTDLLRVTQNRIAEKTFINDHGIATAPWRPVGSRAELDAALAEIGYPAVLKTCEGGY
FT                   DGHGQIVLRTPDDLAEVWPDEGFPQAILEGFVDFAFEASILVSGNGDDYQTFPIVRNIH
FT                   RDNILHLTLAPADVDEQVARTAHELALELARGFKLAGTLAIELFVKADGTVIVNELAPR
FT                   PHNSGHYTIEACDFDQFDMHVLGIAGWNLPTPRLLSPAVMVNVLGQHIAPTQAVEPMHP
FT                   EWHVHDYGKAEAKFNRKMGHITVLCENPRDAAQSLEQTGCWDC"
FT   gene            697329..697730
FT                   /locus_tag="Balac_0591"
FT   CDS_pept        697329..697730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0591"
FT                   /product="metal uptake regulator ferric uptake regulator
FT                   protein"
FT                   /note="COG0735 Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45965"
FT                   /protein_id="ACS45965.1"
FT                   /translation="MGERNTRQKDVIREALQGADDFISAQQLHARLEDAGEHIALATVY
FT                   RQLGTMADAKQVDTVRLNGQQLFRLCNAGGHHHHLMCVSCGRTVEIDPPSEAWLQSVAQ
FT                   QHDFTIESHTLEVFGLCADCRAARGDCAA"
FT   gene            complement(697831..700599)
FT                   /locus_tag="Balac_0592"
FT   CDS_pept        complement(697831..700599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0592"
FT                   /product="hypothetical protein"
FT                   /note="COG2898 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45966"
FT                   /protein_id="ACS45966.1"
FT                   /translation="MSATDSNDGVASGQTQAAAKPPTSPKPPKAPKRYAAQPVSNQLLN
FT                   DIRRWIHEQSFALWVTFGFIMINVCWWAWYNIEHHKMPRHALTTSLHEFNVGHLIASLF
FT                   LTGSVFQMIVDALLILLVLCLAEPYLGKSRTAAISLVSAASGTLVGLIICSAISAMLGE
FT                   RAEVLNISFTLSPVVLVIGALMAATAFSYQLWRRRIRIIGYTAIMVVVLYGGNPGDYCV
FT                   LFAAIIGQIIGRAIAGKPIEAEQWHWQYSSSQEIRRIFGAIGVVLALGPMVATSSRSHA
FT                   GPLVSVALVLSPESVNTGVLAACMHGHVVDGCLQQYSLMRASQPGDVVRSVLPLLVMLA
FT                   LAWGMWLGRRTAAISSIVFYAASAFFAISYYLLPYSLDDQLHITMGNIPRMILVNALIP
FT                   LIYAIAVIIELPHFSIRTKPRTLRRCVAAIVIAFVVCSAIYLLFACLRPQDFTPHPNVG
FT                   MVLREWPARFLPIGYLTDSSISFIAVTPLASLVLQGVGIVFWIVLVVVSFAWLNASIDY
FT                   DHKAHALAEELVEDGGESMSFMTTWEGNEYWLSPSKRSAVAYRVLNHIALTTTGPFGDP
FT                   DEWMSDMDEFARYCSDHSWSPVFYAIHEEAKDHLQQLGWHSIVVGDEMLIDPQSWKTTG
FT                   KKWQDIRTAINKAKREGIVDEMSTYDEAPHEVQVQIEEISEQWSEGKALPEMKFTLGGV
FT                   EELKDPRVQVLYAIDSDGIVQAVTSWLPTFNNGRVIGWTLDFMRYRSGSYNGIMEFLIA
FT                   RMAQRMHDQGVADPSNQVQFVSLSAAPLTGLKNFTDAKSDDSSNVDGTTMLQHSLALVA
FT                   DLLEPAYGFKSLYNFKKKFQPIERPVYISYSDSALLANLGIAIIRAYLPALTFRDALGM
FT                   LSSFKPAKPKDDGKATGHGQPAGSPRDAAHESEVHDAKGGKPVDDQAGEPR"
FT   gene            complement(700596..701969)
FT                   /locus_tag="Balac_0593"
FT   CDS_pept        complement(700596..701969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0593"
FT                   /product="Putative esterase"
FT                   /note="COG0627 Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45967"
FT                   /protein_id="ACS45967.1"
FT                   /translation="MAGIKDWFYAIDVISGWFPVTIWTLVAIGIVVLLICQRKGESRKR
FT                   FLRQLGIGLLAGIVGLAATYVCSDVLLLFGVSLGWPVIIAIGVGVFLFAFMIAAAVMTH
FT                   GWLRVLSIVMIPVTLLATAVRANAIYGEYQTMGSLFDYSPYPHISTLDLSLNTISVREW
FT                   NEQAVAKSRNTTQIPQSGKLVHVDIPNPKSGFKAREALVWLPPAAFAKHPPKLPVMVMF
FT                   AGQPGSPTRFFTASNAIEVLGRFAAEHHGLAPIVVSPDQNTAATRNSLCADTTKWGKAE
FT                   TYLAQDVPDWIKANLPVNDKASQWTIGGFSQGGTCATQLAPNHPNIYGNVLAVDGEVAP
FT                   TEGSVDHMVEAYFSGDKAAYERQVPQNAIRNNAPSKQLMILGAGARDGESVDNIRKIGD
FT                   TARENGWTVFRFAVSNWGHDWHAVNAVFAVALPYLCERMGLGNENVQFPTDSEVKEIS"
FT   gene            complement(702162..703424)
FT                   /locus_tag="Balac_0594"
FT   CDS_pept        complement(702162..703424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0594"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="COG0151 Phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45968"
FT                   /protein_id="ACS45968.1"
FT                   /translation="MKVLVIGSGAREHAIAYTLLKGASVEEVTVAPGNPGMELDGIRTL
FT                   SLNPSNQAALIDFVRNNDYDWVFVGPEVPLIEGIVDALAAAGIKAFGPSKAAAQIEGSK
FT                   DFAKRLMERHNIPTAAYRTFDDLRSATDYVNEHGAPIVVKADGLAAGKGVTVAMDVETA
FT                   LDALNDIFVDHRFGSAGARVVIEDYLEGQEFSLMSFVNGTEFWPMPISQDHKRAYDNDE
FT                   GPNTGGMGAYSPVPQIGQDVVDEALETIVKPTVEAMASEGTPFVGILYAGLIATADGPK
FT                   VIEFNARFGDPETEVILPRLHSDLGQAIQAMLDGEAPEFTWLEEGTTLGVVLAADGYPT
FT                   NVLKGAKVPQFKTGTDSHVFYAGVKREGDDLVADSGRVLLVEVSADDIPSARKKVYEIL
FT                   DNADTAGMFYRHDIGAKALQA"
FT   gene            complement(703472..704506)
FT                   /locus_tag="Balac_0595"
FT   CDS_pept        complement(703472..704506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0595"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /EC_number="6.3.3.1"
FT                   /note="COG0150 Phosphoribosylaminoimidazole
FT                   (AIRsynthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45969"
FT                   /protein_id="ACS45969.1"
FT                   /translation="MPQAYENAGVSVEAGYEVVKRIKSHVARTNRPGVVSGIGGFGGLF
FT                   DLASLGYNEPVLISGTDGVGTKLVIAKLMDKHDTIGIDCVAMCVNDVVAQGAQPLFFLD
FT                   YIACGKNDPAVLEQVVSGVADGCVQAGAALIGGETAEMPGMYDEDEYDLAGFTVGCVER
FT                   SKIVDGSTIEAGDVLIGLPSTGVHSNGFSLVRKALFEQAGYTVHTRLPELDDRELGDVL
FT                   LTPTKIYVKALMPLFEANLVRGVAHITGGGFIENVPRMLPEGLAASIELGSWPVPPIFD
FT                   VIEKAGDVDHMEMYNIFNMGLGMVVAIRPDRVDEAMNLLEHAGEKAYRVGHVIEQVNER
FT                   VDLA"
FT   gene            complement(704583..706139)
FT                   /locus_tag="Balac_0596"
FT   CDS_pept        complement(704583..706139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0596"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="COG0034 Glutamine
FT                   phosphoribosylpyrophosphateamidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45970"
FT                   /protein_id="ACS45970.1"
FT                   /translation="MSAELEEIHEECGIFGVWGHPDAARLTYFGLHALQHRGQEGAGIV
FT                   SNDHGHLVGHRGLGLLTQVFQDEKDIQRLQGDAAIGHVRYATAGSGGIDNIQPFVFRFH
FT                   DGDMALCHNGNLTNCFSLRRALEDEGAIFHSNSDTEVLMHLIRRSMRSGITDKLQEALN
FT                   TVHGGFAYLIMTEHEMIGALDPNGFRPLSLGRMTNGAYVLASETCALDVVGAERIRDIQ
FT                   PGEMIVIDDSGYRTQTYTSRTQLSICSMEYIYFARPDSDIYGVNVHSARKRMGARLAQE
FT                   SPVDADMVIGVPNSSLSAASGYSEEAGLPNEMGLIKNQYVARTFIQPTQALREQGVRMK
FT                   LSAVKSVVKGKRIAVIDDSIVRGTTSKRIVQLLKEAGAAEVHMRISSPPLKYPCFYGID
FT                   ISTTQELIAAKKSVEEIREFIGADSLAFLSVDGLIESIGLHADAPYGGLCVAYFNGDYP
FT                   TALDDYEEGFLNSLTPEDRVTLPGYNGKKTMYEGTEYTMMQKPFGEHASQEPTEYLVPN
FT                   I"
FT   gene            706392..707870
FT                   /locus_tag="Balac_0597"
FT   CDS_pept        706392..707870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0597"
FT                   /product="DNA-repair protein"
FT                   /note="COG0389 Nucleotidyltransferase/DNA polymerase
FT                   involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45971"
FT                   /protein_id="ACS45971.1"
FT                   /translation="MAVDLKSFYASAECVARGLDPLDANLVVADVSRTSKTICLAVSPA
FT                   LKSFGLGSRARLFEVEERVGVLNEQRRLRAPGHRLAGSSVSAAQLQADPRLGIEYIAAK
FT                   PRMSYYLDTSAKIYGIYLNYASKEDIHVYSVDEVFIDVTKYLKYFGCSAHELARRIVAD
FT                   ILEQTGITATAGIGANLYLAKVAMDIVAKHIPADEDGVRIAELDERRYRELLWSHRPLT
FT                   DFWRVGRGIARKLERQGIMTMGDIARCSLGRAGEYYNEDLLYRFFGVNAETLIDHAWGW
FT                   EPCTIADIKAYTPENSSLSIGQVLARPYPHTQAHTVASEMADCLAQDLAAKGAVTDQVV
FT                   LTVGFDRESLMDGRYLGPVGKDHYGRPVPKSVHGSCDLGRFTSSATAIRQAVVDVFERI
FT                   ADSRLYVRRLTVVAGRVRMLGETQTFEQPSLFEDLEGSQTQQQATADRKELSLQRTVNA
FT                   LRSRFGAASVIKGVNLDEGATGMERSKQIGGHAA"
FT   gene            707867..708280
FT                   /locus_tag="Balac_0598"
FT   CDS_pept        707867..708280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45972"
FT                   /protein_id="ACS45972.1"
FT                   /translation="MTLENLHRYDDIIDLPHHRSTKHRHMSNLERAVQFMPFAALKGHD
FT                   ERVREVSSTPCTRIALADDERETLNDRLVEVIGQLESHPYASITYFQPEGGRDAGEYMT
FT                   AEGAVRRFDQMRRVIVMEDGTRIALVNIVDIRC"
FT   gene            708287..709570
FT                   /locus_tag="Balac_0599"
FT   CDS_pept        708287..709570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0599"
FT                   /product="GTPase protein"
FT                   /note="COG3597 Uncharacterized protein/domain associated
FT                   with GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45973"
FT                   /protein_id="ACS45973.1"
FT                   /translation="MKVLCAHGVAFVRAYDGVMAYDNGNVIDVRANTTLSTENAIKGNV
FT                   LVLGNSGVGKSTLINAVIGDTVAKTSFGTRGTTSELAVYESPTVPFRVIDSIGFEPSPI
FT                   KSLRAVHAVRKWSKASAKEGHEHNKIDVIWFCVDGTAAKLFPETIRNLSTAVSMWRSVP
FT                   IITVITKSYSKPDRELNVQMVRQAFAGQRMERNLRAIIPVVAQTYVIDETAFAGPEGIS
FT                   DLIDETMKAMPEGMRGGSHDLMAFKLTRKRVLAQGLIGACVAAGATVGAVPIPIADSLV
FT                   LSPLELGELHGLARLYGIDKDEGSKQFLDSIVQVGTASVVAHSAISAVKSIPGVNIAAS
FT                   VLNAIVAASIIAALGEGAVIAFEQVYSGKRSVNDVTWVQNLMQEQFGEGFLGKVSGVAQ
FT                   ASAKAGDAKDMREMIVELVKAAFMNRGE"
FT   gene            709733..710404
FT                   /locus_tag="Balac_0600"
FT   CDS_pept        709733..710404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0600"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45974"
FT                   /protein_id="ACS45974.1"
FT                   /translation="MDGNNDAGRSIPAISKKWKIAGVVIAALSCMVVGCLLMLGFYSLF
FT                   PGTMPAFLKEKVGTSDTQVIRSMERTKEVALLRLGITGIISQENKSHFFNMEIPGTERA
FT                   RFIQYTFDAKLGFEGKDVSIKETGKNTFDVEIPEFKFIGYDHPEYRMIVEQNGALSFGT
FT                   QQIDSLDMINNILTEKTKQEYVDSNRDLLEEQAKSFYASIVMGVNPEAKLNFTFQTPKG
FT                   S"
FT   gene            complement(710572..711081)
FT                   /locus_tag="Balac_0601"
FT   CDS_pept        complement(710572..711081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0601"
FT                   /product="hypothetical protein"
FT                   /note="COG3467 Predicted flavin-nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45975"
FT                   /protein_id="ACS45975.1"
FT                   /translation="MRRADREVRSFEEIIDILRNCTEVRVAYQDAQGLTIVPVNFAFVY
FT                   NNDDSSHNLRLLMHSATQGRKIEAIHASGNALPVAFEMDCDSLIYTGRTPCATSTAYRS
FT                   IIGTGVASLLNDEHEKIDALKLLMKQRTDMHNVELLPRQVSKVAVWQIISTEFTAKAHP
FT                   LPSDMR"
FT   gene            complement(711266..711862)
FT                   /locus_tag="Balac_0602"
FT   CDS_pept        complement(711266..711862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0602"
FT                   /product="hypothetical protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45976"
FT                   /protein_id="ACS45976.1"
FT                   /translation="MDAHELTQAAFVSELNKQYLSRFHQKDVSRWLNSGNKTSTGTIGF
FT                   PKYETMAMIADFFGVDVGYLTGETDETSFDLEHASEYLGMSGESVAALRGWIIGEDADS
FT                   QMRNYRSETLNALFESPKFASVASKLLTLHEMSTLWKSNPERFNTLMESLASDSDLPDD
FT                   LTFQLIIGAFYGMASESFSTLLKDAYPTPTEQATA"
FT   gene            complement(711991..712167)
FT                   /locus_tag="Balac_0603"
FT   CDS_pept        complement(711991..712167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45977"
FT                   /protein_id="ACS45977.1"
FT                   /translation="MAAFLSDEVVRTAGWTAKPSGLAFLVIKGHVFFANPSSICMNARN
FT                   FNDSDELLHLESI"
FT   gene            712166..712309
FT                   /locus_tag="Balac_0604"
FT   CDS_pept        712166..712309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45978"
FT                   /protein_id="ACS45978.1"
FT                   /translation="MFAQIASMILRGIREFDEVARELEKDISGDGSQQTNSGQSTDAKT
FT                   ER"
FT   gene            712413..713951
FT                   /locus_tag="Balac_0605"
FT   CDS_pept        712413..713951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45979"
FT                   /protein_id="ACS45979.1"
FT                   /translation="MADQIYMASVESTYAAMEQMLQFSAVLDVVSRNADERTVTFSVPG
FT                   INGLFTAKVAEGDAAGSSKVTVTAPIDGGDKAQESVAKFYKDLGDQLMVQGAVQSAPQQ
FT                   TPVFDAQNQPTQTFQAPVPAAAGNGGNPAQGTKNKFVAMLTDTNTGKTSVMAIAAAVVS
FT                   AVFLIFGFVSLGMHPPVVVGIIFAVVAAVLCALAYTKTQPGREHGRMLTVVAAGVTVVA
FT                   LTLSLVGAAGGSKSHGSMKEASSSSSPSSSDDDPFCKPISWPSAGVGAKAPKPNSLKGY
FT                   VWTDDADYVNIKLCDVDDAAYTDYLNKVKDSGFVEDYKSTSGDYSAKDSEGNFIDLTFF
FT                   SSLTELDVTVKSAERYQNDLSEKEKQEEEAEAKKKAEEEAKNKAEAEKAAAEEAKKAEE
FT                   EQKRLAEEEKKLKEEAAEKQNTQSNAANGVTPDVKEALDGYETFMNKYCDFMEKYAKEG
FT                   RPAGMLTDYLEMLNEYTDYTQKLSNLDQSAWTDADMNYFIEVTNRVNQRLASVS"
FT   gene            713977..714705
FT                   /locus_tag="Balac_0606"
FT   CDS_pept        713977..714705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45980"
FT                   /protein_id="ACS45980.1"
FT                   /translation="MSASTPAVNRVPVARQTFRAPVAEVYAALVQTLHFSAGFDVVAND
FT                   DVTHSVRFRLPNDNGEYEARVIADGMHSAVIIEAPAGTAGGSAAYSRLYRELAEQIVAQ
FT                   STVVPHDVIAKRRFRQAIVADNDGPRSKWAIGAVVFACGALLGALAMFSDLRPDWQVCV
FT                   TLIVSLFVVCGIAFAVTGRNGKVSGRNLVLIAFAISCLASVLLLCATIVVQIRYSTTLA
FT                   ISETMAQTASALPLEMPKQQ"
FT   gene            714746..715195
FT                   /locus_tag="Balac_0607"
FT   CDS_pept        714746..715195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45981"
FT                   /protein_id="ACS45981.1"
FT                   /translation="MNKKSLAGPRALTIIGSLAMLVSLVLPYATSSNDTMTAFTIAERW
FT                   KEMQSVANMSVGVSEIILVMIIAIAIFTVLALIFALAAKGIPTLVFVVLAILAYVYFNL
FT                   SFTPYGSYGFGFGVYLFYVAAIAVIAGSIWMIAIKRHNKAAIPNM"
FT   gene            715269..715853
FT                   /locus_tag="Balac_0608"
FT   CDS_pept        715269..715853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45982"
FT                   /protein_id="ACS45982.1"
FT                   /translation="MRSVNLLPNEGIVAQFDSVRCESPDFKGCESGELTFTTMSLIFSY
FT                   TQVKVFGKDIEHTFLWALHDIKVVDGRPQLIIDKGDAHQCDILLRKGKLELRMDSHADL
FT                   VTLANGINKLITGNDEDIVGAPKTFISGIASMLSDAGKEVTEAFGLRNTANPKSAESKM
FT                   VSRACAGCGAPLHGRQGTSVTCEYCGRSEQL"
FT   gene            715885..717117
FT                   /locus_tag="Balac_0609"
FT   CDS_pept        715885..717117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0609"
FT                   /product="Putative virion core protein"
FT                   /note="COG4260 Putative virion core protein (lumpy skin
FT                   disease virus)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45983"
FT                   /protein_id="ACS45983.1"
FT                   /translation="MALIRAFAGALSGTFADQWLDIITVGQFDEHAVLMPGIYQETNRD
FT                   RGSNTKHSEAVISNGSRIYVPENTAAFIFDQSGIENIITESGGYEYRTGGTDSVFAGNG
FT                   IGKSIFEQIGERFKYGGEPVANKRIAFVNLREIRGIKFGTPAPLMYHDRFYQTDLEIRA
FT                   RGMMSVQVVNPLAFIRQFVPPNVDYISFDDPNTKSQILSEFMQSFSVALNSLSNEYRIS
FT                   ALPSQANSIALAISGDSSNAGTWESRFGLHLVGIGIESIEFTDESRELVKQYSSNRMNL
FT                   SAYENISQQASNIAAQQKIAEGVQQNGFGDMGGMMLGLGFAQGVNPMTGAMPGQSVPTQ
FT                   TNPAAAAAVAADAQGTVAQAAAQPPAAQGTQSAMSVTEQMEALKSLKELLDAGILTQEE
FT                   FNVKKRQILGL"
FT   gene            complement(717419..721153)
FT                   /locus_tag="Balac_0610"
FT   CDS_pept        complement(717419..721153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0610"
FT                   /product="hypothetical protein"
FT                   /note="COG0046 Phosphoribosylformylglycinamidine (FGAM
FT                   synthase, synthetase domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45984"
FT                   /protein_id="ACS45984.1"
FT                   /translation="MVFRVHVEKKPGFDVEAQQLTNELRTILGIESLNNVRIINRYDVE
FT                   GISEELFGQTIPTVFSEPQVDNVSIELPDVSGDTVFAVESLPGQFDQRADSASECIQLI
FT                   SQGERPTVRSARVYVLDGQLGDDDLAAIKKYVINPVETREAGLETRETLATYAPTPQPV
FT                   EVLDGFREMDDAQLAEFIADRGLAMDEADLRFVREYFQGEQRDPTITEIKVIDTYWSDH
FT                   CRHTTFGTELDSVEIDDAVVKAAFDKYMAMRHELGRDEKPVCLMDMGTIGAKWLKKNGV
FT                   LTGLDESEEINACTVKVKVDVNGESEDWLFLFKNETHNHPTEIEPFGGAATCIGGCIRD
FT                   PLSGRSYVYQAMRVTGAADPRVPISETLEGKLPQRKLVTTAAHGYSSYGNQIGLATGQV
FT                   NEIYHPGYVAKRMEIGAVVGATPASHVRRETPAPGDKIILLGGRTGRDGIGGATGSSKA
FT                   HNVESLELDGAEVQKGNAPVERKLQRLFRRGDACRLIKRCNDFGAGGVSVAVGEIADGL
FT                   HVDLNQVPKKYDGLDGTELAISESQERMAVDVAAEDVDEFLKYAAEENLEAVVIATVTE
FT                   DPRMVMEWNGEPIVDLSREFLASNGAAKHQDAHVPQQGSYRAPFSSGSLSERMNEMLSD
FT                   INIASNKGLSERFDSTIGAATVLMPFGGKEQLTPAEAMVAKFPVFGETTTASAMAWGFN
FT                   PFLMERNQYTGAYMSVVESLAKLVAAGFEHEKAYLTFQEYFEKLRDEPERWGKPLAAVL
FT                   GALMAQVDLGVGAIGGKDSMSGSFEDLDVPPTLVSFAVAVGDMNRATSPEFKHPGDRVV
FT                   RIAPRYLADGITPDKDALLEVFSTIENLVTDGDALAISTPAYGGTAEALFKMCVGNRIG
FT                   VALDDSIAVDDLFAPAYGSFIVELAPSANMPTVSNLVEIGPIGETTADYVFHAAGETLD
FT                   LANLQEVWENGIASVFPYRSGETDAEAEAVDAISFETMEPTVYKGAKIAKPRVIIPVFP
FT                   GNNCEYDTAAAFERAGAEAQTLIVNNLTPSAVAESTQALVDAIHNSQIIMIPGGFSGGD
FT                   EPDGSAKFITAFFRAPAVTEAVRDLLNNRDGLMLGICNGFQALIKLGLVPFGDIVPMTA
FT                   ECPTLTFNTIGRHQSRLVRTRVASNLSPWLAKTEVGDMHTIAISHGEGRFVASDGMLDQ
FT                   LIANGQVATQYVDEHGVPSMDLSVNPNGSMLAIEGITSPDGRVFGKMGHSERTGDGLYR
FT                   NVPGNIYQPIFEAGVEYFG"
FT   gene            complement(721263..722015)
FT                   /locus_tag="Balac_0611"
FT   CDS_pept        complement(721263..722015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0611"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamidesynthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="COG0152Phosphoribosylaminoimidazolesuccinocarboxami
FT                   de (SAICAR synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45985"
FT                   /protein_id="ACS45985.1"
FT                   /translation="MQKLDKLYEGKAKKLYATDDPDVLWVEYMNQATAGNGAKKAQIEG
FT                   KGELNNQITSVIFDLLKARGIDSHFVKRISDTEQLVRKMDMYPLEIIMRNTAAGSFAKR
FT                   YGVEEGTALDKPILEFCVKSDELGDPFINDDGIVALGIASEEELDEISRQARAVNDALK
FT                   DIFSKIDVQLVDFKIEEGKTGDGRILLADEITPDTCRLWDLKDGSGQIEHLDKDLFRRD
FT                   LGNIIPAYEEIYDRLVKLAEAEGVERAE"
FT   gene            complement(722152..723393)
FT                   /gene="purT"
FT                   /locus_tag="Balac_0612"
FT   CDS_pept        complement(722152..723393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="Balac_0612"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /note="COG0027 Formate-dependent
FT                   phosphoribosylglycinamideformyltransferase (GAR
FT                   transformylase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45986"
FT                   /protein_id="ACS45986.1"
FT                   /translation="MILGTPFGEHPTRILMLGSGELGKEVTISLMRLGAWVCAADSYNG
FT                   APAAQVAHEARVLDMANADALRNVIGDVKPDIVIPEIEAIATDVLFEAEQAGIRVVPSA
FT                   AIASICMDRERLRQLAADELGLPTTKFEFAGSLQELKEAATRIGFPCVVKPVMSSSGHG
FT                   QSVVRSADKIEDAWNEAQTGRRAHGEGDVSRVIIEQLVDLDYELTMLTVSSSAGIVVCE
FT                   PIGQRQESGDYRDSWQPAAVEPDHRQEVKRIATQAVQGLIAHAGTDTAWGVFGVELFVL
FT                   KDGTVLFNEVSPRPHDTGMVTMISQYLSEFDLHARAVLGIPVSKAHIGLDLPKYYGAAS
FT                   HAIVVEGNGEVEFSNLQTALATPGTDLRIFSKPRVEGHRRMGVTLAIGSDIDEARIKAN
FT                   ECAQNLRIVVNPAK"
FT   gene            723519..724721
FT                   /locus_tag="Balac_0613"
FT   CDS_pept        723519..724721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0613"
FT                   /product="glycosyltransferase"
FT                   /note="COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45987"
FT                   /protein_id="ACS45987.1"
FT                   /translation="MEAHNEAASPQSASDNATDRPLTIALVVDTFGNRGNGTSNSALQW
FT                   AQELERQGHKVRLVGINAPEYPARENHIPLVSWISAKQQMHFAQPSATLFDRAFDGVDV
FT                   VHIYTPFKFGRHAMAAARAKGLPVTAGFHVQPENVMYSAGPARWIPGMDRFIYWLFRRW
FT                   LYSRVDAIHVPTNLGKQLLLDHGYAKPIFVISNGYAPRFIPKEQRKGDAAPQIPVRIIA
FT                   SGRLSNEKNHVELIEAICRCAHADDIHLTIAGTGPIRNKLVRFAKRKLKRPASIGFHKN
FT                   STMPQLLRSADLLVHPSIADLESVSVIEGMASGLVPVIADSKLSAAGQFSLCPQSSYPV
FT                   GDVDALAERIDWWIDHPRELNTWGDTYARHTKDTYSVEESVRRFVEMERQIISDHTVSS
FT                   R"
FT   gene            complement(724790..725815)
FT                   /locus_tag="Balac_0614"
FT   CDS_pept        complement(724790..725815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0614"
FT                   /product="low specificity-threonine aldolase"
FT                   /note="COG2008 Threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45988"
FT                   /protein_id="ACS45988.1"
FT                   /translation="MLSFENDYSSTAAPQIVARMQAMANEQNSGYGKDQYCDAAANKIR
FT                   KACDAAQADVWFLVGGTQTNQTVLSAITPQYAGVVCPESAHINTHEAGAIEATGHKVLA
FT                   LPQHDGKITGEQLDEYCQSFENDLNHEHMVYPGCVYISQPTEYGTVYTREELASISQVA
FT                   HDHNLPLYVDGARLGMALTADMNDVQLPDLARLADVFTIGGTKCGTMFGEAVVFPRGNS
FT                   PRNFTTIVKQHGALLAKGWLLGLQFDTLFTDDLYFKLAKHANAEADKIRKALFEKHYDI
FT                   EYISQTNQIFIVVTTQRAQELTKSVKLGFMEQVDADHVMLRICTSWATTDEQVDELIKL
FT                   L"
FT   gene            complement(726020..726095)
FT                   /locus_tag="Balac_0615"
FT   tRNA            complement(726020..726095)
FT                   /locus_tag="Balac_0615"
FT                   /product="tRNA-His"
FT   gene            726586..726720
FT                   /locus_tag="Balac_0616"
FT   CDS_pept        726586..726720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45989"
FT                   /protein_id="ACS45989.1"
FT                   /translation="MDARPVGDSKPRHAAESEKCVPYVMAGEWWNIPFAPLLSMVMGS"
FT   gene            727059..727367
FT                   /gene="rpsL"
FT                   /locus_tag="Balac_0617"
FT   CDS_pept        727059..727367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="Balac_0617"
FT                   /product="30S ribosomal protein S12"
FT                   /note="COG0048 Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45990"
FT                   /protein_id="ACS45990.1"
FT                   /translation="MALKGSPLRRGVCTRVYTTTPKKPNSALRKVARVRLSSGIEVTAY
FT                   IPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKDRKQGRSLYGAKKAK"
FT   gene            727373..727843
FT                   /locus_tag="Balac_0618"
FT   CDS_pept        727373..727843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0618"
FT                   /product="30S ribosomal protein S7"
FT                   /note="COG0049 Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45991"
FT                   /protein_id="ACS45991.1"
FT                   /translation="MSRKGPSKKHQVLPDPIYGSIVVAQLINKILLDGKKSIAEDIVYS
FT                   ALDMVKDKTDQEPVAVLKRALDNIRPSLEVRSRRVGGATYQVPVEVKPARANTLSLRWL
FT                   TDFSRARREKTMAERLANEILDASNGLGASVKRREDTHKMAEANKAFAHYRW"
FT   gene            727877..730006
FT                   /locus_tag="Balac_0619"
FT   CDS_pept        727877..730006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0619"
FT                   /product="elongation factor G"
FT                   /note="COG0480 Translation elongation factors (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45992"
FT                   /protein_id="ACS45992.1"
FT                   /translation="MALDVLTNLNQVRNIGIMAHIDAGKTTTTERILFYTGKNYKIGET
FT                   HEGASTMDFMAQEKERGITIQSAATTCFWNRQTHDPDEKFQINIIDTPGHVDFTAEVER
FT                   SLRVLDGAVAVFDGKEGVEPQSETVWRQADKYGVPRICFINKMDKLGADFYYSVSTIKE
FT                   KLGATPLVVQLPIGAENDFSGVVDLIRMKAYVWNDIKDDQGAHYDTVEIPDDLKERAEQ
FT                   YRSELLDQVAETDEELLEKYLENGDLSEQEIRGAIRQLTIAREAYPVLCGSAFKDKGVQ
FT                   PMLDAVVDYLPSPEDVPSIVGFDPSDESVEIDRKPTMDDPFSALVFKISTHPFYGKLVF
FT                   VRVYSGSVKPGDNVLDSTKGKKERVGKIFQMHADKENPVDAAEAGNIYTFVGLKNVTTG
FT                   DTLCDEKHPISLESMTFPDPVIEVAVEPKTKADQEKMSLALAKLSDEDPTFQVKTDEES
FT                   GQTLISGMGELQLDIIVDRMRREFKVECNVGKPQVAYRETIRKAVMNQEYTHKKQTGGS
FT                   GQFAKVLMNFEPLDTENGEVYEFVNEVTGGHITKEFIPSIDAGVQEAMESGILAGFPVV
FT                   GVKATVTDGQVHDVDSSEMAFKIAGSMCFKEAAPKAKPVILEPIMAVEVRTPEEYMGDV
FT                   MGDLNSRRGSIQSMNDATGVKVIDAKVPLSEMFGYIGDLRSKTQGRAMFTMQMDSYAEV
FT                   PKAVADEIIKAQRGE"
FT   gene            730184..731383
FT                   /locus_tag="Balac_0620"
FT   CDS_pept        730184..731383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0620"
FT                   /product="elongation factor Tu"
FT                   /EC_number="3.6.5.3"
FT                   /note="COG0050 GTPases - translation elongation factors"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45993"
FT                   /protein_id="ACS45993.1"
FT                   /translation="MAKEKYERTKPHVNIGTIGHVDHGKTTLTAAISKVLHDEYPDLNP
FT                   EYDFNQIDAAPEEQQRGITINIAHIEYQTAKRHYAHVDCPGHADFVKNMITGAAQMDGA
FT                   ILVVAATDGPMAQTREHVLLARQVGVPKILVALNKCDMVDDEELIELVEEEVRDLLDEN
FT                   GFDRDCPVVHTSAYGALHDDAPDHDKWVATIKELMDDVDEYIPTPVHDLDKPFLMPIED
FT                   VFTISGRGTVVTGRVERGKLPINTNVEIVGIRPTQTTTVTSIETFHKQMDECEAGDNTG
FT                   LLLRGINRTDVERGQVVAAPGSVTPHTKFEGEVYVLTKDEGGRHSPFFSNYRPQFYFRT
FT                   TDVTGVITLPEGVEMVQPGDHATFTVELIQPIAMEEGLTFAVREGGHTVGSGRVTKILA
FT                   "
FT   gene            complement(731665..732339)
FT                   /locus_tag="Balac_0621"
FT   CDS_pept        complement(731665..732339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45994"
FT                   /protein_id="ACS45994.1"
FT                   /translation="MVRSRTAQLIFQSFYCAFGIVGILGSFGMYDGSFDNVFYVYFTNL
FT                   SNYLCIAVMFFELVQTANRKQDGYVKLSPALKFISVTAILLTFFVFNLLLANAPDRNPL
FT                   ENFKVTSITFHVVLPLMFVADWLLFYEHRKVKWTYPLYSTVFPLVYLAFVYMRAWLVNF
FT                   DTAVPKLYPYFFIDANQQGIAGVVRWCLILLAAFIVLGYILMAVDRMMPAAKESTPIDS
FT                   AD"
FT   gene            complement(732480..733049)
FT                   /locus_tag="Balac_0622"
FT   CDS_pept        complement(732480..733049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0622"
FT                   /product="hypothetical protein"
FT                   /note="COG0492 Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45995"
FT                   /protein_id="ACS45995.1"
FT                   /translation="MSMSEEIKDSRITDALANRRSVIIVGRATIAAKLALFESLLANLP
FT                   ESARLGVIDESGALAEIPENATVIDAKLKGVDAIHRIIRDDKLDTIACPSMRRGDIVRM
FT                   LMDVSGQENGQVLMINGNIDDATQTLTSDLPMILLKSSPSGHTEFSDAAIKAMNPVVIE
FT                   LSADDSIRTVTEVDLHAEGLNTIDVR"
FT   gene            733324..733887
FT                   /locus_tag="Balac_0623"
FT   CDS_pept        733324..733887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0623"
FT                   /product="elongation factor P"
FT                   /note="COG0231 Translation elongation factor
FT                   P(EF-P/translation initiation factor 5A (eIF-5A))"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45996"
FT                   /protein_id="ACS45996.1"
FT                   /translation="MAQTTNDIKNGSILNLDGQLWQVIKFQHVKPGKGPAFVRTTIKNV
FT                   LSGKIVDKTFNAGMKMDFETVDNRTLQYSYEDGDNFVFMDMTTFDQIMIPKTLVGDKAK
FT                   YLLEGTDCIVSFHDGQPLSVELPASVVLTITHTEPGLQGNRSNAGTKPATVETGAEIQV
FT                   PLFIGEGEKVKVNTDDGSYLGREN"
FT   gene            733984..734448
FT                   /locus_tag="Balac_0624"
FT   CDS_pept        733984..734448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0624"
FT                   /product="Transcription termination factor"
FT                   /note="COG0781 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45997"
FT                   /protein_id="ACS45997.1"
FT                   /translation="MARSTARRRALNTLYEADEKGQDFLSLLDERIAQPGAQTPLPEYA
FT                   IEIVRGVDEHRRDIDSQLNTHSTGWKVKRMHAIDRNILRIATWEILYNDDVPDKVAIDE
FT                   ALNLSKTLSDDAAPSFIHGVLSAIVAAKDKQSPQSTPLDDSDKDESDQTN"
FT   gene            734522..735757
FT                   /locus_tag="Balac_0625"
FT   CDS_pept        734522..735757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0625"
FT                   /product="carbamoyl phosphate synthase small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="COG0505 Carbamoylphosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45998"
FT                   /protein_id="ACS45998.1"
FT                   /translation="MVTQFDPANEYTAQDAVLVLEDGQVYVGEPFGATGSTCAEIVFNT
FT                   AMTGYQETLTDPSYDRQIVVQTFPHIGDTGVNDDDLESSRIWVAGYVVRDPSMVVSNWR
FT                   AAGSLDDDLMANHIVGISHIDTRKLVRHLRSAGVMRAGIFSGAALVGSNGEPREISDML
FT                   EEVQRTPQMKGMSLYDEVSTPEAYVVEPAGDFEGKEPLFTVAAVDLGIKAMTPHRMAER
FT                   GCRVVVLPSTVTFDEIQELNPDGVFFSNGPGDPEQAGQMVSLLRQVLDAGYPFFGICFG
FT                   NQLLGRALGFGTYKLKFGHRGINQPVKDVTTGKVEVTAHNHGFAVDAPIGETVDAPFEN
FT                   GRYGKVFVSHVDLNDNVVEGLQCVDIPAFSVQYHPEAAAGPHDAAYLFDRFVSMMDNSR
FT                   DSKASKEENANA"
FT   gene            735750..739160
FT                   /locus_tag="Balac_0626"
FT   CDS_pept        735750..739160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0626"
FT                   /product="Carbamoylphosphate synthase large subunit"
FT                   /note="COG0458 Carbamoylphosphate synthase large subunit
FT                   (split gene in MJ)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45999"
FT                   /protein_id="ACS45999.1"
FT                   /translation="MPKRTDIKSVMVIGSGPIVIGQAAEFDYSGTQACRVLREEGVRVI
FT                   LVNSNPATIMTDPEMADATYIDPISTPILEKIIAKERPDALLPTLGGQTALNAAVALGE
FT                   AGVLKKYNVELIGASLEAIDRGEDRESFKKVVKEAGAESARSDIAHTLEEVDAIAERFG
FT                   FPLVVRPSFTMGGLGSGIAHDTEELHRIAGAGIHYSPTDEVLIEEGIEGWKEYELELMR
FT                   DRNDNVVVVCPIENVDPVGVHTGDSITVAPVFTLTDREYQKLRDIGIAIIRGVGVDTGG
FT                   CNIQFAIHPDTGRIIVIEMNPRVSRSSALASKATGFPIAKIATKLALGYTLDEIQNDIT
FT                   RSTPASFEPTIDYVVTKVPRFAFEKFPGADPTLTTSMKSVGEAMALAGNFQESLGKAMR
FT                   SIDKRHMGFSWDGEKPSEGEVHELLEQMRIPTEHRYLQVMRAIWGGATPEQIFNATKID
FT                   PWFIDQFFQINATAMQVRGAETLSKRLLRKAKLAGLSDVQIAHLRRLGDEGENTIRELR
FT                   WNYGLHPVFKTVDTCAAEFAAQTPYYYSCYADETELRKREREAVIILGSGPNRIGQGIE
FT                   FDYTCVHAVQELGKDYDTIMVNCNPETVSTDYDMSDRLYFEPLTFEDVLEIYEAEKKQG
FT                   PIKGVIVQLGGQTPLSLAARLKAAGVPILGTTPEAIDLAENRELFGEVLRQEHLNAPRF
FT                   GTALSLEEAREAAHNIGYPVLVRPSYVLGGRGMEIVYDDAQLETYVNRALSEAKADTVV
FT                   SGRLPSPLLIDKFLQDAIEIDVDALFDGEELYIGGIMEHIEEAGVHSGDAACTLPPSTL
FT                   SDDQIRRLREATLAIAKGCQVRGLMNVQYAFMANTLYVIEANPRASRTVPFASKATGVA
FT                   LAKAAARIMAGETIEQQRENGLLLPYGDGGDVRLGQQVAVKESVLPFKRFRTPVGKTVD
FT                   ILLGPEMRSTGEVMGFDRDFPHAFAKSQLASYEGGLPTNGNVFISVNDTDKRQLPLFAV
FT                   RLVELGFEIWATEGTASVLRRYGIESKIVDKIHSRVDTDPEHPIEIQHAAGSVGKNVVE
FT                   LIEEGQIDLILNTPNSRGSRSDGYSIRAAAIAADIPQYTTMTEFSAVLLAIEAVKKNDY
FT                   EVMSIQEHSRELYELERKHKEEGEEARAQ"
FT   gene            739157..740128
FT                   /locus_tag="Balac_0627"
FT   CDS_pept        739157..740128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0627"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="COG0284 Orotidine-5-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46000"
FT                   /protein_id="ACS46000.1"
FT                   /translation="MTQSLTDKEREAMHSDFGLRLSNSMKQYGPLCVGIDPHRGVLENW
FT                   GYSVDAEGAELFAMRMLQAASGRAAAVKFQLSMFERYGSRGFVALERALYAARQMELIT
FT                   IVDCLHGGLSTTISAIADAYFKPDAPMLADAITLLPYYGARSLGGVINDALDNGRGVFI
FT                   ASLTSNPEGASLQTAIRQNGEYKGKTVAYGIAATAQKYNKSVKGLGSVGLIIGATISQW
FT                   LQESGIEPGDFTGPILSPGYGWQGAEGSDLKNVFHGTNGNVLVTVSRAISQSGPDMDAL
FT                   IESTQTIAADVRKALREAIDGTSTAPRGHMANPKGLRTWEEQ"
FT   gene            740125..740754
FT                   /locus_tag="Balac_0628"
FT   CDS_pept        740125..740754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0628"
FT                   /product="Guanylate kinase"
FT                   /note="COG0194 Guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46001"
FT                   /protein_id="ACS46001.1"
FT                   /translation="MSEQSRQSQATERQGGRLIVLTGPTAVGKGTVETALRKAHPEVWV
FT                   SVSATTRDPRPGERDGVNYWFISEPEFLRRQEAGEFLETAVVHGMAHYGTPLEPVREHL
FT                   AGNVPTILEIDLQGARRVKERAKELGLDVVYVFIAPPSFDELKKRLIGRGTETPEQQAK
FT                   RLETAKVELAAEPEFDVTIVNEQVDKAARDLWNVIAQEYGLPQDTD"
FT   gene            complement(740851..742686)
FT                   /locus_tag="Balac_0629"
FT   CDS_pept        complement(740851..742686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0629"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="COG0129 Dihydroxyacid
FT                   dehydratase/phosphogluconatedehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46002"
FT                   /protein_id="ACS46002.1"
FT                   /translation="MNGRMFAGARALYRAAGVDSKDFGKPIVAIANSFDEFVPGHVHLN
FT                   KVGRLVSEAVKKAGGIPREFNTMAVDDGIAMGHTGMLYSLPSREIIADTVEYQVNAHCA
FT                   DALICISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGTTVLPDGTVKENTDLIDVMYA
FT                   SADDSMSDDDLLAFERTVCPTCGSCAGMFTANSMNCLTEAIGLALPGNGTVLASHGYRK
FT                   QLFERAAQQVVKIANQYYQHDDESVLPRSIATKHAFENAMTMDVAMGGSTNTVLHILAM
FT                   AQSADVDFTLNDIERISHTVPCICKASPSGEWEISDVHRAGGITGILGELDRAGKLHRD
FT                   VHSIDYPSLEAKLDEWDIMRDSCTEYAKDFYRAAPGHIVSPEPWTHETKFDSLDTDRVN
FT                   GAIHDIDHPAVTEGGLAVLRGNLAPDGAVVKTAGVPKEIWKFRGPALVVESQEQAVEVI
FT                   LNDTLKPGQALIIRYEGPKGGPGMQEMLYPTSFVKGKGIGKDVALITDGRYSGGSSGLS
FT                   IGHVAPEAASGGNIALVENGDIITIDIPNRTINVELTDEELAERRAKLEAGDGYVAHRD
FT                   RKVSQALKAFAAFARSADKGATRDPELIDRLSGLA"
FT   gene            742883..743167
FT                   /locus_tag="Balac_0630"
FT   CDS_pept        742883..743167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0630"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG1758 DNA-directed RNA polymerase, subunit
FT                   K/omega"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46003"
FT                   /protein_id="ACS46003.1"
FT                   /translation="MAFGTEPIPTGLADPPIDDLMEHADSKYALAIFAAKRARQINSYF
FT                   TQLNEGLLQNVGPLVEYKSQEKPLSIAFREINEGLLEETLGEDDLSEGN"
FT   gene            743348..744574
FT                   /locus_tag="Balac_0631"
FT   CDS_pept        743348..744574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0631"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COG0192 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46004"
FT                   /protein_id="ACS46004.1"
FT                   /translation="MAEVKLISAESVTEGHPDKICDQISDAILDDMLRQDPHSHVAVET
FT                   SATKGQFWVFGEVTSKGYSDIQSIVRDTVRRIGYTSSVIGLDADSCGVLVSLSEQSPEI
FT                   NQGVSRIDSDRENAVSREERYEAQGAGDQGVMFGYASDETDVLMPLPIHLAHRLAYRLA
FT                   EVRKNGEVKFLRPDGKTQVTIEYDEENRPLRVDTVLISTQHDPEVSQEALREDLREHVI
FT                   EPVLDEVLGDAVKHDDYRVLVNPTGSFIMGGPAADAGLTGRKIIVDTYGGAAHHGGGAF
FT                   SGKDPSKVDRSAAYAARWVAKNIVAAGLAHKVEVQVAYAIGVAEPVSINVETYGTEADG
FT                   VTREQIQEAVRKVFDLRPAAIVDELDLLRPIYSKTAAYGHFGREDDDFTWEHTNKVDEL
FT                   KRAIATLVD"
FT   gene            744694..745977
FT                   /locus_tag="Balac_0632"
FT   CDS_pept        744694..745977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0632"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /note="COG2230 Cyclopropane fatty acid synthase and related
FT                   methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46005"
FT                   /protein_id="ACS46005.1"
FT                   /translation="MAAMTVAQMIELFLKPGAPVHIESFDGSSYGSDDAPLTLQVKNSR
FT                   AIYYMVNAPSELGLARAYLQGDIDSPQLVPGNPYALFKELVPLKSYLRTPNPAQLAKAL
FT                   ASVASHGFHRPAPPDIEGPSRARRISEGLLPHSKAGDEATVSYHYDQSNEFYSMFLGPS
FT                   MTYTCAVFDSPLMSLEAAQKNKIDLVLDKLALQPGERLLDIGCGWGSMVIEAAKRGIKA
FT                   LGVTLSEEQVEWAQRWIKDEGLEDLAEVRLMDYRDVPEGDFDGICSIGMMEHVGHKHYP
FT                   SYFKEIYAKLKPGAKLLNHQITRCNSHQGKKAGQFIDRYIFPDGELSSPAEIEMVIQDT
FT                   GFEVINQENLRQHYALTLHRWNENLVAHWDDAVKLVGEPKARLWGLYMAGCAFNFEMNN
FT                   IQVHQFLAIKPNDEGTDTYPLRPWWPNH"
FT   gene            746131..748374
FT                   /locus_tag="Balac_0633"
FT   CDS_pept        746131..748374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0633"
FT                   /product="primosome assembly protein PriA"
FT                   /note="COG1198 Primosomal protein N (replication factor Y -
FT                   superfamily II helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46006"
FT                   /protein_id="ACS46006.1"
FT                   /translation="MQPAFDGMGMRRRSPRKAAPRKPAAQLPVARVVLDVQATHLGQPF
FT                   DYFVDDSMSEAAQPGVLVRVRFGGQRVSGIIWERVNDSDTPTNAIRYIEKVVSPRVLVP
FT                   SQMRRDITAVANAYGGTIANVLRVAMPGRVAGVEKEPNATMQSASDVESAADEASYADS
FT                   PMVDRRGRFASRAEDHFPVIAKAYEQAQTLRASLTAPQGFSAFVIDALPGVGAWERTLA
FT                   WMALTAMGAGKSAVLVMPGMREVWSMVHALENMGLHVFAPNARQIYEGDIAVLSAALSP
FT                   ADRYRAYLAIGEGRVTCVVGTRAAMYAPVPDEALFAIVDDDAYQYADGLMPYANARGVC
FT                   RLRAKLHGGVFVAIGRARSVLSEWESQTSSVVSEVAGPSVAVHGFSDVIKSQAPPVRWL
FT                   NRDELNRLADPSVGARVPHTAVRVLSKALEHGPMLFSIPHDGVTESLSCAQCLQLARCL
FT                   RCSGPLVRIPGADAPRCSWCGASAVDWHCRHCGAERLRVIRVGAVGTVQELQGLFRGVP
FT                   MLVSSQSQGVVDHVDAAPRIVVATPGCEPMVHTQDGTTGAYEAVAILDAWTSLYDLRLD
FT                   ARVDVLSNWMQAMSLCKSRAAGGRGLLIGETYPTLARSLMLWDPRVVASNELADRIATG
FT                   LPPIVSAACIWGRRDAVERALHNIGIANGDWAWVESGEGKVPSLLGITPLAPDRTIDAR
FT                   ELDEMGDRVKAVVRVSHARRAELALRLRTEVARHVASRESGELRFRMDPKDLL"
FT   gene            748546..749457
FT                   /locus_tag="Balac_0634"
FT   CDS_pept        748546..749457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0634"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="COG0223 Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46007"
FT                   /protein_id="ACS46007.1"
FT                   /translation="MLAKDTEHFEVVAVLTRPDAPTGRGRKIMPSPVKMAARELGLDVI
FT                   ECDPADECFLSALKATGAQCAAVVAYGKILRESVLEALPLGWYNLHFSLLPQWRGAAPV
FT                   QRAIWAGDEVTGCSVFRITAGMDRGPVLGQSTVTIGAHENAGELLDRLAEDGAGLLAAS
FT                   LQALDEGVVNAVDQPAGSYDVAAKITTQDAHMRFDVPAFALDRQIRACTPAPGAWANLH
FT                   PHGDDANETLHVSKAIPADMTADESPRNLKPGELHVTKHHVWVGTSTDPLELLVVKAAG
FT                   KREMGAPEWARGAHLAEGAYLD"
FT   gene            complement(749557..750258)
FT                   /locus_tag="Balac_0635"
FT   CDS_pept        complement(749557..750258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0635"
FT                   /product="phosphoserine phosphatase"
FT                   /note="COG0560 Phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46008"
FT                   /protein_id="ACS46008.1"
FT                   /translation="MSAPLSQHLDNTDTLADPLPALGMPGLLVMDVDSTLIDEEVIDEL
FT                   GEEVGVGDEIAAITARAMNGELDFRQALDERVALLRGMPAQIFDRVYERLHFTNGAHEL
FT                   IDTLHAHGWKVGVVSGGFHEIVDRLAADAHLDYHIANRLGVDARRGMLTGEVVGDVVTK
FT                   EVKLSRLRSWAQENDIARIQTVAVGDGANDLPMIGAAGLGIAFCAKPTVRTAAPHTIDE
FT                   RDLRKVLDFLQ"
FT   gene            750368..750991
FT                   /locus_tag="Balac_0636"
FT   CDS_pept        750368..750991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0636"
FT                   /product="Hypothetical membrane protein"
FT                   /note="COG0586 Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46009"
FT                   /protein_id="ACS46009.1"
FT                   /translation="MTAWLVSLMEHVGGVGVALAIALESIFPPIPSEIILPLAGFTAAR
FT                   GSMSLFGAILWATMGSLLGAWALYGIARWFGLHRIHKAVDRIPGVSRKDVNKANEWFNK
FT                   YGTWSVLIGRVIPVVRSLISIPAGFNQMNFAKFSGWTFLGSAIWNTVLVTAGYMLGDQW
FT                   CSILGVLNVFEDVIIVVFALMLVFFAWRWVRNLIRERRSTQSHE"
FT   gene            751117..752685
FT                   /locus_tag="Balac_0637"
FT   CDS_pept        751117..752685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0637"
FT                   /product="AAA ATPase family protein"
FT                   /note="COG0464 ATPases of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46010"
FT                   /db_xref="GOA:C6A7B2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR022482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041626"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6A7B2"
FT                   /protein_id="ACS46010.1"
FT                   /translation="MGQEKHTDAASQSRDPEAVAAHENDQLRQRNHALAKALTRATEEL
FT                   RKAKAQLEQFMAPPLTMATMVRVHRCSTDEHGVRHASAEILNGNRRQIVPLSPTVNPAQ
FT                   LGSGQGVLLDANMVIVDSCETPTTGPMRAVSESLADGRLIVSDVGGNRGVVMRASAVAR
FT                   TPINVDDRVVIDPSGTYVLSVLPQEQAQDLLLEETPDVSFTDIGGLDEQIARIRDAVQL
FT                   PFQHRDLFDRFDLKAPKGVLLYGPPGNGKTLIAKAIAHELAAGSGNDGVFLSVKGPELL
FT                   NKFVGESERLIRRIFERAKELSGAGRPVIVFIDEMDSLLRTRGTGVSSDVETTIVPQFL
FT                   TELDGVESLDDVMVIGASNRIDMIDPAVLRPGRLDVKIHVTRPDETAAMAITRHYLTDA
FT                   LPLEPGRDADALAASLVRDLFRRDESRLLATLDEQGRRRGIYMADIVSGAMLRNIVDRA
FT                   KTKAVKAEILHGSVSRDDEPQGITEARIHEAIDDEYEQNRSTINETDPGQWLRINALTL
FT                   AADGV"
FT   gene            752768..754372
FT                   /locus_tag="Balac_0638"
FT   CDS_pept        752768..754372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0638"
FT                   /product="proteasome-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46011"
FT                   /protein_id="ACS46011.1"
FT                   /translation="MSVRRVMGTETEYAVSVRQDPHANPVQSSFDVIAHAGDEETRHIR
FT                   WDYRQEDPVHDMRGMTMPRAAARPDMLTDEPQRNITNTFAANGGRMYVDHAHPEYSAPE
FT                   TRDPFEAVAYDFAGDLLMRQAAQSASTERHQFEVFRNNADGKGAAWGSHENYLLRRDVD
FT                   FDVVTALMLVHFATRQIYTGSGRVGLGERGERAGYQLSQRADYFHMKVGLQTTFDRPIV
FT                   NTRDESHAPDEMRRLHVIVGDANRLEVPDVLKLGTTSMLLWVAEQASALDYDLTDELRS
FT                   LSLLDSVAAMHTVSHDLTFDEPLALANGGSSTAWQLQVSLRGLVYEVASMVYGTDSLGE
FT                   PVWPDSQTRSVMAMWQQALIDVAEVRHADDDTRMTMTAQASRLEWLLKWQLLERMRRRI
FT                   AGCGASSASGWDNPQVRALELRWASLAPENEAVFAKVRSRAERVVTDERIAAAATDAPA
FT                   DTRAWFRAAILHRFPTELRAISWTRITTVADGAGDSWTLDMRDPTRFTKDDTERQVEEA
FT                   SSAAQLIRSLGGICEHS"
FT   gene            754492..755385
FT                   /locus_tag="Balac_0639"
FT   CDS_pept        754492..755385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0639"
FT                   /product="inositol monophosphatase"
FT                   /note="COG0483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46012"
FT                   /protein_id="ACS46012.1"
FT                   /translation="MQAGLRELAVQVSRIAEDAGKHALKDQLMPKDLVTLNTVQRDYSR
FT                   GLKVDDRLSQFIYNRLTYIDPFKGRWEDRTDEWAPGDRYWCVGGVDGVINYSRSMAEWS
FT                   VTISLFEFNEFGSAQPILGVIHAPALNLTYLAARQQGAIRMRKTPVGEKREKIMPSTVS
FT                   HLDGSIVSFGMSYVPQEAQHALNVVASLAGKPADIKRIGPVSLDVCKVADGTYDAYFEP
FT                   HLHERDVPAISAAAVVLWEAQGQLSTWEGGLIHWRSQNDLVATNGQIIQELQPYLINSD
FT                   CGESYHHHEQKPAGQQ"
FT   gene            755474..755689
FT                   /locus_tag="Balac_0640"
FT   CDS_pept        755474..755689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46013"
FT                   /protein_id="ACS46013.1"
FT                   /translation="MPSASGHHQIPAETQRHDDDQTQETAQGLSAAAMLAQEQADDLDA
FT                   ILDDIETVLETNAEEYVSSFVQKGGE"
FT   gene            755689..757179
FT                   /locus_tag="Balac_0641"
FT   CDS_pept        755689..757179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0641"
FT                   /product="proteasome-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46014"
FT                   /db_xref="GOA:C6A7B6"
FT                   /db_xref="InterPro:IPR004347"
FT                   /db_xref="InterPro:IPR022279"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6A7B6"
FT                   /protein_id="ACS46014.1"
FT                   /translation="MPQLHDSGSRAIQPSDQTHQHDFARIFGIETEYGVSVTDIPEPMD
FT                   ASHVAMTMFQPVVRRARSTNTYVENGSRLYLDVGSHPEYATAEAICPSDALLSDLAGEQ
FT                   TMRSMGLDAQRRLRESDAQNRHATLHLYKNNADSAGHSFGCHENYLVRRFVNLDMIQHV
FT                   LLPFLITRQIYTGAGRFDGERLLFTQRAAFVDETVSSATTRSRPMINTRDEPHANPDDY
FT                   RRLHVIIGDSNRSQWATLMKCATTHLVLCMMEHAARSGCETELEAFALADPIAANHAIN
FT                   TDGAHARIALAAGRSTTALELQQMMLEQVESFAAHHGDALEASLRYDALCNVEWIVGQW
FT                   RWVLDRLAANDIETLSHVVDWASKQVFFNRLQSRGTVTPARLRQLDLDYHDIANGRLYP
FT                   SLCAHGLMRTLVDADQIHDAVSTPPPHTRAVLRGRFVAAASHTDAVYDCDWTTLKLVRP
FT                   VHMEAVLLDPFHDEPTKQYDKLMGELGDARADGDEAPV"
FT   gene            complement(757257..757538)
FT                   /locus_tag="Balac_0642"
FT   CDS_pept        complement(757257..757538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0642"
FT                   /product="DNA-binding protein HB1"
FT                   /note="COG0776 Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46015"
FT                   /protein_id="ACS46015.1"
FT                   /translation="MAYNKSDLVAKISQKSGLTKAQAEAAVNAFRDVFIEAMKNGEGLK
FT                   LTGLLSAERVKRAARTGRNPRTGETIEIPATYGVRISAGSLLKKAVSE"
FT   gene            complement(757705..760209)
FT                   /locus_tag="Balac_0643"
FT   CDS_pept        complement(757705..760209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0643"
FT                   /product="hypothetical protein"
FT                   /note="COG0392 Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46016"
FT                   /protein_id="ACS46016.1"
FT                   /translation="MTTPNSSGSGRVPSDQTDVQQPSIEKTPEHALASRFPNVKVSDVA
FT                   PKRNHVTSDLLHAGAALVFGILVILVAVYLHGLTTGVEDDAHSASQAFDWLVDLPSSLL
FT                   QQLIVISIVVGVLIQLVLNREWLQSACSVGALLIGFLVCWGVSELLSYHSSAMLINTLL
FT                   SSGTRVGPSLLPDFYAAIAAFLTVAGPRDTRSSVKWSWNILLAGAVIFIMTSWSSLPGV
FT                   LVAICIGRMVGLSIRFGVGTKNSGAWGYQIVQALSSIGLHPAVLDRRPEASDHAPMLTD
FT                   DLTDHSRLYDLTDESGVHYVVSVLDNQVQITGYFSQLWQLIRLNGVAVRHDRSAVSATH
FT                   HHYSMLLGLRDIDLTCARPYGVCDYGESSIVVFEHRETIHAVDCRELDDTEALSLMNYL
FT                   QRAHQRGFTHRQITADTIARSAIGDMVIAGWQNGDYASTTTNITLDKVQLLTLFSTMLG
FT                   IERTVSLARRAWGESTLISLIPFVQKAAVPAATRQMEGWNKQIVEDLRTALSKLAPEEV
FT                   AESMEQVTLTRFNARSFFGLVLLVIAVYVMLTQMRPDEMIRAVKQANLWWAFVVMLFGF
FT                   LAWVGSAMALGAFMDRDRRRPFGLLCSQIAAGFTAVSMPAGIGPAFVNLQYLRKSGYRN
FT                   TTATAIMSAVLAVQGVITVVLLLLIGIFTGRNTLSGMIPTNTLIIAIAVVALAISVIMA
FT                   IPSVRRKIANKYLPLVKSYARSLLETLTQPRKLLGSVAGSLILNLSTGFGFWAALMAFG
FT                   FNMNPIETTFIFLLANTLGSAVPTPGGLGAVEAALSVAFSAVGVPAALALSATLLYRVV
FT                   FYWLRIPLGALAMKWLDKHNLI"
FT   gene            complement(760308..761753)
FT                   /locus_tag="Balac_0644"
FT   CDS_pept        complement(760308..761753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0644"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="COG0015 Adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46017"
FT                   /protein_id="ACS46017.1"
FT                   /translation="MNLSEISPAIALTPLDGRYHAQTAALVEYLSEPALNRERMRVEVE
FT                   WMILLANGFAGNDWKPIVTGVKPLTEQEQAFLRSIPEEFGAQGIARHAAHEAVTHHDVK
FT                   AVEYYIDDYLDSAEQVLGAPTQLTDLKTLVHFACTSEDINNLSIARCVKNAIEHVWLPG
FT                   ADAIVDLLAQRAEEFKDMPLLSLTHGQPATPTTLGKELAVYVYRLGRQLKHVREQEYLG
FT                   KINGATGTFGAHLAALPNVDWVAVSREFVENRMGLTWNPLTTQIESHDWQAELFDTISH
FT                   TNRIMHNLCVDTWMYISRGVFAQVPVKGATGSSTMPHKVNPIRFENAEANFEISCSLLD
FT                   TLAATLVESRWQRDLTDSTTQRNIGSALGYSVLAHNNLLGGLKSVHPNTQVMDRELDEN
FT                   WEVLGEPIQTAMRAQELAGRSGMERPYEKVKELMRGHSISQADVESFIDSLDFDDETAA
FT                   RLKALTPATYVGLASMLVGYDRP"
FT   gene            complement(761804..763354)
FT                   /locus_tag="Balac_0645"
FT   CDS_pept        complement(761804..763354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0645"
FT                   /product="hypothetical protein"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46018"
FT                   /protein_id="ACS46018.1"
FT                   /translation="MTKMVRSSIHGGAQYATATLDLVHGICSRLGACAADLKAQAIALS
FT                   NARMRVAVLRTSTLQWCPEQNGMAALRAPVCESSGFGRSLHVHVEYLRLTDHAESARSQ
FT                   LHALAVQCERIADVLARAYGLYSEAEAKSRMATNRALQWAARVAPATMAKFTIAQALGG
FT                   WLYGVVTEGNFSAAHALNAISWQQEGLMRAASAAIGLHDGQSPVPSGAYAIGGISSRAT
FT                   NLIQGDALTVESVDPHEPSVAPVSDMGGALANLRRLSAANADSTHGEYATIAISRYVDA
FT                   DGRRSWLVTIPGTDGNFDSPLGWEQNVELMSANAMQRRNADSARMVVEAMRQAGIGRDE
FT                   RVALIGHSQGGIIAATLASDYADEYRIEHIVTAGSPIANHPMGKGTWVTSIEMEDELVA
FT                   ALDGEVNPRSEQWLTIRGEVRNVADGSPADANGAVDDGTAAMTAVDQSHQGKYELTHDL
FT                   AYHTAAYENALSLGSEALANHDSHFMATIHGDYMETTYWSGRMEHGKHDIEMDDTHTQ"
FT   gene            complement(763363..763641)
FT                   /locus_tag="Balac_0646"
FT   CDS_pept        complement(763363..763641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46019"
FT                   /protein_id="ACS46019.1"
FT                   /translation="MIGSNSAFNATSGTTTQCVCAGNAQECIALLVPLVRGSFHALDGL
FT                   MAACRSDTGTWSGRAAELFHERLQAMEPRASACMQTLQMLDGLLSTM"
FT   gene            complement(763772..764371)
FT                   /locus_tag="Balac_0647"
FT   CDS_pept        complement(763772..764371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0647"
FT                   /product="cell surface elastin binding protein EbpS"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46020"
FT                   /protein_id="ACS46020.1"
FT                   /translation="MSGNISGRLDRATASRSFTKRAPLGVRIMLAAFAVLAIAFAVLAG
FT                   VNIDAQRQYDAATQTLTENLETASRNDADLKQLLTSQQELDARFASITGKSAVLLPQIS
FT                   ESTTYNAQVSKQLTDLVQQQVDADAAKNDSQQSGQHGEQPKSLDSLTEEQRKQVEELLR
FT                   SNEELGKSEDSTNESNGGQGERENDSPSRPSNVKPW"
FT   gene            complement(764368..765372)
FT                   /locus_tag="Balac_0648"
FT   CDS_pept        complement(764368..765372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46021"
FT                   /protein_id="ACS46021.1"
FT                   /translation="MSTFGFAPALGWIGGSLVAAVMVACAVTCVVLHARRGADGTDETL
FT                   WSCVRRVLACVIVALMAFTPSMVTKTTSRAISTTDVVIVSDITPSMGVQDARYGSKSDL
FT                   SRLEAAKSAIADIVRDYPNSSFSAVSVGASGAVDVPLTPDTRAITNWAQSLDTEDSSSS
FT                   SGSSLDVVIDPLLRALKSIRDAHPDDRIVLYIITDGEQTVRNTRRTFSSLRHYIDDACV
FT                   IGVGSTTGGRIPSKTAGQWVTDPSTGQPGVSIMDEGQIRSLADELSGKVVITSANDTVA
FT                   SAQIAQQAGSWREDDTQKERTRINPIVWPLAIALAALLAWELGTWIATSRRLL"
FT   gene            complement(765369..766430)
FT                   /locus_tag="Balac_0649"
FT   CDS_pept        complement(765369..766430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0649"
FT                   /product="Von Willebrand factor type A-like protein"
FT                   /note="COG2304 Uncharacterized protein containing a
FT                   vonWillebrand factor type A (vWA domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46022"
FT                   /protein_id="ACS46022.1"
FT                   /translation="MMLRWQWPWALVAALLIAALVCLTIVMVSSHRRAYHDEARIYGVQ
FT                   DDLETEHAGALMRVWRRLNRIAVALLACALVLSCILVGRPAHVDAQDEQSSNRDIILCL
FT                   DVSGSTLPYDHQVLSTYLNLLQHFKGERIGLSIFNSSSRTVFPLTDDYAMVTEQLTQAN
FT                   DMLKGVQTQDDIDKMSDEQYQQIADWLEGTQNRKNATSLIGDGLVGCAAMLPGFAYSKA
FT                   DTAQSRSREASIVLATDNVVSGSPTYSLAQALDLTSQAGINVDGLYSGPQSSEGDATTN
FT                   EMRQLIERHGGLFLTQSNSASIDELVREIDGRRSHEAQAQSQTALTDVPGWWTLAVAIL
FT                   LAGWLVMAWRLKR"
FT   gene            complement(766427..766939)
FT                   /locus_tag="Balac_0650"
FT   CDS_pept        complement(766427..766939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46023"
FT                   /protein_id="ACS46023.1"
FT                   /translation="MIVAIDTQNLHPRGTIAITQSLWIALICDIVLALILIVACCVLSG
FT                   TRRRPETTGSQDEETLPKKEWAARVNQVVARHDAQDITRDEAFAQLAAIARDFASNMSG
FT                   RRMQANTLTDLRRLRRTGVAVNWDLLRQTIAALYPPEFAQAEHPQARGVSVRQAADWVL
FT                   DLIERWQ"
FT   gene            complement(766940..767905)
FT                   /locus_tag="Balac_0651"
FT   CDS_pept        complement(766940..767905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0651"
FT                   /product="hypothetical protein"
FT                   /note="COG1721 Uncharacterized conserved protein (some
FT                   members contain a von Willebrand factor type A
FT                   (vWAdomain))"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46024"
FT                   /protein_id="ACS46024.1"
FT                   /translation="MIGTNHDANRSDPIRRKIEMLGTSLSLPTVRRAMGILEGEHASAR
FT                   RGGNDDLLDIRAYEVGDEARQIDWKISARNGRAMIAQRERLSSTRVYLLLDAGVEMTEV
FT                   CPSDEMAYRIAANALCMFAALSLRRSDEVSLVFGDSSNITRVPFHGGLAQFEHTLDKAL
FT                   DRGWRFPRNIDALLDYAAHIRDREALIVLATDDHALDDTHMRAIRRITQTHPLVLINVG
FT                   TINPFSSDPIPSRPHASLVDGATDRRIPAFLRNTKAAQELDTHRAYLLQALDRELLRCG
FT                   SRMIHASSSEGMFHAFVRLLSLSHASVFTPVTIPEGTANA"
FT   gene            complement(767902..768858)
FT                   /locus_tag="Balac_0652"
FT   CDS_pept        complement(767902..768858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0652"
FT                   /product="magnesium chelatase family protein"
FT                   /note="COG0714 MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46025"
FT                   /protein_id="ACS46025.1"
FT                   /translation="MVDSIRSRFAQTLVGQTNLRESLITTLVAGGHILIESVPGLAKTT
FT                   AAQTLATSVSGSFKRVQCTPDLMPSDLVGTQVFDFSTQRFTTQIGPIHANFVLLDEINR
FT                   ANAKTQSAMLEAMAEGATTIGGQRIELPKPFMVIATQNPIEEEGTFNLPEAQMDRFMMK
FT                   AIMTYPSADEEQRMLGLLINRGSDAIDPTKLPRDVISIQDVDWLRETARRVHVSDAIMQ
FT                   YAVALSETSRGGGPKPIQGLSSLVRLGASPRASIALVRIAQASALMAGRDYVIPEDVRG
FT                   FAHEVFRHRILLTFEALADGVTSDQIVDQIVQVVPVP"
FT   gene            complement(769093..769812)
FT                   /locus_tag="Balac_0653"
FT   CDS_pept        complement(769093..769812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0653"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="COG0692 Uracil DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46026"
FT                   /protein_id="ACS46026.1"
FT                   /translation="MTEIKPLEELMDPGWAEALRPVEPQIRHMGRLLRERIGHGEHIAP
FT                   ASRNILRAFTIPFDSIRVLIVGQDPYPTPGYAVGLSFSVAPNVHPLPKSLVNIFKELED
FT                   DLHVPPPCNGDLTPWTHRGVELLNRCLTVEIGRPNSHQNLGWEPVTDCAVRALNNRVDE
FT                   HGKPKPLAAILWGRNAQTLEPLLTNAAIIKSAHPSPLSASRGFFGSHPFSRANAALKQM
FT                   GAEPVDWSLPSSDCPAR"
FT   gene            769989..770672
FT                   /locus_tag="Balac_0654"
FT   CDS_pept        769989..770672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46027"
FT                   /protein_id="ACS46027.1"
FT                   /translation="MARNDDHKYESYPKDSFDNPPTGPVGVHNGRRSWPVRLTPYAIVI
FT                   VVAAAVGVLFWSAFSGEAANMFKHGDRETVVASSSTTTTTSPSSTSASESESPSQSASA
FT                   SASESPSQSPSQSPSQSSESPSQSPSEEQTPEQKVNLDASISVINGTATNGYAAQEAQR
FT                   LQGAGFTNVAPSNPNGMQLPSQSVVWYQNDADLATAQKVAETLGVSTVQKAEGIAVPVA
FT                   VVLMN"
FT   gene            770979..771191
FT                   /gene="cspA"
FT                   /locus_tag="Balac_0655"
FT   CDS_pept        770979..771191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /locus_tag="Balac_0655"
FT                   /product="cold-shock DNA-binding domain-containing protein"
FT                   /note="COG1278 Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46028"
FT                   /protein_id="ACS46028.1"
FT                   /translation="MPRGTVKFFNVGRGYGFITPEDGGADVFVHYSSIEAEGFKALRQG
FT                   DLVEYDSKPTDKGELATRVVKIHRS"
FT   gene            771407..773020
FT                   /gene="groEL"
FT                   /locus_tag="Balac_0656"
FT   CDS_pept        771407..773020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="Balac_0656"
FT                   /product="chaperonin GroEL"
FT                   /note="COG0459 Chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46029"
FT                   /protein_id="ACS46029.1"
FT                   /translation="MAKIIEYDEEARQGMLAGLDKLADTVKVTLGPKGRNVVLDKTYGA
FT                   PTITNDGVSIAKEIDLEDPFERIGAELVKEVAKRTDDVAGDGTTTATVLAQSLVHEGLK
FT                   NVVAGSNPIALRRGIEKASDALVKQLVASAKPVETKEQIAATATISAGDPEVGEKIAEA
FT                   LDKVGQDGVVTVEDNNRFGLDLDFTEGMRFDKGYISPYFVTNAEDQTAVLDDPYILLTS
FT                   SKVSSQQDVVHIAELVMKTGKPLLIVAEDVDGEALPTLILNNIRGTFKSCAVKAPGFGD
FT                   RRKAMLQDMAILTGGQVVSEDLGLKLDSIDLSVFGTAKKVIVSKDETTIVSGGGSKEDV
FT                   AARVAQIRAEIEKTDSDYDREKLQERLAKLAGGVAVIKVGAATEVEAKERKHRIEDAVR
FT                   NAKAAIEEGLVPGGGVALVQAAEKVEKDFNLEGDEATGAAIVFSGIEAPIKQIAENAGL
FT                   SGAVVIDKVRSLPEGEGFNAATDTYEDLMAAGVTDPVKVTRSALQNAASIAGLFLTTEA
FT                   VVANKPEPAAAPAAGQDMGY"
FT   gene            complement(773160..773453)
FT                   /locus_tag="Balac_0657"
FT   CDS_pept        complement(773160..773453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46030"
FT                   /protein_id="ACS46030.1"
FT                   /translation="MSQYQVDSERIAASSAAVCSSITAIRDAVTTMYANLNALQDAWRG
FT                   AAAAQFNMVASEWRRTQQQMELSLEAMQQALTQASTVYADAEMQATRLFATS"
FT   gene            773531..774538
FT                   /locus_tag="Balac_0658"
FT   CDS_pept        773531..774538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46031"
FT                   /protein_id="ACS46031.1"
FT                   /translation="MANNNEWTAQQAIVVGGRGDDPVIVDNFGGLKRQARVWTAVLSVI
FT                   MLFAALLVGATGAQMAAADDSPSPSASESSSPSALVEDSQGYITDPQNLLGDNLTKVID
FT                   AANRTKQETGVTVRLLYLESFNTTEKPEQWASQLLESLNPPANTVMLAVASHDGNLVVV
FT                   VSPNSDEWLRSQSTVDQLSEAASKPLLDQQAGQGPNWSQSAIDMMDAIASAKSTATTHA
FT                   VSSVSIIVMIIVFVVLIVVVLVMIFMRRKREVSEGSKQTEEVGKTRNDDAMQLDNADDD
FT                   LDVTAMAPEETSEQPEGKEAQEPNPTSEASGMPAPRRGRHAAAPHDDERFKRPN"
FT   gene            774619..775329
FT                   /locus_tag="Balac_0659"
FT   CDS_pept        774619..775329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0659"
FT                   /product="response regulator of two-component system"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46032"
FT                   /protein_id="ACS46032.1"
FT                   /translation="MVVDDEPSIRELLVASLHFAGYEVETAASGSEAIEVISRTKPDMI
FT                   ILDVMLPDIDGFTVTRRIRQEGITAPVLFLTARDDTQDKVMGLTVGGDDYVTKPFSLEE
FT                   VVARIRAILRRTREQVEDDPIIRVGDLEINEDSHDVTRAGQTIDLSPTEYKLLRYLMDN
FT                   EGRVLSKAQILDHVWQYDWGGDAAIVESYISYLRKKVDDVTVTDEDGSTHKVTPLIETK
FT                   RGIGYMIRAPKAQK"
FT   gene            775403..777148
FT                   /locus_tag="Balac_0660"
FT   CDS_pept        775403..777148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0660"
FT                   /product="sensor protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46033"
FT                   /protein_id="ACS46033.1"
FT                   /translation="MKDTPLAQVAAADARKGQSSQNQPHTHRSRRLAALNECIPLSVRL
FT                   MSIIVGMLSIGTIVITFSIRWLVSSYPMERVDQQLLEQADLVFPQMLNTDVNTQNGFTS
FT                   YYVKVYNTNTGSSAVMLQPVLKDGVISSPKLPDNGSLDGHELGVPFTTPAVVNTKNVVG
FT                   VPDHATMQFAECPWRVVALKGLTKSGKGEFQDLGIVYIGLSLGDQIDVISTLTRFCIMV
FT                   SIAVVLLGGSLGALVVQRTLSPLKRIEKTAAKIAAGDLSQRVPESGESTEIGSLARSLN
FT                   SMLTQIERSFHEQEAVTQKMRQFVSDASHELRTPLAAIHGYAELYKMQRDAPGTLERAD
FT                   DAISHIESSSSRMTVLVEDLLSLARLDEGRGVSMNQRVDFTSVMQDSVDDLHALDPDRE
FT                   ITTMQLDIDLSAPRKPKLSETPGPLPKIALTGDATRLHQVITNIVGNIHRYTPSDSPVD
FT                   IGLGVIESSRTPEDLAAMPQDGDMLETLLQGARKSKSSKLLSMYAVAVLRDHGPGVPEK
FT                   SLHNIFERFYTADPSRDRQKGGTGLGLAIALSIVNAHGGRIYASPTEGSGLTFTIILPM
FT                   ESGTD"
FT   gene            777275..777718
FT                   /gene="cspB"
FT                   /locus_tag="Balac_0661"
FT   CDS_pept        777275..777718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspB"
FT                   /locus_tag="Balac_0661"
FT                   /product="cold shock protein"
FT                   /note="COG1278 Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46034"
FT                   /protein_id="ACS46034.1"
FT                   /translation="MDFWYAAGPHVFETIEVNMPSGRIRWFDAKKGYGFIAGDDGKDVF
FT                   LPQTALPQGVRNPRKGAKVEYSVIEGNRGQVAMGVTMVASAPSLVKATRPKPDDMAAIV
FT                   EDLIKLLDSAGNGLRRHRYPSSADSRKLATLLRAVADDFDVQD"
FT   gene            777720..778850
FT                   /locus_tag="Balac_0662"
FT   CDS_pept        777720..778850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46035"
FT                   /protein_id="ACS46035.1"
FT                   /translation="MATSEFDPIALARAEAIDTAHEPEDVGEFVTSEAHDDGVTDFRFE
FT                   ALMKGYEGWQWSVTLYHDVELDHWTIDESSLIPTDKALLPPKWVPWKDRLLPSDLSVTD
FT                   SIGTPEDDERLDDGIGIDEAVSRTEELNAEQQAVETVQAQEGGSPDEQADALTAVEDVV
FT                   EAVEELDLSRRHVLSELGQTQTAQRWYEGPHGPKSLSTKTADGNLCSTCGFFIPLAGSL
FT                   KTMFGVCANRWSPDDGKVVSVDHGCGEHSEIRPPEPSRMWVQTKPAYDDLHIDVVAQHG
FT                   RDERKDEELLESLDEVDAESLAGLKQKALDMDDDMPDTSSFGIGSVSPQDFSGEEPEAD
FT                   STVERSAAKEVCEDEDAEQIDSMCTSETVIAEEAGE"
FT   gene            complement(778933..779955)
FT                   /locus_tag="Balac_0663"
FT   CDS_pept        complement(778933..779955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46036"
FT                   /protein_id="ACS46036.1"
FT                   /translation="MSADDESADNVGETSAQMTAAPESVTQSTTDDQDEVHGTVVPPSF
FT                   PPHHEETDPASDSEDTDAKQRPSKSARGGARRHLPMHITTIVLGIIVILIAGLYLYANG
FT                   NISGTPRAAAMSDCRSSVSHANSARSLLTTAVGDAKTYRASHVTDMSDEQLRNLTSYLD
FT                   QSAQQPSVPSCSIIANDGVLQTNAVNAKKLAHNATTLTRDLLLATTGVLPQELQGDEQT
FT                   GDPSYSPSETQMPTESPQPPTSPSTDSSTHGTTSDDAKSHNDSGTANELASPSAQPSNT
FT                   SRTSPEPSPSPSASMSTSSEDAGTGKRKQKESGSSASSQSEGNGSNTTKSNGTKSGNVM
FT                   "
FT   gene            complement(780120..781097)
FT                   /locus_tag="Balac_0664"
FT   CDS_pept        complement(780120..781097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0664"
FT                   /product="Universal stress protein"
FT                   /note="COG0589 Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46037"
FT                   /protein_id="ACS46037.1"
FT                   /translation="MEPATVQSLNPQGDLVVGVDGSQESFGALRWALRQAALSGQTVNA
FT                   VYGWSYSWDMGPEPTTDEELAKLRTQIAEKLRDWVKDAAEGIDIDSDQIRLTSFRASGT
FT                   SALLEIGSDAQQIVVGRRTLGRVARWFSGSLSSSLAEESQIPVTIIRVENEDQSVQDEI
FT                   ANALTPGSQEVHFELPAPDTPRTSRPIVVGVDGSPTSRRALEFSAWLANLNHAPLHVMY
FT                   CWQLKDMTDIPGYETSVPPLDVAQQHAEQVVQHLIASSTLPEGLTIKADVFHISAGKGL
FT                   VSASRYCRHIVVGSRGLSGADAHFLGSVSKQLINLAECNLTIVH"
FT   gene            781404..783956
FT                   /gene="clpC"
FT                   /locus_tag="Balac_0665"
FT   CDS_pept        781404..783956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="Balac_0665"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46038"
FT                   /protein_id="ACS46038.1"
FT                   /translation="MFERFTDRARRVIVLAQEEARALQHNYIGTEHLLLGLIREGDGVA
FT                   AKALEAKGVTLEDTRKQVEEMIGKGTAAPTGHIPFTPHAKQVLELSLREALQLGHSYIG
FT                   TEHILLGLIREGEGVGTQVLIKMDVDLSDLRSTTIDMIRGNSGNGEGDKGDMANAGSVQ
FT                   DKRSQSGSAILDQFGRNLTAEAKDGKLDPVIGRSTEIERVMVVLSRRTKNNPVLIGEPG
FT                   VGKTAVVEGLAQKIVAGDVPETLKDKQVYSLDLGSMVAGSRYRGDFEERLKKVLKEIKT
FT                   RGDIVLFIDEIHTIVGAGSADGALGASDMLKPMLARGELQTIGATTTDEYRKYIEKDAA
FT                   LERRFQPIQVSEPSIAETIEILKGLRARYENHHHVTITDGALQSAAELSARYIQDRNLP
FT                   DKAIDLIDEAGARLRIKRLTAPPELKELDNRIARIAKEKDQTIKDQQFEKAAELRDKQE
FT                   KLEAERKEKEKSWREGESDVRMVVDEDVIAEVISQSTGIPVFKLTQAESKKLMSMEKEL
FT                   HKRIIGQDEAVSALSRSIRRTRVGLKDPKRPAGSFIFAGPTGVGKTELAKALAQFLFDD
FT                   EDALIRVDMSEFSEKYAASRLFGAPPGYVGYEEGGELTEKVRRKPFSVVLFDEIEKAHP
FT                   DIFNTLLQVLDDGHLTDGQGRKVDFKNTIIILTTNLGTRDIAKTANTGFTMGGNTESSY
FT                   QRMKDQVSSELKQQFRPEFLNRLDDIIVFRQLTEPQVRQIVDLDVTKINDRLFERHMEL
FT                   DLTDKAKDLLAEKGFDPLLGARPLRRVIQRDIEDTISEKILMGDLHDNERVIVDAEGDG
FT                   ILGEFTFRGEPFELPAAGEGDESKDVVPEPAAAASEAE"
FT   gene            complement(784358..786160)
FT                   /gene="aspS"
FT                   /locus_tag="Balac_0666"
FT   CDS_pept        complement(784358..786160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="Balac_0666"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="COG0173 Aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46039"
FT                   /protein_id="ACS46039.1"
FT                   /translation="MSQQTAYRTHHATDVTEVLVGEHVTLAGWVDRRRDHGGVAFIDLR
FT                   DNTGLVQVVINEEEMARPLRSEYVIEVDGKVRQRPEGNENDHLATGKVEVVAEKIRVLA
FT                   KSDALPFQVSTALENESENKLPGEDVRLKYRYLDLRRPAMQRNIKLRSDMMRAARTELD
FT                   KLGFTEVETPTMIKSTPEGARDFVVPARLVPGSWYALPQSPQLLKQLLMVAGVERYYQF
FT                   ARCYRDEDFRADRQPEFTQLDMEMSFVDQEDVIAMAEQVIKAIWKADGYDIETPIRRIP
FT                   WQEAMDKYGSDKPDLRFGNELIELTDYFKNTPFRVFQAPYVGAVLFKGGASTPRRQFDA
FT                   WQDWAKQRGAKGLAYVVFGENGELKGPVAKNLSGEERNGLKEAVGAEDGDAVFFAAGAR
FT                   ESSQLLLGAVRVELANRAGLLDPKKFAFCWVVDFPLFKRTDDPDDDDVAVGHSKWTSMH
FT                   HPFTMPSKDWIDTFDEDPEHAMSDSYDIVCNGNEMGGGSVRIHRDDIQDRVLNVLGITP
FT                   QEAQDKFGFLLEAFKYGAPPHAGIALGWDRTVALLAGADSIRDVIAFPKAGGGRDPLTG
FT                   APAPISDEQRAETGVDYDPEEDED"
FT   gene            complement(786219..787565)
FT                   /gene="hisS"
FT                   /locus_tag="Balac_0667"
FT   CDS_pept        complement(786219..787565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="Balac_0667"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="COG0124 Histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46040"
FT                   /protein_id="ACS46040.1"
FT                   /translation="MVEQRVIDTLREVFELNGFIGIETRAVEQGSSLLKKGETSKEIYL
FT                   LSRLQEVGHESDIPVEQRLGLHFDLTVPLSRYVVEHSGALPFPFKRWQIQKVWRGERPQ
FT                   EGRFREFVQADIDVVGDGTLPSHYEVELPLVMVNALERLREFGLPKATVHANNRKLSEG
FT                   FYRGLGLTDIEGVLREIDKLDKIGPQAVTDLLVETCGATEAQANACLELAQVTAEDGQE
FT                   LIEKFNGLCEIHHIPFDGDEYAMAKEGLDTLSMIIDEARRIRPGSVMADLKIARGLDYY
FT                   TGSVYETFLEGASDLGSICSGGRYDNLATQGNRKYPGVGLSIGLSRLVSYMLHRAGATA
FT                   SRMSPACVLVAVWDEENRGDSNAIANTLRSRGIAADVAPTAAKLGKQIKYADKLGIPYV
FT                   WFPNENPENDGSDEVKNIITGDQRPADAQSWQPDTVYAQQTVSINADNR"
FT   gene            787753..789171
FT                   /locus_tag="Balac_0668"
FT   CDS_pept        787753..789171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46041"
FT                   /protein_id="ACS46041.1"
FT                   /translation="MADSNVTESKTTDNAVANDEATTPAAAVPSPAAMKAHAPSPAVLA
FT                   KSPVAHLASSSSHDDVELKEAESFGRVDGNGTVYVKEGEEEREVGQFPDASADEALALY
FT                   ARRYLDLKAKLDVFANRLKSNSIKPREIDETLAALTEEVKQPAVVGDIPALQSQLEELR
FT                   KKAAAKKDAIAKARKEAMTKAIAERTSIVEKAEALAAGLGDNTNWRSTADKFRSLFEQW
FT                   QEHQRTTIRIDKAEADALWKRFSGARTTFNQARRKWAQARDAERSHAKAQKEAIIAEAN
FT                   EIKDSTAWGETSRKFNELMDRWKKAGRAGRNEDDALWAQFRAAADTFFNARQADREQIS
FT                   SNEKENLAQKEALLAKAEALVPVETGEQAKQARVKLAQIQEEWDQIGYVPREDMRRIEG
FT                   RLDAVDNQIKAVEDAAWKKTDPEADARKSSFEGQLKAQLAELDEQIAKESDAKKKAKLE
FT                   AEKATKEQWLNAIM"
FT   gene            789350..790138
FT                   /locus_tag="Balac_0669"
FT   CDS_pept        789350..790138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0669"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46042"
FT                   /protein_id="ACS46042.1"
FT                   /translation="MTTSTHTEEITVMRDGLRLHGRIDAPQGEPKGPVVILMHGFMADL
FT                   GYEPGSLLQQVSDQLVEAGFTSVRFDFNGRGNSDGSFANSDVCNQVEDAIAVLNFVRDR
FT                   FEPAEISLLGHSQGGVIAGMTAGMYADVVHSLVLLSPAASIKDDALRGRVLGVPFDPYH
FT                   IPRRIALADGKHEVAGKYSRIAKTIPVYEAAAMFKGPALAIQGEQDKVIDPSCAHNYGN
FT                   AMANCTVSLYTNLDHKFNGDDRMRAIGEAVAFLQTHHEVA"
FT   gene            790307..791092
FT                   /locus_tag="Balac_0670"
FT   CDS_pept        790307..791092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0670"
FT                   /product="ATP-binding protein of ABC transporter for
FT                   glutamate"
FT                   /note="COG1126 ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46043"
FT                   /protein_id="ACS46043.1"
FT                   /translation="MSENNTVEQLSPSGENAHHLVELEHVEKYYGNLHVLRDINLKVDK
FT                   GEVLVIVGPSGSGKSTMCRTINRLETIDSGVIRIDGQALPQEGKGLAQLRAEVGMVFQS
FT                   FNLFANKTILENVTLAPIKVRHMDRDQAEKEAMDLLARVGVDSQAMKMPSQLSGGQQQR
FT                   VAIARSLAMHPKVMLFDEPTSALDPEMVNEVLDVMVELAQEGMTMLCVTHEMGFARKAA
FT                   NKIVFMADGQILERGTPDEFFEHPQTERAQEFLSKILTH"
FT   gene            791178..792017
FT                   /locus_tag="Balac_0671"
FT   CDS_pept        791178..792017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0671"
FT                   /product="ABC-type amino acid transport system periplasmic
FT                   component"
FT                   /note="COG0834 ABC-type amino acid
FT                   transport/signaltransduction systems, periplasmic
FT                   component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46044"
FT                   /protein_id="ACS46044.1"
FT                   /translation="MKHRYKKGLARKAIAMVCAASALFGMAACGSSSADGEKKIRIGIK
FT                   YDQPGLGFKKSGTFEGFDVDVARYVANQLGYTDAEIEFLEAPSKQREAMLQNGDVDMIL
FT                   ATYSITDERKKAVSFAGPYFVAGQDLMVRADDHSINGPEDLNGKRLCSVTGSTSAKVVK
FT                   ERFAKEVQLMEQPGYAECATALFSGIVDAVTTDDIILAGLASASRGKLRVVGKPFTQEY
FT                   YGVGIRKGDTAFAKQINAAIEDMIKSGEWERAIEKNTEGTDYQPDPKYNPPTPDEGE"
FT   gene            792023..792700
FT                   /locus_tag="Balac_0672"
FT   CDS_pept        792023..792700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0672"
FT                   /product="ABC-type amino acid transport system permease
FT                   component"
FT                   /note="COG0765 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46045"
FT                   /protein_id="ACS46045.1"
FT                   /translation="MEGFISLFRSYNIPGAFLVNIELTLWAALFSTILGLILVMMRISP
FT                   VSSLRKVSAGYVELFKNMPLTIIMVFMVLGAFAQLKLSFSDNFQTNFFWLAVTGLSLYT
FT                   AAFVAESLRSGINTVPKGQAEAARAMGLNFMQSATLIIMPQAIRGSVAPLGNTLIALLK
FT                   NSTVAAAASVATETSSLMSEMIEFRPDVIIQIFLIFAMGYVILILPIGILTTYLSNKLA
FT                   VRR"
FT   gene            792704..793795
FT                   /locus_tag="Balac_0673"
FT   CDS_pept        792704..793795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0673"
FT                   /product="permease protein of ABC transporter for
FT                   glutamate"
FT                   /note="COG0765 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46046"
FT                   /protein_id="ACS46046.1"
FT                   /translation="MGNSDESSLLFDQPGPKGLKRIRIINWVATILFVVVLVLIVLRLH
FT                   NPPDGENQLSWELWKPALDGEAWSDFYLPGLWATLRAAFLAVIGSVVFGLVFGIGRLLP
FT                   SRIVQGICAIVIEFCRAVPVLIMMIFFWRAFAFLDLPSPSYWAVVISLVFYNGSVVAEL
FT                   IRSGVGNLPGGQHEAAVALGMTRTQSLMSIEVPQAIYAMLPAAVTQLVVVLKDTALGSI
FT                   IMYTDLLQESRRLGSMYFNILQTLVVAAVIYFIICWLLSRLAEWLPVRMQQHTLAPTEP
FT                   EPVAPIAIMDPSNVNQIAVAKEGRPLGGSQRLYHVHHRGTNARIHGWRRTRYVQGYDET
FT                   QPQSQHVPAEHHMHHHSKGAGER"
FT   gene            793908..794876
FT                   /locus_tag="Balac_0674"
FT   CDS_pept        793908..794876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0674"
FT                   /product="hypothetical protein"
FT                   /note="COG2326 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46047"
FT                   /protein_id="ACS46047.1"
FT                   /translation="MASDKKNGRGSKKGESITVAERKARKVAERLAREAKSSETLSAVW
FT                   SLPPAQLLRFHSHTHLVDIDAGSKPGFDGDQEAGERFIADSSSEIANYQRLMYANGIHG
FT                   DTHRVLIVLQGMDASGKGGIVRHVFSQVDPMGIHYHGFGKPSEEDLAHDYLWRIRRELP
FT                   SNGWISIFDRSQYEDIVMPRITGSLPEETWRARYGQINDFEAELAGSGCAIIKIFLVSS
FT                   RQAQRQHFLRRLDDPTRYWKFDPSDLEARDRWDDYMAAWQEVFERTSTSIAPWYLIPAD
FT                   KRWYSRMVVSELLRTTMKNFNQTWPPLDADRDEALARLGVE"
FT   gene            complement(794891..797479)
FT                   /locus_tag="Balac_0675"
FT   CDS_pept        complement(794891..797479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0675"
FT                   /product="DEAD box-like helicase"
FT                   /note="COG4581 Superfamily II RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46048"
FT                   /protein_id="ACS46048.1"
FT                   /translation="MAEADDERTALMRLVPSRGEDNRSLDADEIYERFFDWVVEERGIE
FT                   PWPHQEEAVLDLLAGDHVVLNTPTGSGKSLVALGMHFAALCTGRRSYYTAPIKALVSEK
FT                   FFELVNVFGRENVGMITGDSHINAEAPIICCTAEILANQALREGRRADIGCVAMDEFHY
FT                   YGDPERGWAWQVPLLTLPQAQFLLMSATLGNVDTIADSLEDLTDTDVDIIAEARRPVPL
FT                   SYRYTTDPLEKTVELAVQNGETPIYIVHFSQDAALDTAQSLSNTGVSTKEQREAIARAM
FT                   KGTKFTTGFGKILQRLLRTGVGIHHAGMLPRYRRLVEQLAQQGLLPVICGTDTLGVGIN
FT                   VPIHSVVLTQLTKFDGTHMRKLRAREFHQIAGRAGRSGFDTEGLVIAEAPEYEIENARA
FT                   LAKAGGDPKKLRKIKRKKAPEGFVTWNESTFAKLIGKEPETLIPHMKITHSMVLNEVAQ
FT                   GGDARKRIDRLIEDSAQTDEQKNALRTRADEIFRTLIDTDVIEIEQEDGRDYYYTTVDL
FT                   PQDFALDQPLSPFLIAALELLDPASPSYALDVISMAEATLEDPKQILRAQERQARDKAM
FT                   EEMKADGVDYDERLDRLQDITYPKPLNDLLTEAFDQYRKDVPWANDYWINPKSVVRDMV
FT                   ETASDFNGYIARYNAARSEGTLLRYLSDAYRVLARTVPPEKRNEELDDIIAWLRVLVRS
FT                   IDSSLVDEWENAGTQAQEAANLAAPNVANAVVEDRRGLIVLIRNAMFRRVQLMDLDRPD
FT                   ELGALDKAWHYDVHTWEDVLDDFYDEHEYVNTDAEARGGEYFVLDTRHEQDRHEWTVRQ
FT                   IIDDSDGDHDWAITGTVNLDATQESGEVVFTDYSVRDVVNDNDAATVKAQ"
FT   gene            797610..799124
FT                   /locus_tag="Balac_0676"
FT   CDS_pept        797610..799124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0676"
FT                   /product="recombination factor protein RarA"
FT                   /note="COG2256 ATPase related to the helicase subunit ofthe
FT                   Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46049"
FT                   /protein_id="ACS46049.1"
FT                   /translation="MTNDLFAASDPSEEVVRPLAVRMRPTTLDEVVGQRHVLAPGSPLR
FT                   RLADSASTGSLTAPSSVILFGPPGVGKTTLAHIVAKQSGRQYEELSAVTSGVKDLREVL
FT                   RRAHERLVSQGKETVLFIDEVHRFSKSQQDALLPSVENRDVTFIAATTENPSFSVIKPL
FT                   LSRSVVVKLESLEPEELRTVIERAVSNPRGLGGKVRVQGDAVDGIIRLAGGDARKSLTI
FT                   LEAAAGAVDESGSNVPAEITTDVVSTVMDVAAVRYDRNGDDHYDVISAFIKSMRGSDVD
FT                   ATLHYLARMIRAGEDPRFIARRIMIAAAEEVGMAAPQILQITVAAAQAVQMIGMPEARI
FT                   ILSEAAIAVATAPKSNASYTAINQALADVDAGLIGQVPLHIRNAPTTLMKSWGNHEGYH
FT                   YAHDYPNAVVEQQYMPDVLVGREYYHPNSRGYEREIGPRLDRIRAIIHGEPAPPAPTQT
FT                   ERKPTEPVDPAHTEHPGETQRSQMKGKNDDATDTGRKEEDREPGGE"
FT   gene            799066..800568
FT                   /locus_tag="Balac_0677"
FT   CDS_pept        799066..800568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0677"
FT                   /product="efflux-type transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46050"
FT                   /protein_id="ACS46050.1"
FT                   /translation="MTTRPTQGGKKRIANPAANDDRISPKLIGSIVSVGSLAFIGILTE
FT                   TVMTVLFPELMVEFSVNTATVQWITTIYLLSVGVTMPVSSYLKRRFTMKSVFVAAVALA
FT                   VVGSFIMIVGTSFPVIIVARVIQGVGSGIATPLMINIILEQSPRSKVGRLMGVGSLVIT
FT                   VAPAIGPTVGGAVASIWPWRSIFVIVIPVIVLISLPIGLKCITQTKPTEAVSLNPLQFL
FT                   AIIVGLAGMILSLNQGGVAVSEGVSGEPWGRSAAIAIVSLAVGVAALVFFVWSSRRSFS
FT                   PLIRLGWLKDKVVMLHLIPYTLLPMVGIGFGYVITNLAQLSLGTSALVAGMLVLPGALI
FT                   GAFFAPVGGMLYDKHGPTKPILGAFACCFGALVLFLGFSMYLTSVLMASFYFIFGVGYA
FT                   LGFSNIMTDAISGIHHEFTPDGNAVFNTALQFGGAAGTTLFSTILAIAQAGHGAEGTPV
FT                   YRHATAVGGTWTFAVMLAIVAVSWIMLARAFALNKARMEQRA"
FT   gene            complement(800646..802481)
FT                   /locus_tag="Balac_0678"
FT   CDS_pept        complement(800646..802481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0678"
FT                   /product="long-chain-fatty-acid--CoA ligase;
FT                   long-chainacyl-CoA synthetase"
FT                   /note="COG1022 Long-chain acyl-CoA synthetases
FT                   (AMP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46051"
FT                   /protein_id="ACS46051.1"
FT                   /translation="MTDAGIVKEYTTPLKHEIDPDINLFDFLEGRAQRNPDGSMVSYKD
FT                   ANGIWQTFSATEFRDKVVAIARGLIGWGARAGESIAIIAHTRWEWVALDMAIMSIGCVT
FT                   VPVYETNSPAQIRMVFNDAEVVLAFAEDDAQRDKLESIANDTPSMRGSFVIDSAAIDAI
FT                   IAFGANVTEEQFLERKAAVHGDTLATIIYTSGSTGTPKGVEISHGNMAAECMDALQYMP
FT                   RAIDIPDRRLLLFLPLSHVFARFMATVAFAGTLTLGLTSNMKTIIKDFEDFGPTLLLAV
FT                   PRVFEKVYNAASQRAGTGFAGRMFARGVRVAREWSKAKQSGNGIPAGLRMRHAFYDAVV
FT                   YKKIRTVFGRNADFAITGGAPMDSDLAHFYNGIGMPLLEGYGMTETSGPVCVSLPENNH
FT                   IGTIGQPLCGTTAGIAEDGELCFKGRDICMGYHNQPEVTKQQIVDGWLHTGDLGDIDDE
FT                   GFIHLTGRKKDLIITAGGKNVSPGHLETTVMTSPVVAQCLVIGDRKPFVAALVTLDLED
FT                   ANAWLTSQGAKPAADLEELSKNPIVHTEVERIVNKANEGVSRAESIRKFEILPDEFTSE
FT                   NGMLTPSLKTRRKQIIDHYRKLIDTVIYVPRKKAS"
FT   gene            802762..803841
FT                   /locus_tag="Balac_0679"
FT   CDS_pept        802762..803841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0679"
FT                   /product="transposase"
FT                   /note="COG3328 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46052"
FT                   /protein_id="ACS46052.1"
FT                   /translation="MTSVSDDVALTMDDMPLGEDGLIDFRALAVGLIETVADHAMELEA
FT                   DELLGEGNRRNGYRERRLRTVIGEIVLRVPKPREDTYFPERVMRPYSRVDRAMVGVVYR
FT                   AYVNGMSTRRIEKVADELESGRLSPSTVSRMRASLDGEVDALRQAEFDAGSPVQYLWLD
FT                   ATYVKCRDDDSRVCSQATVTAIGAFMDGTRRFVGFDLVDTESYDSWKRFLLSLRRRGVA
FT                   GVRLVTSDAHAGLRRAIMEVFDGASWQRCFVHMQRDLTARIRHRKDQGRAMHALSAVPR
FT                   QPDAAMTRAAYDAAVVRIGAIDRRAGELLEDAREDALAHLAFHREHWVRLRTNNVQERA
FT                   NAEIKRRTRAVQSSPHASP"
FT   gene            803901..804023
FT                   /locus_tag="Balac_0680"
FT   CDS_pept        803901..804023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46053"
FT                   /protein_id="ACS46053.1"
FT                   /translation="MSGDDMATALNPRTPRRAEITDEMQRRADQIIMTALESAA"
FT   gene            804308..805873
FT                   /locus_tag="Balac_0681"
FT   CDS_pept        804308..805873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0681"
FT                   /product="hypothetical protein"
FT                   /note="COG4715 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46054"
FT                   /protein_id="ACS46054.1"
FT                   /translation="MVRRQCICGAHLYGLGHTGPNMFGFIPSSSLAHYNYDCEFNTGVT
FT                   LPGGRILEQCENCGAIVLCEYPTLDGSRRGEDPLIAYGPGTVYEQCDIESVPLTYRSFR
FT                   ALMSSGVTGGVMYSEAFKTNIAKLFDTDIDHLPSWKVLKDALLDSENCALDEWWQAAIG
FT                   RNFIVLYENSKALRLVAAWHRVPGTEILNTDMRRVIEENRDPMRHTASDADEMEQAGRE
FT                   LEISDATKRLLLTGTHARLRLIARSMRLGKPITELARFVSLESLMGGKQLWENGDVREL
FT                   HFVPFGIFHAEVADDTEMHTVDIIMRHNLLSRMMCSCEQAQSLHVCRHEVATILQLAQQ
FT                   FRFAIDLDVEHGVSMREGEHGTGGQFGHYANMLDVMREHEDSRDTYEWLTAYIQPLESD
FT                   TGDLYHTEFMTMPGVMSSVPYVVYEPIMLGFIDSVLTRCSADFTKTLRRYGLDADVDPK
FT                   ILNMRSLDMELVSALITMIVYRERRSDGYLAECLENGVLVGLLKRMRELVEEHKGRQSR
FT                   RIRQ"
FT   gene            805979..806635
FT                   /locus_tag="Balac_0682"
FT   CDS_pept        805979..806635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0682"
FT                   /product="hypothetical protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46055"
FT                   /protein_id="ACS46055.1"
FT                   /translation="MLCETWHKQDPQMDEDLQMKLAQIDLEYCLARTTTAEVAVRDGEV
FT                   VGAVLGRIDAQETRKGINQHHRSVMKIMGPLFFNKSAHQALKNMLNAEKADRQMIKQAK
FT                   KDGHAYDGEIVLFIVREDMRGQGIGQHLFDWMLNEFKVNNVEHYFLYTDTDCDYGFYED
FT                   RGMVRRMEMPMEPHTPKEDTEAHQEADYLDNHLHALMFDNETSPANEGVNPLGRD"
FT   gene            806652..807020
FT                   /locus_tag="Balac_0683"
FT   CDS_pept        806652..807020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0683"
FT                   /product="Putative Zn-dependent protease"
FT                   /note="COG3824 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46056"
FT                   /protein_id="ACS46056.1"
FT                   /translation="MHMSEPEFERTVTEAVRSVPERFKKALSNIAITVADEPTDKEYVS
FT                   MTHGDGELLGLYQGTPITQRTTGYAGVLPDRITIFKGPHERICATHAQMVEQIRKTVLH
FT                   ELGHYFGFDDKYLHSHGY"
FT   gene            complement(807099..807509)
FT                   /locus_tag="Balac_0684"
FT   CDS_pept        complement(807099..807509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0684"
FT                   /product="hypothetical protein"
FT                   /note="COG3304 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46057"
FT                   /protein_id="ACS46057.1"
FT                   /translation="MDIVRLAAYPWPAYTVGMRFIGNLIWLVLGGLEIAFAWFVVGLVL
FT                   CVTIVGIPLGVQSFKMAQLTLTPFGQHVVYGGSVGSLLLNIVWVVLVGWWMALGYLIAG
FT                   VLNCITVIGVPFGIQSFKMCKLALWPFGTTID"
FT   gene            807664..808404
FT                   /locus_tag="Balac_0685"
FT   CDS_pept        807664..808404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0685"
FT                   /product="transcriptional activator TenA"
FT                   /note="COG0819 Putative transcription activator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46058"
FT                   /protein_id="ACS46058.1"
FT                   /translation="MAKSMPTTITRTDLPPFASRMRQAADPVWEEGYRQPFIQELGAGT
FT                   LDRSKFAFYLMQDELYLGAYAKVHALAVTKTDDREVMAWMASVQDAILHVETSLHRDYL
FT                   ASFGLTEEKVLHGQQSAFARAYTTNMLTTAYSGDLLDILVSVLPCAWVYADYGERLARD
FT                   FAQGLEHNPCRQWIDMYKTDEFWQSSVWLLAQIERRVAGVGEERRRGLVDSFVRGVEYE
FT                   YMFWASAYERQMTWKPQWEGLTSR"
FT   gene            complement(808527..808832)
FT                   /locus_tag="Balac_0686"
FT   CDS_pept        complement(808527..808832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0686"
FT                   /product="hypothetical protein"
FT                   /note="COG1534 Predicted RNA-binding protein containing KH
FT                   domain, possibly ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46059"
FT                   /protein_id="ACS46059.1"
FT                   /translation="MALTKKQVRQLRAMANQLKPLVQIGKGDLSDNVIKQADETIEKRE
FT                   LIKVQVLDGSGIDAKEAAQGLADRMGAEVVQVIGNRAVLYRRSHRDDIEHIQLVRE"
FT   gene            complement(809103..809939)
FT                   /locus_tag="Balac_0687"
FT   CDS_pept        complement(809103..809939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0687"
FT                   /product="morphine 6-dehydrogenase"
FT                   /note="COG0656 Aldo/keto reductases, related to
FT                   diketogulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46060"
FT                   /protein_id="ACS46060.1"
FT                   /translation="MALQDGEHTIALNNEVLMPEIGFGVWHAEEGPETVNAVKAALANN
FT                   YRLIDTAAFYKNEKSVGEAIASSDVPRDQIFVTTKVWNDDIRAGKTKEAFDKSLKLLDL
FT                   DYLDLYLLHWPVEGWQQAWKELETLYRDGRVKAIGVCNFEQDQLEELLDLAEIKPAVNQ
FT                   IESNPLFANQDLIDFCHSKGIAVEAWHPMGGRGSDLFENETLRDIGDKYGKSPAQVMIR
FT                   WHMQREVIPLPKSVHETRIVQNIHVFDFELGENDMARINAMDTGERQGADPHHVDF"
FT   gene            complement(810300..812597)
FT                   /locus_tag="Balac_0688"
FT   CDS_pept        complement(810300..812597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0688"
FT                   /product="cobalt import ATP-binding/permease protein cbiO"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46061"
FT                   /protein_id="ACS46061.1"
FT                   /translation="MNASGFQIELRHVGFSYDGGETWALDDVNLGIRAGERVCIVGANG
FT                   SGKSTLLRVMAGLSAPDTGSVTLLGHTVFTDEGGADADAYACARRGIGAVFQNPEDQIV
FT                   TTVTADDVAFGPENLDVPANMIGARVHASLSCVDMLTAWGADPTHMSGGEQQRIAIAGM
FT                   LAIHSRLLVLDEPTAMLDPQARAEVLALLDRIQASGTTLVIVSHLPEELRHADRIVHIE
FT                   HGRITGEDCAQHMPQHDHHSPSVTTFAQLDTLARHVNTEHAGIIGAAPTAVVFDDVSFR
FT                   YERESADVLSHMNLRIPRGCLTAIMGPNGSGKTTFARLLCALDKPRGGRIVVEGIDVTQ
FT                   ARRRERRRLRRVLGFVMQHPERQLFAETVADDVAFGPTNQGLDAAQVRERVDWALDLVG
FT                   VSDLRGRNPFELSGGQQRLVAIAGIIACDPSVLVLDEPCAGLDTSASRHIERLMENLRH
FT                   RGVTVILICHDPDQVDRLADQVILFGNEQQGRAHADSGGEVQREVLSPTDTGYSWVSGL
FT                   DPRVKIVCILTVMCAAFAMNTWAQLAVGVLLTAALWGASRVGFTRLLRSVRGFLVLFAV
FT                   MGALNIGVVHTGDVLVRIGPLPITTGGVSVAIIYTTRFAIVLILGALLLETTTPTRLTA
FT                   AFSSLLSPLRRLHWHTQETALVLSLALRFVPTLAQEALSIRDAQAIRGGSIESGSLPQR
FT                   VNAMCATIIPVFAGAIRHANNLSLALQARSFEEGRPRSTWHAMHIRGRDIVFMTLTVTT
FT                   LAAIIAMNVFTI"
FT   gene            complement(812594..813085)
FT                   /locus_tag="Balac_0689"
FT   CDS_pept        complement(812594..813085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0689"
FT                   /product="Hypothetical membrane protein"
FT                   /note="COG3601 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46062"
FT                   /protein_id="ACS46062.1"
FT                   /translation="MYALFVALAMAVSFIEIPLMPAAPWLKYDPSGIVCILAGFAFGPS
FT                   GAVIVSVLGFVPHLFVNPLGAVMAILVALGYSLPVAFIYRRRSTRTGALTGILLGAAVA
FT                   LAAAIVGNLFITPLYAHMSMQQVASMIVPILLPFNLLKFAINGVVSFLCYRPVCKLIAR
FT                   "
FT   gene            813631..814401
FT                   /locus_tag="Balac_0690"
FT   CDS_pept        813631..814401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0690"
FT                   /product="polyphosphate glucokinase"
FT                   /note="COG1940 Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46063"
FT                   /protein_id="ACS46063.1"
FT                   /translation="MIDTAQAFGVDIGGSGIKAAPVNLEKGEFAEPRLKILTPEHSTPK
FT                   AVGDIVRQQLEHFEVPEDVPVGIAFPAPIKPGKKLDFMANLDQSWIGVDVTEVFSEACG
FT                   RPVTVVNDADAAGLAEQAFGAAAGQDGLVIATTLGTGIGTALIYDGVLIPNTELGHIQL
FT                   PKGKGDAEKYAASSVREKLDMGYRKWAKRLTKYYGLMELYFSPELFVVGGGVSRVSEKF
FT                   LPYIDIKTPIVAAKLHNEAGIVGAAYYANQQSAK"
FT   gene            814581..815666
FT                   /locus_tag="Balac_0691"
FT   CDS_pept        814581..815666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0691"
FT                   /product="aminotransferase"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46064"
FT                   /protein_id="ACS46064.1"
FT                   /translation="MDLDKLNDSNPTAHGLAPQLLPQVYRAQPRGQMEARRRLARAIGC
FT                   PDPERLYLLSSTSQAYAWLMMLLCDPGEAVLAPKPGYPLIESIARLCGVKTVEYQLQFD
FT                   GSWYMDIAALRTILERDGQAGRHIRALIVINPNNPTGQYVKPSEREHLIELCREFGIAL
FT                   IADEVFFDYALEPFEGNRRFAGERRVLTFALDGFSKRLAAPHAKVGWIEVSGPDDDVRE
FT                   AMRRLDVIADDFLPMSELIAERMDDMIAELDSQHDRVQERISRNLESLHRLLDADDLGV
FT                   VSVLRAEGGWNVLLRFPSFIDENELVTTMIRDNATSGQPGYFFDMEANGYLAISLLPVP
FT                   DLFDAHVRLVLSAVRHCVEEI"
FT   gene            complement(815645..816460)
FT                   /locus_tag="Balac_0692"
FT   CDS_pept        complement(815645..816460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0692"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46065"
FT                   /protein_id="ACS46065.1"
FT                   /translation="MFGMGLLTSLFKTTRPVTPPQKVGFGFDHAVYAYDAQTYGVRDIS
FT                   LDLSCSNGNTAIIGLNGAGKSTLIDLMNGTLTPSSGKVTVEADGKSYDASHGGRAQIQR
FT                   IVGTVQREADLYRLRHNVSIEQSIDELLRKYRLTTVQRLAIAGDALAKFSLDTNMRTPL
FT                   DELDGEQLHLFAIARAYAANPGVLLADEPMRGLDEISSRHVAHRLFTCGKPVVFATHNV
FT                   DLIRNDEFNITRVIVMDEGEIAFDGEPASASAYYAQLIRSKYRQISSTQ"
FT   gene            complement(816530..818743)
FT                   /locus_tag="Balac_0693"
FT   CDS_pept        complement(816530..818743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46066"
FT                   /protein_id="ACS46066.1"
FT                   /translation="MTHVNTPARRTHPFIAALVAATVIVLVECLVFNFACLRSRSARPA
FT                   DASQSLIEQGSNSAADPQVTLGPGLAIHGDGLLQVTDATKAYIDAPTNGSSPYAQVLMT
FT                   SLNDIALARTTMTQVQRDELYRELVHVRLDGGRMQTVAVDAPRSTYLPYQDSETRHAQS
FT                   NGDHTVRLWIEEATDSLIPIVGLDANARVPFSWNWAQVLLMAAFAALLIAFSPRSRLWL
FT                   IPLDTSSRLQRGAFTIGALALAGYTAVQIYWQIAGAAPMAYHIPGRYSYDYDQYDHVAQ
FT                   ALMNGHAWLDLPVPEQFAQLRNPYDTAARDRLLEQGVTHIYWDYAYHDGHWYSYFGVLP
FT                   ALLLFLPYRAITSLFVPGGLMLPNASADLLLMFGAAVFGCLLVIRLLKRMPVQVSVATC
FT                   ALSCLAFVLGSNLLYFWHRTNFYSIPFASGLFLTFLGMWLWLGAPVARKRTCTLGRSDS
FT                   ADAASLSLLHVALGALCIAATIGCRPTFALTALLAIALFFPQVRAVFSASTWRERATRI
FT                   QALRFLCALIIPAMLIVVPVIAYNAMRFGSFTDFGNAYQITVANMTDFHTPLPQMPRAL
FT                   CCYLFLPLTFGNDFPWLELTPAPTPIWFFTETTPAGLFVLMPLALLAFAVPFMRRPLGR
FT                   LYATLTSMLALSMVLLVFDAYVGGFAWRYLADFSWLVMLCALAVMAWLVERHPAWRVVF
FT                   VIVLVYAIMLALASMFVIGRDDAMINIMPSRFADVRSWFTLLP"
FT   gene            818826..822155
FT                   /locus_tag="Balac_0694"
FT   CDS_pept        818826..822155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0694"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46067"
FT                   /protein_id="ACS46067.1"
FT                   /translation="MTGTNSNTSDPQPRKPARWLRNLGVNAARYARQVESTAQSMFAGA
FT                   LPTHNMFTPTPTNPLLGVKMPSAETIVLNPLMRRRSFSVAGTGLPFERVGWVQMPGLRR
FT                   FALGYFTSHDRFCTLAMADDTGAVYMTGDLYANLDAREPDLELDVTDSLTTDDDSRFGG
FT                   TKPAHIATVEGSARALVGDIRGRDGNGRMVWLARFLKSANRYTIENARAELPARLRTDL
FT                   EYRDLMAVCFFHLYLAVSVNGGLQGYGAGNIISNFRRFSPLAAIRTSVSQTDTARAHRM
FT                   RVSGLEEYFADTMRRIGVMGDLSELEADHGSEPLYMIESPVSHARFLVWEKRMPYDAML
FT                   TSLKLEGAVNRFLLIDKWLDYNAAHSEQPIEDTVTFKQVARIDRRLLRNPSLSALPPTH
FT                   PVHILDDPECFRVDDYLHFGRGMSLSASLDASQAGVGVDVRHLVGSEWIYRHALANAVN
FT                   ALWLPFRFDTDFRSNLQQGEVAFAFTSASRTLMPDELINMRSGAMAELDEAERSRISAE
FT                   YNLQIGLIFASLAFGASEQIRRVSLRMDSLGLEEAVYERDNAIKTLMDSAMTQISDLTN
FT                   LEDFTTHAGQGRFGERGSALFSGSEETSGVGDDEHDGVQTQAMQTDADFDRELRDLLEH
FT                   DESTSSDDTTTHHAESEDDTVQSILNVDEEFDRLRNSNPSIKHLLTVTFTRDEFIDYMH
FT                   ANSCADPFAVYDAFGAQYDYDGTEGFRPVEPGFSMDDTRFTGDAAYTIPERRDRPLDAT
FT                   VARSLGAHNVRDLSISREEMFRGTLELIADTAKNDGLRADRKATYAMGLIEQCADPELR
FT                   NHATEITTAIIDGTPIPQITSTVERALADARRKSQEMVFSGDEEGAIANMERVIGELDE
FT                   MFESDGVVPRYFTSYTDRVVYNRLFAMPDERIALVPDALFQAHLDMGEVLFRYDRGEEA
FT                   MAHLNTLVRYAPATAGVHIQQAIRLCVSEDWNSVRAAALNALRVACDPVDAANAYYYYV
FT                   CASWMKGDTAVAVAAGNLATSLTQNLAPAQRARLERFRNLAMAQGEQIAQTGAQAVGVL
FT                   MRHDVPVWPQVECAQIIRDAAFTATNEKIFPVAQALNVSWYALQGGNLGPGGMQFLRSL
FT                   NA"
FT   gene            822269..824860
FT                   /locus_tag="Balac_0695"
FT   CDS_pept        822269..824860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0695"
FT                   /product="LigA"
FT                   /note="COG0272 NAD-dependent DNA ligase (contains BRCT
FT                   domain type II)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46068"
FT                   /protein_id="ACS46068.1"
FT                   /translation="MEDALIADEQLDRYPIGSDPWIDSLRDIDSDAMELDDLDVSKLNV
FT                   EQAVRLWSRLSAWVEGDQVAYYVKDAPLSSDAAYDARMNCLKRLESEFPQLDTPQSPTH
FT                   RVGGTFSNDFTAVRHPSQMMSLDDVFSFEELRAWYDGVRKDLEWPEDKLLPMTCEVKID
FT                   GLALNLIYRNGVLTQGLTRGDGVTGEDITMNVRTIHSIPTNLDGPEGDIPDMVEIRGEV
FT                   FMRWDDFHKLNEANEDAGRPPFANPRNAAAGSLRQKDPRITAQRHLSFYAHGIGELVWG
FT                   SGKPVDVADEVRNQSDAYTMYRKWGVPISPHNREVTDFDQILDMIEYYGEHRGDIEHAL
FT                   DGIVVKVDDLALQRRLGSTSRAPRWAIAYKYPPEEVNTKLLNIVVQVGRTGRVTPVAIL
FT                   NPVYVAGSTVSRTTLHNAYEVKRKGILIGDTVVVRKAGDVIPELVGPVIAKREGHEQDL
FT                   REFVMPTRCPSCDTVLRYEKEGDKDLRCPNSESCPAQLAERVINLAARKAFDIEHLGDQ
FT                   SAVALTNPEDNRPDSVEAYAPGVREIVVEPGEEPAPYLAPSGLELPPIQEPVLTSEANL
FT                   FDLEASDLRDVYVWREAQIIEVRRHVDSHGKERKVRHRLGGSGLWHREPAFWSGVKDAP
FT                   LKKDANRKTVKDSEGNPEYEVKPDAVIVGHGRNGRPRIEEPTENTRKMLDEIEKAKHTD
FT                   LSRVLVALSIRHVGPPTAFTLAKHFKTLDALADASAEELEQIDGIGAEIADSIATFFEE
FT                   ARMPGNWRGRVLEAWKAAGVGMSTHDEGLPQTLEGKSVVVTGTLEHFSRESAKEAIERR
FT                   GGKASGSVSRKTDWVVVGANPGSKATKAEELGIPIIDEQQFDTLLATGDVQ"
FT   gene            complement(824930..826042)
FT                   /locus_tag="Balac_0696"
FT   CDS_pept        complement(824930..826042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0696"
FT                   /product="hypothetical protein"
FT                   /note="COG0489 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46069"
FT                   /protein_id="ACS46069.1"
FT                   /translation="MTDQTQIIETAVIERLSHVIDPELGRSVTDLGMICGVDVRPTGLD
FT                   SFNVRVNVELTVPGCPLSAEISRQIEAAVTSYAEAQLTAEIVVGAMDEEKLKSLVNDLK
FT                   AARRENPFSKPGTKTRIFAIASGKGGVGKSSISANLAATFAALGYDTAAIDADIYGFSL
FT                   PRLFGVHDQPTNLNGMLMPVTAWGVKLMSIGMFAGSDRAILWRGPRLQRSLEQFLADVW
FT                   WGEPDVLILDLAPGTGDMAISVAQALPNAELVVVTTPQPSASDIAVRSGLVALQVPMRV
FT                   RGVVENMSYFEHAGERIDIFGTGGGARVSSQLTDALHYEVPLMAQLPLDPRIREIGESE
FT                   GRPAVLNDDGTLRDDDFGRTFGHLAKSLLA"
FT   gene            complement(826173..826781)
FT                   /locus_tag="Balac_0697"
FT   CDS_pept        complement(826173..826781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0697"
FT                   /product="hypothetical protein"
FT                   /note="COG4721 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46070"
FT                   /protein_id="ACS46070.1"
FT                   /translation="MIYPSQASSRKWRVLDITVTSVIAVASGVVFWMWDWVCMAPLTLF
FT                   ENITPGFEGLLNGFWLFAGPLAAVIVRKPGAALYAETVAAFLELTLGNQWGVGGSLIVG
FT                   LMQGLGAELAFALFAYKVWTNLVVLLSGALSGAMCGVYYWFTNPGWGMMRVSIYLGTSV
FT                   VGGVIAAAACIALSRAIARTGALAQFAHWRVRDSEAKRA"
FT   gene            complement(827019..828455)
FT                   /locus_tag="Balac_0698"
FT   CDS_pept        complement(827019..828455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0698"
FT                   /product="glutamine synthetase 1"
FT                   /note="COG0174 Glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46071"
FT                   /protein_id="ACS46071.1"
FT                   /translation="MTPLKTKADAEALVNQEGIEYVSVRFTDLIGVQQHFTVPASEFLK
FT                   DAFDEGMPFDGSSIEGFQAINESDMKLVPDIETAFVDPFRKHKTLDVAFSIVDPLTDEP
FT                   YSRDPRQVAAKAEAYLKSTGVADTASFAPEAEFFIFDKVRFGNDMRGSFYEVDSIEAPW
FT                   NSGLDVEEDGTPNIGFKNRVKRGYFPVPPADHTQDLRDDMVANLQKVGLILERAHHEVA
FT                   GAGQQEINYRFNSLQHAGDDLMKYKYVIHETAALAGKAATFMPKPIAGDNGTGMHCHQS
FT                   LWKDGKPLFYDEKNYGGLSDMARWYIGGLIKHSSSVLAFTNPSLNSYHRLVPGFEAPVN
FT                   LVYSARNRSAAIRIPLAGTSPAAKRIEFRAPDPSCNPFLAFSAQLMAGLDGILNHIEPP
FT                   EPVDKDLYELPPEEHAGIKQVPSSLAEALDALEEDHDFLTAGDVFTEDLIETWIDLKRG
FT                   EIDQARLQPTPLEYELYFHI"
FT   gene            complement(828739..829485)
FT                   /locus_tag="Balac_0699"
FT   CDS_pept        complement(828739..829485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0699"
FT                   /product="hypothetical protein"
FT                   /note="COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46072"
FT                   /protein_id="ACS46072.1"
FT                   /translation="MFEQIVTIYKFTAAEDKALPWITGAVFAAPIVVGIICGIVFHWGW
FT                   VSWITLMILAVMIGLLLFTIVLTRRADNVGYKQMEGKSGAAISILGNMKRAGFDFPQEP
FT                   VWVDPRTRDAVWRGTGYQGIYLIGEGNYGRVMQAMDRQEKQIKGVTAGSHIPVYRICVG
FT                   DGPKQVRLKDLRNTVLKKKTYVPNNYTNPIMRKLHPRHRFALSKPQLITLNDRLHTLQR
FT                   RSGMGIPKGMDPMKTHKVSRRAIRGR"
FT   gene            complement(829626..831107)
FT                   /locus_tag="Balac_0700"
FT   CDS_pept        complement(829626..831107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0700"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3 component, and
FT                   related enzymes)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46073"
FT                   /protein_id="ACS46073.1"
FT                   /translation="MTSEHYDVVIIGAGPGGYTVALRSAELGKSVLLVERDDVVGGTCL
FT                   NRGCIPSKALITATRTIDTIHRGEQIGIDCELQEIDFGKLRAFRDGTVSTMRDGLLALL
FT                   TFRGVHMVQGIASVVEDGHVHVRPAQGGQTIRIRTADGDFKDGGQSLDVTAGDVVIATG
FT                   SRPKPLDVAPFNHVLIDSTRALALNSFPHSAVVIGSGATALEFASMWNSAGADVTLIMR
FT                   GDIVLSRSDRRAAKILMRELKRQGITIVTNAAITAVDTGENLGVTVHYTDADGNGQEVF
FT                   AEWALAAIGRVPNTDGAWFAKASIELDENGLVKTDAYGRTSREHVWALGDITPGHQLAH
FT                   RAYQQGYVVAETIAGLDPSPVDEYTIPTVVFSNPEFASVGYTLREAKADTELVDVTETL
FT                   IPVMSNARMLMSGASGSVSVVSGKKSADQSDDVHVLGVHIVSPDASDLIAEAQQIIGNH
FT                   VPLSAAARNIHPHPTFSEMLGETLLKADGRPLHTR"
FT   gene            complement(831328..831936)
FT                   /locus_tag="Balac_0701"
FT   CDS_pept        complement(831328..831936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46074"
FT                   /protein_id="ACS46074.1"
FT                   /translation="MALFKKKETESKQDVAQAPAEPTVGKGRPTPKRKDAEARNLRPLV
FT                   PENTKEQRKLAKQKLRERENREYEAMRTGDLNNMPKAERLPWRIYTRDYIDARFNIGEY
FT                   FIPVALVMLVASVIFTVIFPSPLVSIIIMTLLYLYLFAIVIDEVVMWRKLKKLLIAKYG
FT                   EQSVARGMRTGSYAWSRSIQFRRWRLPKPRYAKRGHFPE"
FT   gene            832047..833414
FT                   /locus_tag="Balac_0702"
FT   CDS_pept        832047..833414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0702"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase"
FT                   /note="COG0624
FT                   Acetylornithinedeacetylase/Succinyl-diaminopimelate
FT                   desuccinylase and related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46075"
FT                   /protein_id="ACS46075.1"
FT                   /translation="MILTADQIRARVDADWPQILGVVEDRIALRPISAHGINGEHMRKS
FT                   AEYVANKLREVGVDAKAVQARDKDGNPSAWEVIGSLEVNPNAPTVLLYAHHDVQPVPDE
FT                   KEWDTAPFEATLKGDRLYGRGACDDAGGIAIHYGALRALGDQLGVNIKVFIEGEEEMGS
FT                   ASFIPFIEAHHDEFDSDVIIVADSGNWAPDVPSLTTSLRGNATCDVHVKVLGHPVHSGQ
FT                   YGGPVLDANTLASMLIAKMYDEKGELAIPGLMEGEPIGGLQRDLDEADMRAAAGVVDSF
FT                   TLVGTGSLASRLWTKPSATVIGFDAHPVKDSFNVISPETTFRVSLRVAPQQDPHVAMDA
FT                   MVDFFEKNAPFGAEVHVEPLEAGMGWAMNPDCEATQDALTSLKEAFGIDPVNKGEGGSI
FT                   PFIPELQKIFPDAQVLVTGPEDPISNAHSPNESVSVSGLRKDVVAEALLLDKLGRA"
FT   gene            833653..834774
FT                   /locus_tag="Balac_0703"
FT   CDS_pept        833653..834774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0703"
FT                   /product="Signal transduction histidine kinase"
FT                   /note="COG4585 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46076"
FT                   /protein_id="ACS46076.1"
FT                   /translation="MQKRLKNIAHPFLAFIIAAFSLVFECDVWLFTPPKQWWFISVLML
FT                   AQALAISCYWSPVWCSVALLLLNGVGEYAISGYAQFTSYFMFLAVILICYKTSNRIAAA
FT                   LCLLMMSYTCLETMIRPGSFTGYGCLAFCMIYAVASTIGRYMAWEQRRMERMRESVMVE
FT                   SRLRQLEANQYLAAYLHDALSQELALISMETQLHAVDKSVPDEERWRRVSDYTQNALAD
FT                   LRGIITQLRGDGDFKKNGDEPENVVALLRREAAAGDRLLHDHGFSGETVLESAQDANMH
FT                   SSELCGLLSLICHELYTNMLKHAETARPYHVSISLSSSHVCIRYANGIGEQSVAGGGNG
FT                   LRSLQSLITSMGGDFSHDADDGGWSGTVEIPLQ"
FT   gene            complement(834793..835233)
FT                   /locus_tag="Balac_0704"
FT   CDS_pept        complement(834793..835233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46077"
FT                   /protein_id="ACS46077.1"
FT                   /translation="MPNGAGYTKPPQNQSNGVYFAPICVSSEGLSDAQSRKLDEDIDEC
FT                   KDLHVSAIDLGHQTQLGNPEFYGDPEVALIDCLHRGNLMPKDYTINKYWLQFEAYMNGT
FT                   KAGSVPDDWFSFDLNDSAMLTCLASDKSPLLQTRLEAWKPFG"
FT   gene            835339..835581
FT                   /locus_tag="Balac_0705"
FT   CDS_pept        835339..835581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46078"
FT                   /protein_id="ACS46078.1"
FT                   /translation="MFNIESIKSVVLLANLPVSAPAMLSSVLETFPEQADMLRTHAMTA
FT                   IKDGMLRVLFIHAPLQNGKPNTMHQLWPMFGFPRW"
FT   gene            835977..836831
FT                   /locus_tag="Balac_0706"
FT   CDS_pept        835977..836831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0706"
FT                   /product="hypothetical protein"
FT                   /note="COG3409 Putative peptidoglycan-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46079"
FT                   /protein_id="ACS46079.1"
FT                   /translation="MLGMPHTVESAPASSQEYSGTQQVNVVPTIAADRQLPGNATGTVT
FT                   ENWMAGELRSGSRAYQVNDRTVVALHTATPLYRDLKVGDRGEDVRSLNDELSRLGYDSV
FT                   PQSGEYNRNTGNGWRQLMVDAGNSDGAGEDDMNLRLSDTMWIPPDSVKVQGWSATRGSA
FT                   VQAGAPLGTVPGGLVRLAIRGGKPSDEGRPLTVFGVAAPLAPGTTDITDGELLQRIAAT
FT                   EGYQGKSAEERAAGMDPAHAQQGDPDPTRAGRFGVRHQWDLGMHRHRHVRQSPCRTGAH
FT                   HHQ"
FT   gene            836812..836928
FT                   /locus_tag="Balac_0707"
FT   CDS_pept        836812..836928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46080"
FT                   /protein_id="ACS46080.1"
FT                   /translation="MRIITSELGASLVQPSSGGGEGVDRVLIGPRLGTLRCS"
FT   gene            837273..838478
FT                   /locus_tag="Balac_0708"
FT   CDS_pept        837273..838478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0708"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46081"
FT                   /protein_id="ACS46081.1"
FT                   /translation="MRLFDLDYAADRRFSELSGGEAQRLMLARAVCSRPDMLLVDEPTA
FT                   QLDTRTAHSVSHVLGNLANQGMIVLVATHDPDTRDACARNRSGLLCARGGRGRVGMGLR
FT                   SIFSEAIRNIGSGTAHALALFLVVLLGGVLLGGYEAYTVVAMECESLTRVRAVADVDSV
FT                   IGGTVDGSACDRLTRTTDGAITQAGAMRAGGEITALSTPNNALQSYEVTPGMLSLVASN
FT                   GTTTDSIDMSGIWVPTEVARDFGLTIGSTLSTSHGEAMVAGIYSWPNDGRDTRFAYTFL
FT                   VPRAASQGTYNECWVRQWPRSGAASNLLYSTLGVGEGSGQAGVTSLDKGFDSHYDPYAT
FT                   YMGRVTHWIPYLSILIGVVIGVLAVRVRRLEYAAALHSGSRSRRCCSASARRCSSGPDW
FT                   EH"
FT   gene            838514..838657
FT                   /locus_tag="Balac_0709"
FT   CDS_pept        838514..838657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0709"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46082"
FT                   /protein_id="ACS46082.1"
FT                   /translation="MAIGDVASVMLASCRAPLAMCSGTFVGAIAMEMTARQSQLFLLFK
FT                   RR"
FT   gene            838893..839513
FT                   /locus_tag="Balac_0710"
FT   CDS_pept        838893..839513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0710"
FT                   /product="Hypothetical membrane protein"
FT                   /note="COG4721 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46083"
FT                   /protein_id="ACS46083.1"
FT                   /translation="MSASVIEAKPVLKWRVVDIAVASVIGVASALIYWFVAFATAAPWS
FT                   LLEGVVPGLAGIFNGLWLFAGPLAAIIVRKPGAALYAEIVAGVLEALMGNMWGGVETFL
FT                   IALVQGLFAEIAFAVFAYKKWNLGVTVLSGALSGVGCWGYSFFTHLQAIDLGGSYGVVY
FT                   LITTVLSGALVAGVAMWYLYLGIARTGALDQFASGRAVRGAKH"
FT   gene            839554..842109
FT                   /locus_tag="Balac_0711"
FT   CDS_pept        839554..842109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0711"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46084"
FT                   /protein_id="ACS46084.1"
FT                   /translation="MTTVKSACVEPTTGIALQFDHWGYRHASRKHFAVRGLDLKIHAGE
FT                   HVLLLGASGIGKSTILEGAAGLLGDETGQTDASRVNNAAEGEPPVAVEDADGGITEGAI
FT                   RVGGIEVHAARGKVGLVLQDPDAQAIFQRLGDNVVFGPENLNVPRDLAWQRVDEALNAV
FT                   GLAGVQLDRSVMHLSGGQMQRLALAGALAMRPEVLLLDEPTANLDPDGVVQVVGAVDDV
FT                   LRQTHATMVLVEHRADRWIDMIDRVVVLGLERTDDTRQVGNSGEESEIARTNFRNTVVV
FT                   ADGTPDEVFHNTDIDFNELGIWVPERYRTAEDEITRIHTVDEPEYAPQTGLPEVLLSTK
FT                   ELGIGRDGNAIAEHINLDFHPGQITALVGANGAGKSTLSLTLAGLLKPVEGEVIAHDGL
FT                   AGELDKVWPIDWTSRQLASRISYVFQNPEHQFACSSVLDEVMLGPLRTGMAEEQARARG
FT                   MDLLRRFHLDQYAHVNPYTLSGGEKRRLTVASALASAPKVLLFDEPTFGQDRRTWMQIV
FT                   RLIHDLRSDGVSIVVVTHDRELVTALGARVVELVPTRNPQGLGDDVAATIAARLASPQD
FT                   AVDTTLVPVSQVNERVEEAKPASRSRFLASINPVYRLFGAFLASLPLLASLDWVSASVA
FT                   LGLEFVVLMAIGFTPWRIVRSTWPIFIGAPGSALAVLLYGKSGGDTWWQWGWVNITDRS
FT                   AELALATALRILAIGIPAIIAVLGIDATDLADGFSQILHLPDRFVYGGLAGMRLFSVLQ
FT                   DDWTALTASRRSRGLGDDSAVASFFPQSFALLVLSIRRSTTLAVAMQARGFGGTAPRSH
FT                   ARMSHVHARDYWFLAGCLLIPVIALASAAFAGTFSFMGN"
FT   gene            complement(842192..842911)
FT                   /locus_tag="Balac_0712"
FT   CDS_pept        complement(842192..842911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0712"
FT                   /product="ABC transporter"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46085"
FT                   /protein_id="ACS46085.1"
FT                   /translation="MTMHTETETPTTHSAMADGETSVPILQLKDVSYAYAKGGRNVLSD
FT                   INYTFPSGSVTAIVGPSGAGKTTLLSLISGLTTPTGGEVLFEGHNLAKMDRYCYRSRDI
FT                   GVIFQSFNLLPGLTVLENIMLTMDASGKRFDRPKRDIALDLLKQVHLPERYANERILHL
FT                   SGGEQQRVAIARALSTNPQVVIADEPTGNLDPATQDDIMRIFIELAHEQNKCVIIVTHS
FT                   PQIAERSDRVFQLSKRD"
FT   gene            complement(842949..844286)
FT                   /locus_tag="Balac_0713"
FT   CDS_pept        complement(842949..844286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0713"
FT                   /product="hypothetical protein"
FT                   /note="COG0577 ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46086"
FT                   /protein_id="ACS46086.1"
FT                   /translation="MDGGIEAVDTNNGSSQESSDNANSRTDTGTAGAGTEGAMPNDMPR
FT                   DMGGQNGGPAMTTGDFSLVGFSSDEALVNAPNGSFTMNSGKAFDYDASDGNPVLVSKTL
FT                   ADANNLKVGSTFKLANISDSKKTYTFTVAGIYSNTQESNMPMGGPMASSANDAANAIYM
FT                   SAATLGKIGLDSTKTLSITDSKGNTRETSAAQLSFTYVFDGKADYDRFTEDVRKAGLSD
FT                   DYTVSSMDVEQYGQSLVPIDNLSKFARTMLIVVLSVGAVVLVILTIFNIRERKYEIGVL
FT                   TAIGVKKWKVAAQFAVELLTVVLIGLIVGTGIGAATSVPVSDALLSSQVASQQSQQESR
FT                   RAQFGRDMQGAPGAAPDGNAQSAKPNTDNTQGESAVPNEGKQPQSGMPQGLQHASNAIK
FT                   QVNATVSWATIGWMLLIGSALTLLASLTAAIFVMRYEPLQILADRS"
FT   gene            complement(844383..844643)
FT                   /locus_tag="Balac_0714"
FT   CDS_pept        complement(844383..844643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0714"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46087"
FT                   /protein_id="ACS46087.1"
FT                   /translation="MFIVHNAIRNLWRNKGRSVLIIIVATIIAAASTIGFAIVQAAQRA
FT                   RASALENTTIGAQISLDRNKIMQSANSSGQKPDMGSFGKAT"
FT   gene            844771..845676
FT                   /locus_tag="Balac_0715"
FT   CDS_pept        844771..845676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0715"
FT                   /product="rRNA methylase"
FT                   /note="COG0566 rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46088"
FT                   /protein_id="ACS46088.1"
FT                   /translation="MGTARYAGGMPIDQQVLTNTKAERIRRISELTNRKHRQKAGKFLI
FT                   EGPQCVREALTWQPQIIQDVYVRTDGADPDSPIASTALGKLAGEAMEERIHVHKMTQEV
FT                   EHRVSHDAQGVFAVADLNSCRDLLGRVPQTPHPFLAAFWQMRDPGNAGTVIRSADAAGC
FT                   DAVVLVGDCVDIFNPKVIRATTGSLFHLPVLAMDERAFFDLCRERDTTVLAADVYGTEG
FT                   KPPVSLPDLLRNRELVEGSKAVLFGNEARGLTTELLDECAMSVSIPIYGKAESLNLGTS
FT                   AAVMLTTLAMSSRIETMGSR"
FT   gene            845755..846822
FT                   /gene="pheS"
FT                   /locus_tag="Balac_0716"
FT   CDS_pept        845755..846822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="Balac_0716"
FT                   /product="phenylalanyl-tRNA synthetase subunit alpha"
FT                   /EC_number="6.1.1.20"
FT                   /note="COG0016 Phenylalanyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46089"
FT                   /protein_id="ACS46089.1"
FT                   /translation="MAEGIVFDADAVSKDIAEGIAAIQQASTMEELKAIKAKYAGANSA
FT                   MTRASKAIGSLAKNEKKEAGKVMGKLRADFGRAYGTKEASVKAAQEAAELAAETVDMTL
FT                   PIRRKPLGARHPLPKLMEDVEDFFVGMGWQISDGPEVETEWFDFDALNFGPDHPARQMQ
FT                   DTFYVKGNQSKDAAGFVGSNMVLRTQTSSDQVRGLISHGVPLYIACPGRVFRTDELDAT
FT                   HTPVFHQVEALAVDKNLTMADLKGVLDKLAVAMFGPEAKSRLRPSYFPFTEPSAELDLW
FT                   FPDKKGGPGWIEWGGCGMVNPNVLRSAGIDPDIYTGFAFGVGVERTLLLRHDINDMHDL
FT                   VEGDVRFSEQFVMGE"
FT   gene            846842..849433
FT                   /locus_tag="Balac_0717"
FT   CDS_pept        846842..849433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0717"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /note="COG0073 EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46090"
FT                   /protein_id="ACS46090.1"
FT                   /translation="MGWLREHVAVPENETYEELARDLVRVGLEEEEIHTSNVTGPIVVG
FT                   YVVDATPEPQKNGKVINWCHVDVGEEYNDVDEHGNKVPRGIICGAPNMKAGEKVVVTLP
FT                   GAVLPGNFKIEPRKTYGHISDGMCASERELGLGDSHDGIILLRDYGFTPEEYEALQPGD
FT                   DAMHLLHLDEPILEINVTPDRGYAFSYRGIAREFHNSTGAEFTDPVAAFEERAPQLEDQ
FT                   NGQTHDIDVIIDDDNPIHGVVGCDRFYVRAVHDYKPGSPTPNWMRHRLSRAGMRSLSLP
FT                   VDVTNYVMLDLGQPMHAYDLDKISGPIVVRRAKAGETLVTLDGKKHDLDPEDLLITDSP
FT                   NGEQGSRILGIAGVMGGEYGEVTDETTNILLEAAHFDPITVARSARRHKIPSEASRRFE
FT                   RGVDTQIQPAAAQMAVDLLTKYGDAKASDTPRDVNNVKRGHPIAFKAGEVKRLTSLDLD
FT                   INKISDILTDIGCSVAGGGNGEFSVTAPSWRPDLTAACDLVEEVARIYGYDRIPVRVPH
FT                   APVEGHVGLTDDQLHKRQVADELAEYGLVEVLSYPFVGKADFKNFQIDSEEVEKVSVEI
FT                   VNPLAGDRPFLRRQVLLTLATTVQRNLHRGLENICCYELGHVYLADPEAPAVPALPGAQ
FT                   RPSDDQLSALDAGLPEQPLHVAAILTGNAEDDGWLGDKRPVDWTDAVEAVHRIADRLGA
FT                   KIVLDQSDGDKAGAQWHPGRVARIMSGDTPVGVVGELHPKVDDALGFPRHSAAFEIDLT
FT                   ALFSTLSNKPVQAKPISTFPPVKQDLAFTVPTSVTAHELTETIRQAAGDVLESIELFDV
FT                   YTGDQVGDGKKSLAYAVTFRAPDRTLTSQDSEEIRQRIVEKTATLGAQLRA"
FT   gene            849473..850261
FT                   /locus_tag="Balac_0718"
FT   CDS_pept        849473..850261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0718"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46091"
FT                   /protein_id="ACS46091.1"
FT                   /translation="MSEQEQHDTSNGVPNEPNDQHHAAPTAHGERHAINPDAAQDDVRG
FT                   LVLDGRFDDDPPSVGSSNGLEYGALDSQFPATYDPYIYGHPDTDDALGAAAARAQAQRG
FT                   NEYGQPSQQNAYGQQAGLPYQTQNQPGSGRQGNGGRNQPPFNLNDPSFINSMNQMNPDD
FT                   PNQNPLYGHWDPGAIIAFVFALILPLPVLPALFGWFSMRRTKIYHMKGYGLAVAALVIN
FT                   VLYTIMWLYFLVSGVSPTEYLNQMLNTLNNGSGGSDSVKA"
FT   gene            850390..851484
FT                   /gene="argC"
FT                   /locus_tag="Balac_0719"
FT   CDS_pept        850390..851484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="Balac_0719"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="COG0002 Acetylglutamate semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46092"
FT                   /protein_id="ACS46092.1"
FT                   /translation="MTKYTVAVAGATGYAGGEALRILAAHPAFEVTAVAGHSSIGHRLG
FT                   EYQPHIPQLADLIVEDTTPAVLDGHDVIVLALPHGASGALAAQLDDDAVVVDLGADHRL
FT                   ERQQAWDDYYGGDFYQHWTYGMPELILGIGSDGKYVRQRDELTGAKRIAGPGCNVTATT
FT                   LALQPAIAQGLVDTKSIVADLAVGYSGAGKNLKRTNLLASEAMGSASPYSVGGTHRHIP
FT                   EILQNFAHAAGLGASQADMFSLAFTPILVPMSRGILASVSAKLTDEALALTDEQIHDIW
FT                   VQAYEGQEFIFVLDPGVMPATQNVLGSNAAHVQVAVDRRSGTLHAFTAIDNLNRGTAGQ
FT                   AIESLNIAFGLNDATGLSKIGVAP"
FT   gene            851481..852653
FT                   /gene="argJ"
FT                   /locus_tag="Balac_0720"
FT   CDS_pept        851481..852653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="Balac_0720"
FT                   /product="bifunctional
FT                   ornithineacetyltransferase/N-acetylglutamate synthase
FT                   protein"
FT                   /EC_number="2.3.1.35"
FT                   /note="COG1364 N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46093"
FT                   /protein_id="ACS46093.1"
FT                   /translation="MSVTFAKGFEAAGVVAGISSQTGKQDVALVVNNGPLNAAAGVFTS
FT                   NRFCAAPVQWSRKQVSDGELKAVILNSGGANACTGEEGYQQTVRTAEAVALMMHVEPSE
FT                   IAVCSTGLIGELLPLDKVIEGAQKAFDSLDSSAQAGSDAAHAIMTTDTKPKTVNRLGSN
FT                   EFRIGGMVKGSGMIAPQLATMLCVITTDAVVSAGQLQAALTAAVDRSFNRIDVDGCMST
FT                   NDTVLLLASGASGITPDPDEFNGLVADCCSSLARQIIGDGEGASHDIRIRVTGATSEDA
FT                   ALACGRAVAASNLLKCAISGNDPNWGRVVSSLGTVPADVAPYDPNEVSVTINGVRICAN
FT                   GGPDRDRSEVDMTLREIDIDIDLNAGESEACVWTDDLTHEYVHINADYES"
FT   gene            852663..853619
FT                   /locus_tag="Balac_0721"
FT   CDS_pept        852663..853619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0721"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="COG0548 Acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46094"
FT                   /protein_id="ACS46094.1"
FT                   /translation="MASPLRGPGYHLDVHTDLGPDQKAEVLIEALPWLEEFFGKTIVIK
FT                   YGGNAMVNDHLKECFAEDMVFLRQVGIHPVVVHGGGPQISQMLKALGIHSEFKGGLRVT
FT                   TPEAMDVVRMVLTGKVSRELVGLINAHGPLAVGLSGEDAALFSASQRKPIIDGEPTDIG
FT                   LVGDVVGVDASAVVDLIHAGRIPVVSSVAPNEDDATEVLNVNADSAAAALASALGAHKL
FT                   VILTDVDGLYADWPDKNSLVGRIGVEDLRDLLPELESGMRPKMEACVRAIDGGVQQAHI
FT                   IDGRKPHSILNEIFTTAGVGTMVEPGEGMELRSSYDL"
FT   gene            853609..854862
FT                   /locus_tag="Balac_0722"
FT   CDS_pept        853609..854862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0722"
FT                   /product="Ornithine/acetylornithine aminotransferase"
FT                   /note="COG4992 Ornithine/acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46095"
FT                   /protein_id="ACS46095.1"
FT                   /translation="MTSEQIDLTHDTELIGEYEQVHMHVFGTPLRVLDHGQGTHVWDVD
FT                   GNEYLDFLAGIAVNSIGYAHPAWIEAVSAQAAQVAHVSNYFATRPQISLAAKLVELAGA
FT                   PQGSHVYFGNSGAEANEAALKLAKLYGRSLGADKPYRIIALEHGFHGRTMGALSATWKP
FT                   AIREPFQPLVPNFEFVPANDLDAMRAAFEATDSGPVASVIMELIQGEAGVLPLDPEFVR
FT                   GVRSLCDEHHAKLIVDEVQTGMGRTGKWFAFQRDDLGGITPDMVTFAKGVAGGFPMGGM
FT                   IAFGEELSNLFSPGTHGSTFAGNPLGAAAGLATIGVIEREDLLVNAEARGEQLRRQIRA
FT                   CGNPLFESVRGRGLLNAIVLTHPCAHAAMDWALEHGLIINAVAPNALRLAPPLVVSEND
FT                   VDEAVHVLAAIPSDLPND"
FT   gene            854946..855908
FT                   /locus_tag="Balac_0723"
FT   CDS_pept        854946..855908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0723"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COG0078 Ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46096"
FT                   /protein_id="ACS46096.1"
FT                   /translation="MGELRHMLRDDDVNHEEQKQILELGMKFRADRFYHRPFEGPQGVA
FT                   VIFDKPSTRTRSSFSIGVAELGGYPLVIDKSGSQLGRGEPVADTAEVLTRMAYGIVWRT
FT                   FEQSRVEQMARVATVPVVNALTDEFHPCQVLADFLTLAQFKGGVDNLENLKIAYVGDAA
FT                   NNMSNSYLLAGAVAGMDVRVAGPNGYLPDQKIVEDAQAIAETTGGSIMVTVDPEQAVDG
FT                   VDCIFTDTWVSMGEEAEYAIRSKPFWPYQVNERLMGLAKPDALFQHCLPAYRGKEVTTG
FT                   VIDGPQSVVWDEAENRLHAQKALLTWLIGKQRGDESLLS"
FT   gene            855928..856473
FT                   /locus_tag="Balac_0724"
FT   CDS_pept        855928..856473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0724"
FT                   /product="arginine repressor"
FT                   /note="COG1438 Arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46097"
FT                   /protein_id="ACS46097.1"
FT                   /translation="MSEQTGSESSNGASGVGRPSTRAARLQMVRQLLADNVVTSQAQLS
FT                   ELLAREGFPVTQATMSRDLDEVNAAKTRLADGTIAYAVADQVPLATVPESNGQGRGEQQ
FT                   LAKILTGLVVSVAHASNFVIVHTPAGAAQYVASGIDKHSIDGVLGTIAGDDTILIICSD
FT                   DTTAGRRAEWMLRISSRS"
FT   gene            856553..857791
FT                   /locus_tag="Balac_0725"
FT   CDS_pept        856553..857791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0725"
FT                   /product="argininosuccinate synthase"
FT                   /note="COG0137 Argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46098"
FT                   /protein_id="ACS46098.1"
FT                   /translation="MSDKNRIVLAYSGGLDTSVAIPYLKDRTGKDVVAVSLDVGQGGES
FT                   LETIKERALACGAVEAYIVDARDEFANEYCMQALKANAMYEGVYPLVSAISRPLITKHL
FT                   VRAAHQFGADTIAHGCTGKGNDQVRFEVSIQSIDPELKAISPIRDLSLTRDVEIAYANE
FT                   HDLPIVQTEKSPFSIDQNVWGRAIETGFLEDPWNAPTKDCYSYTDDPDFPPVEDEVVIE
FT                   FKEGVPVKIDGREVTPLQAIEEMNRRAGAQGIGRVDLIEDRLVGIKSRELYEAPGAIAL
FT                   ITAHEELENMCLEREQHRIKRGIDKRWAELVYDAQWFSPAVHSLNAFINDTQRYVSGEI
FT                   RMVMHGGRAVVVGRRSDSSLYDYNLATYDSGDTFDQNASNGFIEIYGLPTKVAAARDVR
FT                   FGNGIEVPQNDVE"
FT   gene            857906..859402
FT                   /locus_tag="Balac_0726"
FT   CDS_pept        857906..859402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0726"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="COG0165 Argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46099"
FT                   /protein_id="ACS46099.1"
FT                   /translation="MSDDHKPESQDHLALWGGRFSSGPSPELALLSKSTQFDWRLADDD
FT                   IAGSRAHARALGRAGLLTADELQRMEAALDELQRQVDSGEFTPIDDDEDEATALERGLL
FT                   QIAGDELGGKLRAGRSRNDQIATLIRMWMRRHARVVANQLLNLADALIVQAKDAGHTVM
FT                   PGRTHMQHAQPVLLAHQLIAHVWPLLRDVERLRDWDQRVDASPYGSGALAGNTLGLEPV
FT                   AVARELGFTNVTENSIDGTASRDLVAEFSFVMAMAGVDISRLSEEIIIWNTQEFGFVKL
FT                   DDAYSTGSSIMPQKKNPDIAELARGKAGRLIGDLTGLLATLKGLPTAYTRDLQEDKEAV
FT                   FDQVDTLEVLLPAFTGMIRTMRFDEQRLEKEAPTGFALATDIAEWLVKNGVPFRHAHEL
FT                   SGACVKVAENRGVELWDLSDDDFIEIFRGFVEPDVAVEVREVLSTEGSVSARAGKGGTA
FT                   PNRVREQIMSAKTLIEQLRSFFQVKSDGMAYKACGSLNKQ"
FT   gene            complement(859486..860271)
FT                   /locus_tag="Balac_0727"
FT   CDS_pept        complement(859486..860271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0727"
FT                   /product="L-2,3-butanediol dehydrogenase/acetoinreductase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46100"
FT                   /protein_id="ACS46100.1"
FT                   /translation="MTDIRVAIVTGAARGIGRGIAVKLAKDGFDVAVADLEGQRQEAEE
FT                   TIHRIEQEGRRAFFRPTDVSQRDQVFGLVDDTVNELGTLDAMINNAGICQIKPMLDVTQ
FT                   EELETIYRINLFGMVYGVQAAAKKMIKLGKKTGHIVSASSIAGFEGFPILSAYSSTKFA
FT                   VRGFTQAAAQELAPYNITVNGYAPGIVDTPMWTFIDEEMSKLNGKPLGQNFKDMVDTIA
FT                   LKRCETPDDVAGVVSFLVSDNARYVTGQTVIVDGGMQYR"
FT   gene            860324..860911
FT                   /locus_tag="Balac_0728"
FT   CDS_pept        860324..860911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0728"
FT                   /product="hypothetical protein"
FT                   /note="COG1418 Predicted HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46101"
FT                   /protein_id="ACS46101.1"
FT                   /translation="MPPTYIESDYIGKAHASHMQLAAYAGTYQGEGGGMLDDGGIHAIV
FT                   NAYGADILSHEQMQIERDSLQHGAVTTYEHSIAVACLSVKIADRLHLWHHVNLRSLVRA
FT                   ALLHDYFLYDWHEKDNGSHRLHGFRHPYTAERNARADFELDDIVSNSIRTHMFPLTPIP
FT                   PKYLEGVIVNIADTLCAIRETLSPSRFHAAKP"
FT   gene            861000..862322
FT                   /locus_tag="Balac_0729"
FT   CDS_pept        861000..862322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0729"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="COG0162 Tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46102"
FT                   /protein_id="ACS46102.1"
FT                   /translation="MAHVIDFKEAGFDSVLDELEWRGLISQSTDRDRLAHTLNGEPVHY
FT                   YCGFDPTAPSLHIGNLVQLIIMRHLQEAGHHPIALVGGATGLIGDPRQSGERILNPKDI
FT                   VEQWCERLRIQIGGILEQEGSNPVTFVSNYDWTATMNVLDFLRDIGKNFRVGTMISKDI
FT                   VARRLNSEEGISFTEFSYQVLQGNDYLYLYDHYDCVLELGGSDQWGNLTSGLDLIHKVR
FT                   GVNVNVMASPIITDANGKKFGKSEGNAVWLDPNMLSVYKFYQFWLNRPDVEMASLLKAF
FT                   TFLPKAEIERLVEATDTNPGAREAQRVLAWEVTSLVHGDEPTRKAIDASASLFGRGGDL
FT                   ADIDLETLESVLDGLKVENEAGEKVFAQALPGDRIAQAGVSAGLFKSISEARKTIKSGG
FT                   VYVNNVRVEDEEQLLGDGDFLKGRFVVLRRGKKALGVVARS"
FT   gene            862458..864125
FT                   /locus_tag="Balac_0730"
FT   CDS_pept        862458..864125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46103"
FT                   /protein_id="ACS46103.1"
FT                   /translation="MADERGSRNSNNSRGRSYGNSRGNSGSRGRGNGGGFHRGGNSGSR
FT                   FNSHNRNDRGYRHEGDGEFRRDGNGRYSRDDRRDSRDGSRRGNGERRGFRRDDDRRGNG
FT                   GFRRRNDGDRRFNRDDNRGDGEHRGFSHDNDHRSNGRHDGERRYDRFDHAGHNNDRRNN
FT                   PRYNRDDDRRGNDRHGDRNNRNERREFNREDRQAYHDRKRDEYMSKSRKNSDGTVSFPS
FT                   QNPYDHLRPGEPKLPKGLEWSMLSKDERERLRGLSKEHAENIGLHILAAYTLEGNDPDR
FT                   ALAHAKWAAKQASRVDIARETLAMIAYRQGDYKLALREFQTAFRMNGYLDYLPFMADCE
FT                   RGLGKPKKAIELCMGDDAKHLTGEAKAEMFLVYAGALADLKLWNQAIEVVSKLVHAKGL
FT                   AGEYRMRAAQAEQYFLEESGRSDEAVAMDELIDDLEDRYADVEQDETDDDFVVDYDVED
FT                   LPEDLQAKLGVTPDDAQYAPFDDEDGVNMDDETRIPAEEQRAGAEMDIEPAEMQERNTR
FT                   RDEEGLMADPDLTDAQDDIDEEDAEIGDSEEEIKEETE"
FT   gene            864122..865162
FT                   /locus_tag="Balac_0731"
FT   CDS_pept        864122..865162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0731"
FT                   /product="hypothetical protein"
FT                   /note="COG0647 Predicted sugar phosphatases of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46104"
FT                   /protein_id="ACS46104.1"
FT                   /translation="MTLLKATEAPLSQTYSLALLDLDGVVYRGKDPVAFASESIRQAEH
FT                   LGMTIEYTTNNSSRMQSVVADQLRGFGLDVEPWQVITSSVVAARMVSKHVPQGAKVLVV
FT                   GAEHLQDEVGKAGLTPVQYASDHPTAVIQGWFPQMTWQMLAEASFAVENGAMYFVTNRD
FT                   LTIPREAGIAPGCGSMIQAVINATGVQPIASAGKPESAMYDEARELAAQGDTEPVCKAR
FT                   SLAIGDRLDTDIEAGNRGGYDSLAVLTGVTNPTELMCAPKHLRPTYIVRDLRGLNEAYP
FT                   RIDVDEAGTRATCAQAQASLTHRRLTVNDPNDVNALRAACALTWQAADSGQDVAAFALP
FT                   EFSLGE"
FT   gene            865222..865980
FT                   /locus_tag="Balac_0732"
FT   CDS_pept        865222..865980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0732"
FT                   /product="hemolysin-like protein"
FT                   /note="COG1189 Predicted rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46105"
FT                   /protein_id="ACS46105.1"
FT                   /translation="MREERLDVVVANATGESRSKAQRLIKTGKVHVNGHPQTKPAYAVQ
FT                   PESTISVHMAMEDDYVSRGALKLLGAFNAFAPAGFTSVEGKHCLDIGASTGGFCDVLLR
FT                   RGAAQVIALDVGHGQLDPRIADDPRVIEMSGVNMRYVGVDDLPYRPDVIVSDVSFISLT
FT                   YLMAAIAEVAAPAAQIVLLVKPQFEVGQKGRLGKNGIVTDPSLREQALERVERCAREHG
FT                   LQVVASAPSPIEGTHGNAEYLLYLRMSQSS"
FT   gene            866238..867701
FT                   /locus_tag="Balac_0733"
FT   CDS_pept        866238..867701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0733"
FT                   /product="hypothetical protein"
FT                   /note="COG0168 Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46106"
FT                   /protein_id="ACS46106.1"
FT                   /translation="MANLLFDESASNSETSKGFGWWFSGDTFERNAYEERNPHSRSLSY
FT                   RLNSHPGRLTIIYFLALITVSTSLLCLPIATQPGKKTSFSTAFFTAVSALSTCGISVVN
FT                   TTDHWTIFGQVVLIFSVQMGGLGVMTFASLIALAVNHHLKAMQRLLAANELGTNKLSEI
FT                   RGVLQVVLMTTLVIEVVTFFALFPGLLSVNKGNVGRTLWESLFFAVMSYNNAGFTPDGA
FT                   GLYVNNWAVGLPIMMSAFCGTLGFPVLLNIFRTARMHKSPKHWSLHTKITMIMTFAIVF
FT                   MSLIWFLAVEWDNPVLFKDGDVDTRMRRAMVAAVMPRSSGFDLSWVPGVKECTKVFMSI
FT                   VMFIGGGSTSTAGGIRVTTLAVILLVCKAAFTGHTDVNAFHKRIPQHVIMTAISITASC
FT                   VALVFIASVALMLITDSSLSHAMFDTCSAFGLGGYTVGVAQENNPASLYVLAAAMVVGR
FT                   LGPMTLAYAVSRPKELDVVRYPEGQIVVG"
FT   gene            867792..868442
FT                   /locus_tag="Balac_0734"
FT   CDS_pept        867792..868442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0734"
FT                   /product="hypothetical protein"
FT                   /note="COG0569 K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46107"
FT                   /protein_id="ACS46107.1"
FT                   /translation="MPENRSVLVVGLGRFGSAVATTLDALGQDVLAVDKDPELVNRWSS
FT                   QIPTVQADMTDVLAIEQLNASDFDTAVVAIGDSVEASVITAGNLLDAGISDIWAKSVSK
FT                   EHARILQRIGARHIINAETDAGKRVGHLVSGNYLDYIELEGAYSVVKIHTPPQFVGYTI
FT                   GEAKIHDRYGVTIVGVKSPGHEFQYASNDLQLKRNDELIIMGKQDQIDHFIRG"
FT   gene            868532..869506
FT                   /locus_tag="Balac_0735"
FT   CDS_pept        868532..869506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0735"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /note="COG0061 Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46108"
FT                   /protein_id="ACS46108.1"
FT                   /translation="MKMAKVRHAVVVTHKKLRETGTIVQDTLLQLERGGFDVTLVDTDT
FT                   IPDFGTLPQTVPPETEIVVVLGGDGTILRAAELVHCTDVPIIGINMGHVGFLAEFESFQ
FT                   LEEAIRRICDHDYRIDERMVAHVDVWLPGTTEALSDWALNDVTIERADRGKMVEMSIGI
FT                   DGVAMSSFGCDGVIVSTPTGSTAYAFSAGGPIIWPDVQALLMVPLAAHALFSRPIVIGS
FT                   TSTLQFTIHDDSTSGGWICCDGRRQLALAKGTRVEIRQSASKLRLARLSDVPFTNRLVT
FT                   KFNLPVEGWREQNASKHEDTDGRLLTDPQGTSLKGEGDEVDEC"
FT   gene            869631..871361
FT                   /gene="recN"
FT                   /locus_tag="Balac_0736"
FT   CDS_pept        869631..871361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="Balac_0736"
FT                   /product="DNA repair protein RecN"
FT                   /note="COG0497 ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46109"
FT                   /protein_id="ACS46109.1"
FT                   /translation="MVNMLEELELRDLGPIDSATITPAPSMTAITGETGAGKSMLLNAL
FT                   RMISGGTADASRVASGADQAWAQGIFALGERDPLRAMLAEAGIPVDDDGLFLSRSVPAK
FT                   GRSRSVLCGKSVPRSLLGEVASNLITIHGQTDQLRIASVARQREFIDAYARDDKARESF
FT                   NQSYEKYRSVCERLRRLQTQESSMRQQADYLRDSIARIDHVDPHDGELEELMDQRDRIE
FT                   HAEQITSGVEHALAYLDASQFESAEGAAGVGQLIAGAVQSLRGIHAVGDYEQLAERLES
FT                   AGAEIDDVVFSLSRSLDADGETGNLDSINGRIHDLNELAQRWGPTLADVLQWRDRAKID
FT                   VEDLDASPEQLHSLEQERDRLRDEAIARGRALSKARTDAANALSAQVNRELGQLAMSGA
FT                   KLDIVVTPRNGEGMLDATGIDDIEFLFTPFPGSASLPMGKSASGGELSRLMLALELCAA
FT                   DSSQESDSSQNASAGMTFIFDEVDAGVGGKAAVELGRRLAKLARRNQVIVVTHLPQVAS
FT                   WAERQYVVSKETGKEGTHTTVREVSGGERVREIARMLAGSESKTSLEHARELLHESEIE
FT                   "
FT   gene            871373..872056
FT                   /locus_tag="Balac_0737"
FT   CDS_pept        871373..872056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0737"
FT                   /product="hydrolyase"
FT                   /note="COG0637 Predicted phosphatase/phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46110"
FT                   /protein_id="ACS46110.1"
FT                   /translation="MANMVNAAGVNSGRAAIFDLDGTLLDSMGVWDAVDVEFLGRRGFD
FT                   VPADYMQKVSAMQFHDIAAYTIRRFGLDDTPEELMREWNDLAYEAYTTTVELKPGARAY
FT                   LEWLRASGARLAVATSMLPSLREPAMRHAGIYDLFDVVVGTGDDGSSGKDNPVIFLHTA
FT                   QLLGVKPAHCTVFEDLLTAVESAKRAGMHVWGVQDDSSAMHWERICETADGVLFDFTQA
FT                   PRQLT"
FT   gene            complement(872150..873637)
FT                   /locus_tag="Balac_0738"
FT   CDS_pept        complement(872150..873637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0738"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="COG0498 Threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46111"
FT                   /protein_id="ACS46111.1"
FT                   /translation="MSTFHSTRSSDEAFTSKQAIRKGIADDGGLFVTDALGETKIDISD
FT                   LAGKSYQQIALTVLSVLLDDYTEEELSQCIAEAYGSQWSDERITPVKPLGNDFIMELFN
FT                   GPTCAFKDVALQILPRLMARTTPADGDCDEKIMIVTATSGDTGKAALAGFADAQGTGIT
FT                   VFYPQGKVSRVQELQMTTQQGSNVNVCAVDGNFDDAQSTVKRIFGDRDLASRLEADAHV
FT                   RLSSANSINVGRLVPQVVYYFSAYAQLLEQQVINVGDQVDFVVPTGNFGNVLAGYYAKL
FT                   LGLPVRQLVVASDRNNVLFDFLTTGTYNSKRPFFETTSPSMDILVSSNLERMLYYMSER
FT                   DPRMITYLMNDLAEWGTYEVPPEMLMEIRKVFATGWADEDQVREMIADCWDRNHYVIDP
FT                   HTACGYFVMQQMPADPQVPRVLLSTASPYKFPRVVNEALGLKADGTDFECMDELHAKSG
FT                   TPIPQMLRNLENAEVRFRDCVEVSDMGHYVEECADRL"
FT   gene            873774..875087
FT                   /locus_tag="Balac_0739"
FT   CDS_pept        873774..875087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0739"
FT                   /product="Gamma-glutamyl phosphate reductase"
FT                   /note="COG0014 Gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46112"
FT                   /protein_id="ACS46112.1"
FT                   /translation="MTNTNELQTPVSGDVQQAVNALADAAAIAQHELAQATADTKNGVL
FT                   MAIADALDAHASDIADANAMDMQAAFDAGMDQGKLDRLKFDVIRVAAAAQGVRHVATLP
FT                   DPVGEIVRGYDLGNGLRLQQQRVPLGVIGMIYEARPNVTVDVAALCLKSGNAAILRGGH
FT                   AAERTNAATLQVIDEVLQELHFDPALVASVDRYGREGARAMMRATGHIDVLIPRGGAGL
FT                   IQSVVHESRVPVIETGAGNVHIYVDSSADIDKAIDIVVNAKTQRVGVCNAAEKLIVHRD
FT                   IARQFLPRMAQALARAHVTIHADELSMRIMGDADIKDIQLLAADEADWGTEYLALEIGV
FT                   RIVDSLDEAIDHINRYSTHHTESILSQDYTNIERFTKAIDSAVVMVNASTRFTDGGVFG
FT                   FGAELGISTQKLHARGPMGLQEMTTTKWVGYGNGQVRA"
FT   gene            875105..875722
FT                   /locus_tag="Balac_0740"
FT   CDS_pept        875105..875722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46113"
FT                   /protein_id="ACS46113.1"
FT                   /translation="MEWLDEREDGAGGMTEVVSDAPVNPWGLDLDDPFIALRLTAERLS
FT                   LVRYVFVVQIEDGIATAGQRASLEYADAVLIGWPDEHAKGLDAPTDEDRRTIDEQIRLM
FT                   EEYVDKFRTMEQDGDIDGMTDTLIRITERVARVRSIYQPKFLLPTFAEIRRVVQDEWDE
FT                   DMGKIDSDTVMNDNGESGLAKDVQKAALDADEAGRGTDRASE"
FT   gene            875719..876423
FT                   /gene="nadD"
FT                   /locus_tag="Balac_0741"
FT   CDS_pept        875719..876423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="Balac_0741"
FT                   /product="nicotinic acid mononucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="COG1057 Nicotinic acid mononucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46114"
FT                   /protein_id="ACS46114.1"
FT                   /translation="MNGTTPMDRSMSELSPYAQREVELVSQHGRRSARGNWHAHARIGI
FT                   MGGTFDPIHNGHLVAASEVAWVYDLDEVIFVPTGRPVFKLDKHVTNEEDRYLMTVIATA
FT                   SNPKFVVSRVDIDRPGVTYTIDTLRDIRARYPDAELFFITGADAVAEIMRWKDAERMFD
FT                   IAHFVAVTRPGYSSKVPLPAGKVDMLEIPALAISSTDVRQRARNGEPVWYLVPDGVVQY
FT                   IAKHGIYDEDAK"
FT   gene            876515..877534
FT                   /locus_tag="Balac_0742"
FT   CDS_pept        876515..877534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0742"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COG0462 Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46115"
FT                   /protein_id="ACS46115.1"
FT                   /translation="MSAILEGKPDKNLILVTGRAHPKLATDVADQLGIDVLETTAYDFA
FT                   NGEMYVRYTESVRGADVFVLQSHCTPVNKSIMEQLIMIDALKRASARSITAVCPLLGYS
FT                   RQDKKHRGREPISCRLVFDLLRTAGADRVMSVDLHAAQTQGFFDGPVDHLIAMPVLVDY
FT                   IRDRFDGHLDNVTVVSPDAGRIRVAEQWAQRLGGGPLAFVHKTRDITRPNQAKANRVVG
FT                   DVKGKDCVLVDDLIDTAGTIAGACQVLREAGARSVTVVATHGVLSGPAVDRLKSCGARE
FT                   VVLTDTVPIPEEKRWDGLTVLSIAPLLSSAIKAVFEDGSVAELFDTYPEHHGQGFLFA"
FT   gene            877622..877695
FT                   /locus_tag="Balac_0743"
FT   tRNA            877622..877695
FT                   /locus_tag="Balac_0743"
FT                   /product="tRNA-Gln"
FT   gene            877758..879140
FT                   /locus_tag="Balac_0744"
FT   CDS_pept        877758..879140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0744"
FT                   /product="bifunctional protein glmU"
FT                   /note="COG1207
FT                   N-acetylglucosamine-1-phosphateuridyltransferase (contains
FT                   nucleotidyltransferase and I-patch acetyltransferase
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46116"
FT                   /protein_id="ACS46116.1"
FT                   /translation="MTLTAAIVLAAGEGTRMRSRKPKVLHEFAGKTFLNRVMDAVGALD
FT                   PETLAVVVRYQAQRVAEAARSYDDAVLIVEQDEIPGTGRAVQCAMEQLGEQGPLSGTVL
FT                   ITASDMPLLDTSTLKQLLDYHRDSGDGATVLTTVLDDPTGYGRIIRDADGNVLKIVEQK
FT                   DGNSSELAVREVNTSVYVFDAAVLEQAIANLNADNAQGEFYLTDALTVARQVSKVGAFA
FT                   APDPLSVEGVNDRVQLASLAKAHNLRVCRQWMLDGVTIVDPQTTWIEDEVEMESDAVIL
FT                   PGCFLQGHTTIAHDAVVGPYTTLIDATVEPEAHVERSRVQESRIGREANIGPWTYLRPG
FT                   NEIGTGSKAGAFVEMKKAHIGDGSKVPHLSYVGDADLGENTNIGGGTITANYDGVHKNH
FT                   THIGSDVHIGAGNLFVAPVNVGDGVTSGAGSVIRHDVPGDAMVYSENTQHVVDNWKPAW
FT                   ER"
FT   gene            879151..879555
FT                   /locus_tag="Balac_0745"
FT   CDS_pept        879151..879555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0745"
FT                   /product="hypothetical protein"
FT                   /note="COG0799 Uncharacterized homolog of plant Iojap
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46117"
FT                   /protein_id="ACS46117.1"
FT                   /translation="MEQSINSVRVAATAADGMKAEDVVAYNVGDKLGICDLMMIASASN
FT                   ERQVLAIAEEVEKQLFLKDGGRKPRSREGVEEAQWVLLDYGDFIIHIMHDEARDFYNLE
FT                   RLWRDCEPVDLELEHPESRGIKSSDADTEE"
FT   gene            879619..880251
FT                   /locus_tag="Balac_0746"
FT   CDS_pept        879619..880251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0746"
FT                   /product="hypothetical protein"
FT                   /note="COG0406 Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46118"
FT                   /protein_id="ACS46118.1"
FT                   /translation="MQGSIDIPLDEVGLWQVNQSAQSLIKLYVLPDPSRHQLVVSSDLE
FT                   RSMQTAHAFADRLGSEVHADERLRERHFGEFEGRSGAYLQANFPQDFDSWCRGMGGEMN
FT                   HGAESHEHAGVRSMEAMNDWAHECDDDTDLFVFSHGALIENALQVLFGIERRYPDFTLT
FT                   SMCNAHWARLRRADIDMDSRWIMEDYNHGPALADTQYWERPDTLPAK"
FT   gene            880351..881280
FT                   /locus_tag="Balac_0747"
FT   CDS_pept        880351..881280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46119"
FT                   /protein_id="ACS46119.1"
FT                   /translation="MKNFFKGISFSQLLAGALAAVTSFLLSSKIGIAGSVIGVAVASIV
FT                   STAASQLYQNVIDASSKKLQDAAQQVGVAPPHANAHTGDHSTADIDDTQTIAPVHSDSS
FT                   RGARTVVSGTHATDASKHPQAGTKPQMTKHDKRVAVIVALISGLVAVGITAGVILALTG
FT                   GKGTDSVVRDVVSPTYSQTPAEMPTQTPTQTPAPTQSGEGSDTDSRHTKDSSTSDRNGQ
FT                   SSGSSSGNANTGSGNSGSDSSNPGSSGSSGSQNSNGSGTAGTGSAGQDGNSGDTQNTDS
FT                   GNGDSGGSVNDGTNSGTTQKKDGSQAQQ"
FT   gene            881420..881495
FT                   /locus_tag="Balac_0748"
FT   tRNA            881420..881495
FT                   /locus_tag="Balac_0748"
FT                   /product="tRNA-Ala"
FT   gene            881541..881616
FT                   /locus_tag="Balac_0749"
FT   tRNA            881541..881616
FT                   /locus_tag="Balac_0749"
FT                   /product="tRNA-Ala"
FT   gene            881751..882155
FT                   /locus_tag="Balac_0750"
FT   CDS_pept        881751..882155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0750"
FT                   /product="hypothetical protein"
FT                   /note="COG3576 Predicted flavin-nucleotide-binding protein
FT                   structurally related to pyridoxine 5-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46120"
FT                   /protein_id="ACS46120.1"
FT                   /translation="MAQLTEDMKEFIKNNLAWVATVNQDGIPDLGPKMSMFVLDDNHLA
FT                   YHERTAGQTYRNLENGSPLVVAFANFEQKKGYRFRGEVVLHTDDAIYDEQVKLANERGT
FT                   KVPACVPVLEISEIEDLSAGAKAGTVISHD"
FT   gene            882254..883078
FT                   /locus_tag="Balac_0751"
FT   CDS_pept        882254..883078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0751"
FT                   /product="phosphoglycerate mutase"
FT                   /note="COG0406 Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46121"
FT                   /protein_id="ACS46121.1"
FT                   /translation="MIDEVMFMRHGRTAFNLQRRLQGQIDIPLDIVGQWQVDMSGFTLA
FT                   QRFYWAKVSNIARHPDRLSQPSDPPIRRSDITEYEQAPASRRRMVVVSSDLFRAQQTAH
FT                   AFADPLGLDVTLDSRLRERDFGQWEGMSREEINERYPEGYASWKAHEGGEAAYGVESRP
FT                   DLGKRGSSTIRSYCDDPQYMDEPTTLFVVSHGSWIAATIGNLMGLPDSQLDNLTGMRNA
FT                   FWSRMEPQYTSNSVLFHLTEYDKGPDVADAVDWENGPAYLRNPDMPMWKPLI"
FT   gene            883219..884169
FT                   /locus_tag="Balac_0752"
FT   CDS_pept        883219..884169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0752"
FT                   /product="Mg2+ and Co2+ transporter"
FT                   /note="COG0598 Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46122"
FT                   /protein_id="ACS46122.1"
FT                   /translation="MLRMFSTVDGQVRQISKPENGSWLALADPTDVELATVSQETGIDL
FT                   ADLRAPLDDEERSRVDVEDDYTMIIVDIPTVEERSGRDWYETIPLSIIVTKTMIITVCM
FT                   QDTPVLHPFMEGTIRGFNTFMRSRFILQILYRNATMYLRYLRIIDRETDKLELRLRHSM
FT                   QNREILMLLELSKTLVYFNTSLKSNEIVMEKLMTLTRIKQYPEDEDLLEDVITENKQAI
FT                   EMANIYSGVLANMTDAFASIVSNNLNNVMRIFTMISITLSIPTLIFSMYGMNFQQGMIG
FT                   MPLSDSKWGFLVIVLLACVLAGAVIWFLTRSRLFK"
FT   gene            884298..885068
FT                   /locus_tag="Balac_0753"
FT   CDS_pept        884298..885068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0753"
FT                   /product="solute binding protein of ABC transporter system"
FT                   /note="COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46123"
FT                   /protein_id="ACS46123.1"
FT                   /translation="MSIGVPADEPGVGWYHDGEYSGLSVEVAKYVAKVLGYGDEQLFFH
FT                   SQTPATRLDRLDDGSVDFAMVTFAYDGGKNALEMDHTQTADGTRYEVSGPYLVARNQLL
FT                   VRADDARRLPDVQSLDGRTVCTVAGEYSGEQLHDRHPRIKILQRADYSECSASLLVGQS
FT                   DAIAGPQPILAGLRKDGGTRYLHLQEDSYGTQAFGIAVKADQRKLMELIDTALQQMVDD
FT                   GAWDAQIDAMETELGMHVDLSLNPVTVARSQDDE"
FT   gene            885229..888120
FT                   /gene="leuS"
FT                   /locus_tag="Balac_0754"
FT   CDS_pept        885229..888120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="Balac_0754"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="COG0495 Leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46124"
FT                   /protein_id="ACS46124.1"
FT                   /translation="MAQRIEEKWQDIWESEGTFWAANVSGELTDSKGRHADGRQSFFAM
FT                   DMFPYPSGKGLHVGHPLGYLATDVVSRYHRMKGENVLHAMGYDAFGLPAEQYAVQTGQH
FT                   PRITTEQNIANMRRQLRRMGLSFDDRRSFATIEPEYVRWTQWIFSRIYDAWYDPDTRNP
FT                   SGSMGCARPISTLIGQFRAGTRPIDGHEDKAWDELTEMEQTEVLNEYRLAYISKSPVNW
FT                   CPGLGTVLANEEVTAEGRSERGNFPVFQRELRQWSMRITAYGHRLIEDLDSIDWPEKVK
FT                   LMQRNWIGESHGASVHFKVPVDGEMADMEIYTTRPDTLFGATFCVVSPEHPMLEHVPQS
FT                   WPEGVDPAWTGGYATPSEAVSAYRELAEAKTAADRVADNGEKTGLFTGLYAINPITGAK
FT                   LPVFTADYVLMDYGTGAIMAVPGGDQRDYDFAVKYGLPVIYTVAPLPDSGDDLANYEGT
FT                   APFVSHDGIVINSAVDATWARGDALCLDGMRVDDAIAAVTTWLEEAQVGKGATSYRLRD
FT                   WLFSRQRYWGEPFPIVYDEHEVPHLVPDSMLPINLPDVPDYSPKTFDPEDSQSSPEAPL
FT                   SRNEDWVNVTLDLGDGPKTYHHDTNTMPNWAGSCWYYMRYLNPHDTEHMVERDEYDYWM
FT                   GPKHSPAAGQAGGVDLYVGGVEHAVLHLLYSRFWHKILFDLGYVDSFEPFHKLFNQGMI
FT                   QAYAYTDDRGQYVPAEDVQESEVDGKTVYTYEGEPVNREFGKMGKSLKNIVTPDYMYDH
FT                   YGADTFRLYEMSMGPLDESRPWNTRNVVGGMRFLQRLWRNVIDENTGEVTVTDDAMDER
FT                   TLKLLNNTIAEVTGEMEAMRPNTAIAKLIVLNNHLTGMNGVPRAAVEPLVLMVAPIAPH
FT                   IAEELWNRLGHDESLAHHPWPQADERYVGQDTVTAVVQIKGKVRAKLEVSADIDPDELE
FT                   KMALEAVAERLGGKPPRKVIVKAPKIVSIVPGE"
FT   gene            888232..889008
FT                   /locus_tag="Balac_0755"
FT   CDS_pept        888232..889008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0755"
FT                   /product="putative DNA-binding protein"
FT                   /note="COG1555 DNA uptake protein and related DNA-binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46125"
FT                   /protein_id="ACS46125.1"
FT                   /translation="MGIVYSGRRESPDAVIVLREGAVTRLRHLGGPSSRSMAAGSSTGP
FT                   GFSIQMPSVPLPPPPGVQEPSVTASNEQSSGGVREVSGDDQKAGALLSSLTVVNDDDFE
FT                   AERGVRRLERPRFELEPKHALLCIMVLVCALATTLTLLVQQAANMGALDTQATTNASSH
FT                   TTATASPSDRDSTPSTAAPEPSPSASDNKQDTLVNINTADEAQLQEIKGIGPVTAARII
FT                   EYRTQHGAFASLDDLVNVPGIGMKTVEKLRPWACAQ"
FT   gene            888990..890756
FT                   /locus_tag="Balac_0756"
FT   CDS_pept        888990..890756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0756"
FT                   /product="ComA-like putative transmembrane protein"
FT                   /note="COG0658 Predicted membrane metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46126"
FT                   /protein_id="ACS46126.1"
FT                   /translation="MGMRAMTAPACDREHRGIAGSRDLRMLPVAAGVWSATLLTRWVCS
FT                   QHGSGHDVFWQHGRMLQMACLAVASAAIFIALVLIPLTMNGAGKHHGLAVDRAHRMLYT
FT                   LLTVCFAILAATLATAARSLTEHADPVNMSASSSTERVNLTFTAHSLPLATSMGGYDCQ
FT                   VDGNARSIVRHDVRRPSSRGVRVFARQPACGRIAQQGDYAIVGTIQAAAYGEMPIWVLA
FT                   DGDMMAVKEPPAPWRAVHRIRMAFLQTTRGLDNPGVVLVPGVTLGVLGHDAMVHCADGG
FT                   VEDEYAELLQEQCRRAGIMHLMAVSGGHYALVGTLVMGLGARLHWNRFVKAGALAMVYP
FT                   MLTMVLAPSRSVTRAMLMSMLSLGFLMLGRRRQSVHLLCLTVVFGLLLDPSLASSYGFA
FT                   LSCAAVFGLSTACTRMTAWVSHLLPDRLAKLLAASCCAQLFAGPVQILMDNEVSIWSLP
FT                   ANLLVAPFVDAATILGLCSLFVAWMAPGVSRFLAWACSQCTTVIEYAARLFGSEESSTL
FT                   AWMEGIPGAAVLIVTELTTWALIVCIGDLLRAYDDTVTNGDGRPMRMPVRERLTQWFEH
FT                   TLEMMGWLTWRR"
FT   gene            890822..891784
FT                   /locus_tag="Balac_0757"
FT   CDS_pept        890822..891784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0757"
FT                   /product="hypothetical protein"
FT                   /note="COG1466 DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46127"
FT                   /protein_id="ACS46127.1"
FT                   /translation="MTAATLCLLIYGGDEYLNEQNARDAVYRLLEEHRDAELARVDARS
FT                   ADANSFDEAVSPSLLSQRSVVWVEHAEDADSGLLDAIVAYANETNRDPEASPVVMQCAA
FT                   TLKGRSVEALMRRNNIPVDTVPKLDKAKDKLNYVYQQFQSRGRRIDPQAAQQLVNVLGD
FT                   HVGELAAMIRQLCFDFDDDPMRVNRVNQYLTGNPKVTGFNVADLAMGGKTARAVIALRS
FT                   ALAQGTEPIALIGALALQMRNLAKAAAIRQGDISKTKAAVNEWALRTANGRLGGWTSQG
FT                   ISACMQRLAWADEQCKSRGGDPIYALENTIELIGAKGIQ"
FT   gene            891781..892410
FT                   /locus_tag="Balac_0758"
FT   CDS_pept        891781..892410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0758"
FT                   /product="Putative ATPase"
FT                   /note="COG0802 Predicted ATPase or kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46128"
FT                   /protein_id="ACS46128.1"
FT                   /translation="MNTIHHMLEPNPSPAPRQPDSTITLQVPTAQAMHELGERLARSLH
FT                   GGEVILLSGPLGAGKTTLAQGLGEGLGIQEPIVSPTFTIARELDGTLADGTPAHLIHVD
FT                   AYRLGSNDYAPGQAQADLLLDELESLGLDEELEEPGTRTIILMEWGEQMAVALADERLE
FT                   IRIQRPTDHVSAPIGRNEPTADGERIVTITPVGTRFALAEPADTQA"
FT   gene            892486..893328
FT                   /locus_tag="Balac_0759"
FT   CDS_pept        892486..893328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0759"
FT                   /product="hypothetical protein"
FT                   /note="COG1214 Inactive homolog of metal-dependent
FT                   proteases, putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46129"
FT                   /protein_id="ACS46129.1"
FT                   /translation="MNTLVIDTSFGSTVGITGHEPICEQDSRTHVEKLQHDIAQVCAEA
FT                   KIQPHDIERIVVGIGPAPFTGLRAGIVAAKAIAYATGAQLLGQDSLSGQAAMMQAAYNG
FT                   DPNLLNTAIFGNWNTPANAGTALHLTLSVNDARRKQLYYTLLANTNADTKDERIQLDMN
FT                   IGTPSNIAAKVSAAVATIQQRHPDQPVAVDIVGHGASKYEQIWSEQPWHGITLDHSLLD
FT                   TGAWGVKTFAALAEHDTEADANPRPIEPLYLRRPDVSVPNPLKHVLNHEGAHRNEANA"
FT   gene            893325..893822
FT                   /locus_tag="Balac_0760"
FT   CDS_pept        893325..893822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0760"
FT                   /product="Acetyltransferase"
FT                   /note="COG0456 Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46130"
FT                   /protein_id="ACS46130.1"
FT                   /translation="MIVDANTLDRATVCSQIAKMELQLFGKGAWSNTLIDEELSAPHRS
FT                   YYVNVDDQGTIDAYAGLWYDGYDAQIMTIGVSPERQRQGIATQLINQLIAKANELHAER
FT                   MLLEVRVDNEPALTLYRHFGFETMGIRKRYYQPENKDAYTMSLTLRDSRPAGFAIPLNT
FT                   QC"
FT   gene            893863..894906
FT                   /locus_tag="Balac_0761"
FT   CDS_pept        893863..894906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0761"
FT                   /product="metalloendopeptidase Gcp"
FT                   /note="COG0533 Metal-dependent proteases with possible
FT                   chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46131"
FT                   /protein_id="ACS46131.1"
FT                   /translation="MSNQIILGIESTCDETAAAVVQGKTLLANVVASSMDEHARYGGVI
FT                   PEIASRAHAQSFVPVVSKALADANMTIDDVDAIAVSAGPGLAGCLAVGVSGAKALAWSA
FT                   NKPIYGINHVIGHVAVTQLQFGDLPANTMALIVSGGHTSLLHVNDIARDVEVVGTTLDD
FT                   AAGECFDKVARLLGFPYPGGPYIDRHAQHGDPHAIKVPQGLTQGRAGKEHPYDFSFSGV
FT                   KTAIARWIEERQGSGQEIPVDDVCASLAGSVAQVLSRKSMRGCEQFDSTTLIVGGGFSA
FT                   NSQLREALMEVGCNHGVDVRIPQIKLCTDNGAMVAMLGSNLVEAGVAPSDMEFPIDSAM
FT                   PLTKICM"
FT   gene            895040..895115
FT                   /locus_tag="Balac_0762"
FT   tRNA            895040..895115
FT                   /locus_tag="Balac_0762"
FT                   /product="tRNA-Asn"
FT   gene            complement(895139..895645)
FT                   /locus_tag="Balac_0763"
FT   CDS_pept        complement(895139..895645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46132"
FT                   /protein_id="ACS46132.1"
FT                   /translation="MEPVQPNMPKSSDDHGDTSSTASSTHRNASIIVMLCLAIVFAAGA
FT                   ALIVHNMNVSHLTHARHMCAAASDKLRIAMNTYTYLHDSEASKAYHLGTYDVQDPNVLV
FT                   QFAKEYEEKAPEITGCNADSVEELQRRTGRIMENTGWYTTHHDRLKELTELVNESRRDT
FT                   VSGTQ"
FT   gene            895848..895923
FT                   /locus_tag="Balac_0764"
FT   tRNA            895848..895923
FT                   /locus_tag="Balac_0764"
FT                   /product="tRNA-Asn"
FT   gene            895975..896352
FT                   /locus_tag="Balac_0765"
FT   CDS_pept        895975..896352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46133"
FT                   /protein_id="ACS46133.1"
FT                   /translation="MSRNTDDRRALAAIESERMEDQIAYYRKPFMVLWAAVQEASSELE
FT                   EDYGLSSDVSQLWVAERLRQVSDSLVDRLAEKAVQHGTSKSNVARAADSDPTNAMRRFP
FT                   RLRPGAVRTRLLIDEVLDSLE"
FT   gene            896587..897165
FT                   /locus_tag="Balac_0766"
FT   CDS_pept        896587..897165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0766"
FT                   /product="hypothetical protein"
FT                   /note="COG0739 Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46134"
FT                   /protein_id="ACS46134.1"
FT                   /translation="MVRLWMLRLLRMQHELLILALCLVCGAVAPLAVSSSEIHGMELVA
FT                   GCTAIAGEMCHARMLSPVPDGLIVRGFDRPEWQWSPGHRGVDISLNGMHELLAPSDGAI
FT                   SFSGMVAGKSVVSIDTGPYTLTFEPAHTQLAVGDKVHRGKRFASVGGQSDHCGESCVHW
FT                   GVKRTGRRDYLDPASFLRPMQIRLVPYSE"
FT   gene            complement(897186..898700)
FT                   /locus_tag="Balac_0767"
FT   CDS_pept        complement(897186..898700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0767"
FT                   /product="hypothetical protein"
FT                   /note="COG4213 ABC-type xylose transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46135"
FT                   /protein_id="ACS46135.1"
FT                   /translation="MGKGTSHIIRAFVSLAMAGSLMCATAGCSTDPLTGTATTSPSATT
FT                   AASTGHVALFLPSNSPNLSQNVPLNNWNTLNDSLENALSTGGFSGKSMNRETSGSLASQ
FT                   SDALKRYVQERLNADSKEQYGDPQTEQGATTIVIAPAVRLDRNYGEYSHFITTPNQEPS
FT                   DQDASDTDSDESSSMRQIADSLNKAKNAGMHVVVLGNPIDGFVPNVYVPLVTAADIGRM
FT                   QAQQIVSKLDLDAVSESNPKAIEVLLPNTDPSGKNNSFQAQAFEGIWEVLGPYFRQRKA
FT                   YSPSQRLSFFTTKSDYKDVMFKATKDSQIEDELKSRLETKGRDAAVRIDGILAMNDFTA
FT                   AASIKALKTMGYSGSSMDVNPSITIFDVVGNIAGRKPLNRQRVPDPAQSGDESAQPSQT
FT                   TKTDSKQWPIITGFGAYISDIPNIVNGLQWMTGLVDVHANTGTIAQIALQLNRKEKLSN
FT                   IAELKTSDDYGSEIPTLHMTLLAVSAANLKAALIDPGYISLADADM"
FT   gene            complement(898816..900039)
FT                   /locus_tag="Balac_0768"
FT   CDS_pept        complement(898816..900039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0768"
FT                   /product="isocitrate dehydrogenase"
FT                   /EC_number="1.1.1.41"
FT                   /note="COG0538 Isocitrate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46136"
FT                   /protein_id="ACS46136.1"
FT                   /translation="MAKIKVEGKVVELDGDEMTRVIWKDIKDRLILPYLDIDLDYYDLG
FT                   IENRDATDDQVTIDAAEAIKREHVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILG
FT                   GTIFREPIVIDNIPRLVPGWTKPIVVARHAFGDQYKATDFKVPTSGTLTVTFTPNDGSG
FT                   PIEHVVFDYPGSGVAQVQYNLDESIRGFARACFNYGLLRHYPVYLSTKNTILKAYDGEF
FT                   KDIFAEVFETEYKQRYEQEGLTYEHRLIDDMVASSLKWHGGYVWACKNYDGDVQSDTVA
FT                   QGFGSLGLMTSVLMTPDGQTVEAEAAHGTVTRHYRLWQKGEKTSTNPIASIYAWTGGLK
FT                   HRAKLDGTPQVANFAETLEQTIISTVEGGQMTKDLAILIDPSHEWLDTEQFMNALDENL
FT                   QRNLAEQR"
FT   gene            900166..901287
FT                   /locus_tag="Balac_0769"
FT   CDS_pept        900166..901287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0769"
FT                   /product="inositol-5-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="COG0516 IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46137"
FT                   /protein_id="ACS46137.1"
FT                   /translation="MAQETEIGLGKKARIAYGLDDISIVPSRRTRDPQDVSTSWQVDAY
FT                   EFDIPVIGAPMDSVTSPQTAIAMGKLGTVGVLDLEGLWTRYENPEPILEKIASLDPDDA
FT                   TAYLQQAYAEPIKPELIVERLHEIRDAGVTVAGALSPQRTQQYYSTVLNAGVDLFVIRG
FT                   TSVSAEHVSKDHEPLNLKQFIYDLDVPVIVGGAANYRAALHLMRAGAAGVLVGFGGVAT
FT                   SANRQTIGVSIPMATAISDVAEARRDYMDESGGRYVQVIADGSMGESGSFVTALAMGAD
FT                   AAMLGAPLARAQEAPGHGTHWGSEARHATLPRGLRSEVGTVGTLQEILYGPSHKADGTT
FT                   NFIGALRRAMASCGYVDIKSFQRCPVVVTANRS"
FT   gene            901503..902084
FT                   /locus_tag="Balac_0770"
FT   CDS_pept        901503..902084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46138"
FT                   /protein_id="ACS46138.1"
FT                   /translation="MHTPSNPSNTKPHAGNARQPIDIPPLKEELETCPPDVDMHIERTP
FT                   LPVHSGMLSRNHSLCPVRFRIRSCVNVELLPITAYGISERAFKICCIAFEVVRGRVGVQ
FT                   ALRGMVTTTCCERLELMRDLMKSATSSRVDLHSKRFYGQPMPVLIDGTAVSPMRFEITI
FT                   EVRVGSLQYWVNMVLDLRGSAWICTYLDMG"
FT   gene            902133..904154
FT                   /locus_tag="Balac_0771"
FT   CDS_pept        902133..904154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0771"
FT                   /product="long-chain-fatty acid CoA ligase"
FT                   /note="COG1022 Long-chain acyl-CoA synthetases
FT                   (AMP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46139"
FT                   /protein_id="ACS46139.1"
FT                   /translation="MLREYGLDNKYVTTDDDTVYQLLSKRALERPDELIAQFKDPQTNQ
FT                   WVDVMAGEMLAQVRSVAKGLMAIGARPGTMVAIYSATSYEWGVMDFACASIGAVSVPIY
FT                   ETDSQKQADSIITEVQPAIAFGGDENHTHTLERIAEQVKCLRHVFNFENGALEALIDYG
FT                   ESVSEDELDAAIGRVRADDLLTIVFTSGSTGKPKGAMLSHRNFTHIVKNGYEILPEMLY
FT                   DAPNRLLLFLPLAHCFARYIQYVAIGGYGVVGYVPDAKHLLADLRGFKPTYLLGVPRVF
FT                   EKVYNAASQKAGSKMMSEHKHPGPMMRIKHSFYMSTVASSFRSALGPNLRYLACGGAPI
FT                   NPDLVHFFNGIDDITFIQGYGMTETAAPMIVNWQKANRVGSVGRPGPGMAVRTADDGEI
FT                   EVKGPNVFLGYYKNPELTDEVLEPSGWLHTGDLGYIDDDGFLYITGRKKDLIITAGGKN
FT                   VSPAPLESAISECPIVSHVVVVGDNKPFIGAVVTLDEEMTRSWLDNQGMPTNLSMDDLA
FT                   HSDGVHAFIQQYVDKANANVSRAESVRKFIVLPSDFSIEEGTLTPSQKVVRPKVLSTYS
FT                   ELIDAELYAPKNAARPVPVSMQIIESTSETVKKASQAVQHTAETVTPKVRQAFDNVQER
FT                   FEELQQHGRSDEASSAKPEHGASTTTNSDSSEQNTKEQ"
FT   gene            904160..904642
FT                   /locus_tag="Balac_0772"
FT   CDS_pept        904160..904642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0772"
FT                   /product="N-formylmethionyl-tRNA deformylase"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46140"
FT                   /protein_id="ACS46140.1"
FT                   /translation="MAIREIRVVPDPVLRTPCDPITEITPAVRNLVQDLLDTVDDPGRA
FT                   GVSANQIGVSLRAFSYNIDGKIGYVLNPVLEETRGEQYGDEGCLSLPKLWYKTKRADYA
FT                   RVRGMDLDGNEIVLEGDGIMGRMLQHETDHLDGHLYIDRLEKDERRAAMRRMRSLE"
FT   gene            904919..905830
FT                   /gene="rpsB"
FT                   /locus_tag="Balac_0773"
FT   CDS_pept        904919..905830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="Balac_0773"
FT                   /product="30S ribosomal protein S2"
FT                   /note="COG0052 Ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46141"
FT                   /protein_id="ACS46141.1"
FT                   /translation="MAQITMSEMLKAGLQFGHQTRRWNPKMKQYILTERNGIYIINLFK
FT                   TLDLIDVAYDFIKTTVAHNGTVLFVGTKKQAQEAIKNAATRVNMPYVSERWLGGMLTNF
FT                   QTVSKRVNRLKELETMDFDDVHGSGLTKKELLLLKREKDKLERQLGGIRNMTRTPSAMF
FT                   VVDINKEALAVEEAHKLGIPVVAIVDTNADPEAVEYPIPANDDAIRGIELLTNLFADAV
FT                   AEGLLERSGNASKSESNSEQPMAAWEKELLEKNEKATLRENAVVTENEVKKTDEEEGAS
FT                   SEAARADAQNEEAVAKPGEEVE"
FT   gene            905940..906797
FT                   /locus_tag="Balac_0774"
FT   CDS_pept        905940..906797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0774"
FT                   /product="elongation factor Ts"
FT                   /note="COG0264 Translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46142"
FT                   /protein_id="ACS46142.1"
FT                   /translation="MAAITAALIKQVREETGAGMMDVKKALTEADGDVARAKEIIRAKG
FT                   IQAAGKREGRKAQEGTIASTVIDSAAGQTGYAVELNSETDFVAKTPKFIDFADTVLADA
FT                   VKAGADDIDAVLAAPSQDGTVKEAVEEASALFGEHVKVGQFAKIEGPKVEIYAHKKSVE
FT                   MPPSIVAMIATDEAGAAVAHEAALQISAMGAQWLTRDDVPEDVVETERRVATEKSLAEG
FT                   KPEKIVPKIVEGRLNAFFKENVLLEQAYVKDPSKTIGDLFKEVGGQALAFARLEVGKAP
FT                   EADA"
FT   gene            906941..907687
FT                   /locus_tag="Balac_0775"
FT   CDS_pept        906941..907687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0775"
FT                   /product="uridylate kinase"
FT                   /note="COG0528 Uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46143"
FT                   /protein_id="ACS46143.1"
FT                   /translation="MALENDLAQPRRVLLKLSGEAFGNGKVGVDTATIRRIAGEIVPAV
FT                   EQGVQVAIVTGGGNFFRGAELQEAGIDRSRGDYMGMLGTVMNCLALQDFLEQAGQATRV
FT                   QTAITMGQVAEPYIPLKAIRHLEKGRVVIFGAGAGMPYFSTDTVSIQRSLEIHCDEVLM
FT                   GKNGVDGVYTADPRKDPSAQRFETLSYKRALIDNLAVMDASAMAMARDNNQTIRVFGLE
FT                   GEGNVTRALMGDSIGTLVSNGDSSLA"
FT   gene            907772..908293
FT                   /locus_tag="Balac_0776"
FT   CDS_pept        907772..908293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0776"
FT                   /product="ribosome recycling factor"
FT                   /note="COG0233 Ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46144"
FT                   /protein_id="ACS46144.1"
FT                   /translation="MKKSVESTKENFAGIRTGRANPALLNGIVVEYYGAPTPLKHVATI
FT                   GVPEPRTLSVTPFDPSQANAVEKALRDSDLGASPRRNGSAILLTMPELTEDRRKEYVKL
FT                   AKSKAEDGKVAVRNIRRKSKEAIDKAVKDGEMGEDEGDRLLKELDKVTKATTDELDALL
FT                   EAKQKEIMEV"
FT   gene            908386..909354
FT                   /locus_tag="Balac_0777"
FT   CDS_pept        908386..909354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0777"
FT                   /product="CDP-diglyceride synthetase"
FT                   /note="COG0575 CDP-diglyceride synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46145"
FT                   /protein_id="ACS46145.1"
FT                   /translation="MDSQMQRDREAKADEAINAINRKAGRNMPQAVGTAIALIAIILLC
FT                   LWASPILFVVLVVLFMIAGLWELRVDFATINLHIPLVTLWICSTVTLLAVYFYPRHVVA
FT                   MAVCVAVSLIAVAFSATLQVWHGRRVEKELDNKALTTPDAPDRRTEQHSHLTQVAVAMF
FT                   TVLYIPLLASCIVMPLTFNEHYFAHAMLIVFMPALSDTGGLFAGMLFGRHKLSPRISPK
FT                   KSVEGLCGSMLFAVAGAYAVFACTYEPALWATRWWAPLLTGVIIGIVGTYGDLCASMLK
FT                   RDMGIKDMGHMLKGHGGVLDRVDSILMCAPFICVLLWATGL"
FT   gene            909368..910564
FT                   /locus_tag="Balac_0778"
FT   CDS_pept        909368..910564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0778"
FT                   /product="hypothetical protein"
FT                   /note="COG0820 Predicted Fe-S-cluster redox enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46146"
FT                   /protein_id="ACS46146.1"
FT                   /translation="MSDFRVTDDNQVSETVETGITEGGRSGAFRDVLSKNHARRGKPPV
FT                   HFADLTDDERIAKAKELGLPKFRVRQLANHYYGHFDADAGYFTDFPAGKRDEVAREFFP
FT                   TLIREVTRQVADDGQTIKTLWELFDGSKIESVLMRYPNRTTLCISSQVGCGMGCPFCAT
FT                   GQLGLTRNMSTGEILEQVRIAAAMMERGEVAGGPGRLSNVVFMGMGEPMGNYRAIVSAV
FT                   RQISAMPPEGFGISARNITVSTVGVVPGIRRLAQEGMPVRLAVSLHAPNNALRDELVPM
FT                   NRRFNVDEVLDAAHDYYLASKRRVSIEYALMRGINDQEIHARQLANRLNHYGDNWAHVN
FT                   PIPLNPIEGSKWTASKPEDERRFLEILHNAGITATLRDTRGQDIDGACGQLAAKTNNA"
FT   gene            910684..911253
FT                   /locus_tag="Balac_0779"
FT   CDS_pept        910684..911253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0779"
FT                   /product="hypothetical protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46147"
FT                   /protein_id="ACS46147.1"
FT                   /translation="MPRPPRFTQEEVAVAAFDIVRGGGEESLTARSLAEKLGCSVKPIF
FT                   GLFDTMDEVRQAVWEQANAWYIERLDAAMSAGDRPPYLASGLAYIEFARTEPNLFTLLF
FT                   MHRRTPEQMEQSSIQLRPVIEIIARQLGVGYDEAYAFHMRMWVYVHGIASMIVTGYLDW
FT                   DEAFAEHSLSDMFHALSEYTETKQGE"
FT   gene            911354..911989
FT                   /locus_tag="Balac_0780"
FT   CDS_pept        911354..911989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0780"
FT                   /product="ABC transporter ATPase"
FT                   /note="COG1131 ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46148"
FT                   /protein_id="ACS46148.1"
FT                   /translation="MLGVNGAGKTTTISMLCGLTKPTSGNAYLLGESVLTDAKRIKPQI
FT                   NLSPQETAVAPNLSVTENLRLIAGIYGQSAQQAKASTQQALDEFGLNAVASQKAHTLSG
FT                   GMQRRLSIAMGLITNPKILFLDEPTVGLDIFARRELWNVIKGLKGRVTILLTTHYLEEV
FT                   EALADRIAIMVAGRTIAIGTVAELKKQTGENNLEDAFVKLVGGNNELA"
FT   gene            911997..912734
FT                   /locus_tag="Balac_0781"
FT   CDS_pept        911997..912734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0781"
FT                   /product="hypothetical protein"
FT                   /note="COG0842 ABC-type multidrug transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46149"
FT                   /protein_id="ACS46149.1"
FT                   /translation="MFARRTMKEIMRDPVNLFFGLAFPVLLLWALSLIYKQVGQIPGAA
FT                   TISGDELAAAISAYAPVFVSLFSGMLIAKDRTSSFLTRLFASPMTAADFTLGYSLPMLV
FT                   VALAQSLVTFLFAGLFGHPIGVRMLLGAIVVLPTALMYTAIGLLCGTLMSDKAVGGVCG
FT                   AMLTTIAFILAGVTVPIQIMGPTFQDIAKALPFYNAAQSAVAAVGGDYGRIWPHVWIVT
FT                   AYAVGFWLAAVIVFGLRKRNVNR"
FT   gene            912876..913646
FT                   /locus_tag="Balac_0782"
FT   CDS_pept        912876..913646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0782"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /note="COG0107 Imidazoleglycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46150"
FT                   /protein_id="ACS46150.1"
FT                   /translation="MSLAVRVIPCLDVDDGRVVKGVHFENLRDAGDPVELAAEYYRQGA
FT                   DELTFLDVTASSSHRQTMVNVVTRTAEQIFIPLTVGGGVRTPEDVDSLLRCGADKVSVN
FT                   TAAINDPTLISRVAERFGNQVLVLSVDARRERGEQHTQSGFEVTTMGGRKSTGIDALWW
FT                   ARRAEELGAGEVLLNSMDADGTQQGFDLEMIRAMREVVSIPIIASGGAGKAQDFPPAIA
FT                   AGADAVLAASIFHYGKVTIGEVKDELRRAGYAVR"
FT   gene            913718..914131
FT                   /gene="hisI"
FT                   /locus_tag="Balac_0783"
FT   CDS_pept        913718..914131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="Balac_0783"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="COG0139 Phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46151"
FT                   /protein_id="ACS46151.1"
FT                   /translation="MSYESEIVYDNTKTLDPRIKDRLKYDDKGLVCAVIQQYDTHEVLM
FT                   VGYMDDEALRRTLTTGRVTFWSRSRQEYWCKGDTSGHVQYVKGLSLDCDGDAILVEVDQ
FT                   VGAACHTGKRSCFDEGGPLPVVMGEREPREETE"
FT   gene            914128..915693
FT                   /locus_tag="Balac_0784"
FT   CDS_pept        914128..915693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0784"
FT                   /product="Anthranilate/para-aminobenzoate synthases
FT                   component I"
FT                   /note="COG0147 Anthranilate/para-aminobenzoate synthases
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46152"
FT                   /protein_id="ACS46152.1"
FT                   /translation="MSMQDSSSVKNLGWGETWPSRERFHELAGEGYRIIPIVRRILADS
FT                   LTPVGLYERLAGHRSGTFILESAETNGTWSQYSFIGVNSMAQLRSNQGEADWLGKVPVG
FT                   VPLTGDVIDVARATLDVLRSPKVEGLPNLTSGLVGNVGWDAIRHWEPTLPANAPDETEQ
FT                   PELTLALATDIAVVDHKTGSVWLIANAVNVDDKPTRADAAYNEAVARVGQMEIQAATPA
FT                   QDEFRVNVVDTSIPQPQLRFRTAKEDFIAMVERSRRHIIDGDVFQVVGSQRLDIDSPAD
FT                   PFDVYRVLRTLNPSPYMYFMTLTDAKGRVFNVIGSSPETLIKVDNGLAMSFPIAGSRPR
FT                   GKTPEEDERLHDELLADPKERSEHIMLVDLARNDLSRVCEPDSVEVVSLMDVLRYSHIM
FT                   HICSTVTGRVLPGLSVMDVFTSAFPAGTLSGAPKPKAIELIDQMEPADRGIYGGTVGYF
FT                   DFSGNMDMAIAIRTAFIRDHKASVQAGAGLVLDSIPENEWMETRNKASASVEAIKIAAQ
FT                   LKQV"
FT   gene            complement(915773..916363)
FT                   /locus_tag="Balac_0785"
FT   CDS_pept        complement(915773..916363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0785"
FT                   /product="Uracil-DNA glycosylase, putative"
FT                   /note="COG1573 Uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46153"
FT                   /protein_id="ACS46153.1"
FT                   /translation="MDTIESITKQIMDDPRDAEFTKRGEKPVFSAPSTALITIVGQSPS
FT                   LDAQTRGLCWNDRSGDTLRKWLDVDKETFYDSGKFALVPMDFYYLGDVPGDKGMEEPRE
FT                   WVAPTYHPEIMKLLPDVKLTILAGSNAVKYYLNQWSKARLEDTVKHFQEYLPKYFPIVH
FT                   PSGRTDIWRTEHPWFDETVVPALREHVHAILGK"
FT   gene            complement(916543..916692)
FT                   /locus_tag="Balac_0786"
FT   CDS_pept        complement(916543..916692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0786"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46154"
FT                   /protein_id="ACS46154.1"
FT                   /translation="MSDMAQKIGELKGKAEVKADEVKMKAGELKGKAEAKLDELKKDHE
FT                   DQSK"
FT   gene            complement(916899..917204)
FT                   /locus_tag="Balac_0787"
FT   CDS_pept        complement(916899..917204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46155"
FT                   /protein_id="ACS46155.1"
FT                   /translation="MADIKEHFEEFKDRMEEKHEEHKAERDEKRAERAEDHAAKVIAKE
FT                   DEKIVKAADDPDAKLEKITDKADDKKDKAEGKAAAKEAKATEDQVELNERFGTQLG"
FT   gene            917455..919539
FT                   /locus_tag="Balac_0788"
FT   CDS_pept        917455..919539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0788"
FT                   /product="bifunctional indole-3-glycerol phosphate
FT                   synthase/tryptophan synthase subunit beta"
FT                   /note="COG0134 Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46156"
FT                   /protein_id="ACS46156.1"
FT                   /translation="MSVLDELVAGALEDKCDRERVTSLEELKARAASAPAPLDAKRWLR
FT                   RHDGIPVIAEIKRASPSKGHLIDIEDPAALGRQYEQGGASAISVLTEGRRFLGSLDDVD
FT                   AVRAAVHIPVLRKDFITTDYQIWEARAHGADIVLLIVAALDDTQLAHLLKLTHELGMTA
FT                   LVETHTREEIERAIAAGARVIGINARNLKDLRVDVGKYTELASNLPEDVIKVAESGVFG
FT                   AVEVEDYARAGADAVLVGEGVATADDPRLAVERLVKAGERVKASETTPLSEHHGPYWGQ
FT                   FGGRYVPEALITALDELQRVYDDAKDDPEFHKELATLNKRYVGRPSPLTEAPRFAERIK
FT                   ERTGLDARVFLKREDLNHTGAHKINNAIGQALLVKRMGKTRVIAETGAGQHGVATATVC
FT                   AMLGLKCRIYMGQIDARRQALNVARMRMLGAEVVEVTLGDRILKDAINEALRDWVTNVK
FT                   DTHYLLGTVAGPHPFPEMVRDFQKIIGEEAKEQLAQWYGIDHPDAICACVGGGSNAIGI
FT                   MNAFLDDPRVNLYGFEAGGHGPDSGQHAIRFAPGTGELGMFQGAKSYLLGNSEGQTLDT
FT                   YSISAGLDYASVGPEHAWLKEIGRVNYSWATDEEAMNAFKDLCETEGIIPAIESSHAVA
FT                   GAYKAARDLKEKGYEHPVMIVNISGRGDKDMNTAGKWFGYLTDEQAAALEANGATGNNA
FT                   "
FT   gene            919565..920434
FT                   /gene="trpA"
FT                   /locus_tag="Balac_0789"
FT   CDS_pept        919565..920434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="Balac_0789"
FT                   /product="tryptophan synthase subunit alpha"
FT                   /EC_number="4.2.1.20"
FT                   /note="COG0159 Tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46157"
FT                   /protein_id="ACS46157.1"
FT                   /translation="MTEYNTTPSGQPLGISHRPSPCRELFTRFKAQDKPAFIGYLPFGF
FT                   PTMEQSLEAFATMVENGADIVEIGLPYSDPVMDGPVIQAASQIALNNGERIADVFKAVE
FT                   TVANAGGVPLIMSYWNLIYHYGVERFAADFANAGGAGLITPDLIPDEAGEWIEASDRHG
FT                   LDRIFLVSPDSTDERLRVVCENARGFVYAASRMGVTGERSSLGTSPEDLVARTRKAGAE
FT                   NVCVGIGVSTAAQGKAVGQYADGVIVGSALVHTLLTEDGDARELTSGLAALAAKTAELA
FT                   EGIHNARL"
FT   gene            920531..921469
FT                   /locus_tag="Balac_0790"
FT   CDS_pept        920531..921469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0790"
FT                   /product="prolipo protein diacylglyceryl transferase"
FT                   /note="COG0682 Prolipo protein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46158"
FT                   /protein_id="ACS46158.1"
FT                   /translation="MTTLAYIPSPSISQFHVGSLTIHIYALTMLLGIIAAVWITGERWK
FT                   RLGGTFDQIFDTTLVAVPCGIVGARLYHIITTPERFFGPNGDWVEMFRIWNGGLGIWGA
FT                   ILCGALGAWAWCRHKHYPMALLADSIAPALLVAQAIGRLGNWFNQELYGKPTTLPWGLK
FT                   LNMNGSAIGNSETCYDGASCPTGTLFHPTFLYEMIWNLIGAALIIWIGHRLANRLKAGS
FT                   LFALYVMWYTLGRTWIEMLRIDFSHEILGLRVNVWVSIIVFMLGAVAFIVIQRVGSPTQ
FT                   LLSDKLHAQTELEARREQSPQDAGGSGRNAG"
FT   gene            921524..922189
FT                   /locus_tag="Balac_0791"
FT   CDS_pept        921524..922189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0791"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /note="COG0036 Pentose-5-phosphate-3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46159"
FT                   /protein_id="ACS46159.1"
FT                   /translation="MDIKIAPSILSADFCNLERDLERISNADMVHVDVMDHHFVPNLTI
FT                   GEPVVKRICEVTDLPVDVHLMIDDPDRWAPGYAERGAHSVTFHMGATHAPVRLARQLHD
FT                   MGCEAWFAVRPAEPVEPIFDILEEFDTILIMTVEPGFGGQKFLANQMGKVRRLRDEITR
FT                   RGLDTNIQVDGGVSPKTAATVAQAGANILVAGSAVYGAADPAKAINEIRDTAAAAYRD"
FT   gene            922286..922549
FT                   /gene="hisE"
FT                   /locus_tag="Balac_0792"
FT   CDS_pept        922286..922549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="Balac_0792"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /note="COG0140 Phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46160"
FT                   /protein_id="ACS46160.1"
FT                   /translation="MKTFESLFAELSEKAANQTPGSLTVDELGKGTHFIGKKIIEEAGE
FT                   TWIAAEYEGAERTAEEMSQLIYHLQVMMIDRGITLDDIYKNL"
FT   gene            922613..923464
FT                   /gene="hisG"
FT                   /locus_tag="Balac_0793"
FT   CDS_pept        922613..923464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="Balac_0793"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="COG0040 ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46161"
FT                   /protein_id="ACS46161.1"
FT                   /translation="MLRIAVPNKGMLSEPAWAMLSEAGYTLRSNPRQLVVEDPDNDVEL
FT                   FYLRPLDIAVYVGMGTIDVGITGHDLLLNSGTDAQEEMNLGFGGSTFRFAAPQDSPITT
FT                   LDDVEGKRVGTSFDKLVHDYLTEHGINATPIHLDGAVESSVQLGVADLIADVVSTGTTL
FT                   RNAGLRIFGEPILHSEAVLIRSPRLDPQDERLERLERRLHGVLTAKRYVLMDFDIPVEK
FT                   ISAAVQITPGFESPTISPLHDKQWAAVRVMVPKAKVNQLMDQLYEVGARGIIVTAIQAT
FT                   RM"
FT   gene            923485..924111
FT                   /locus_tag="Balac_0794"
FT   CDS_pept        923485..924111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0794"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate3-phosphatidyl-transferase"
FT                   /note="COG0558 Phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46162"
FT                   /protein_id="ACS46162.1"
FT                   /translation="MDLKEKFSRKKYSPEPRDVVFTIPNIISLLRIISIPIIAWLITEH
FT                   SMVWALVVLALSFASDGLDGLIARKFNQVSKIGQLLDPIADRLLILCSILALGICHVVP
FT                   WWMLILVALRDVTMAVLTVVLAQHNYGPLPVHFVGKTGTAVLMISIVGLMVADIERQMP
FT                   VFEMLHYAAISCAIWGIGLYWMAGILYMRQGIGLLQADGRQKAVR"
FT   gene            924271..925113
FT                   /locus_tag="Balac_0795"
FT   CDS_pept        924271..925113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0795"
FT                   /product="hypothetical protein"
FT                   /note="COG3879 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46163"
FT                   /protein_id="ACS46163.1"
FT                   /translation="MPPRRRGKHYDASLRLIDDLVNRPMDALYNDSRLVTKPDSKLTFW
FT                   GTRIIVLIICVAVGFAGCLFVRLLNTDPRKQVRQQLASQLEAQNTHIDELEKQIADMRA
FT                   DVDRQSQSALPSQVEQEVRRNEAAAGATAVEGEGIVLTVADPMVTNSNAQEGSLPREKS
FT                   TNRLRVVTDTDLQLLVSLMWKAGAEAISINDNRLGVQTSIRTAGNSILIGTTPVSSPYR
FT                   IQAIGNKNELANRMGQKELSTLYQEFKDAGMTLQTSKENMIRLKAATPGQVSNAKEIR"
FT   gene            925113..925445
FT                   /locus_tag="Balac_0796"
FT   CDS_pept        925113..925445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0796"
FT                   /product="hypothetical protein"
FT                   /note="COG3856 Uncharacterized conserved protein (small
FT                   basic protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46164"
FT                   /protein_id="ACS46164.1"
FT                   /translation="MAAVLGLIIGVVVGLFVKPDIPIWLQPYLPIMVVAALDALLGAAR
FT                   AYFERSFSDKVFVISFFSNVVTATLLVLLGNQLGVGSQLSTAVIVVLGIRIFSNVSAIR
FT                   RFIFQG"
FT   gene            925448..926326
FT                   /locus_tag="Balac_0797"
FT   CDS_pept        925448..926326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0797"
FT                   /product="hypothetical protein"
FT                   /note="COG3879 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46165"
FT                   /protein_id="ACS46165.1"
FT                   /translation="MGEANGHENKPIQSAGTPPEPPSGIHVKKILSQQKKDRQNDKLPT
FT                   GAFPAVRKAKPKKQISGRAQSIRARLLASVLVAALCALLSFGYVIQVNNTDMTYETMTE
FT                   SELTRMLGETNTQVQRLEERRTELSRQLTSLQQAADKEAEANRIAKENEESSGILSGRL
FT                   PAEGPGIIVHISAGTKAPIDAATMFNLIEELRNGGAEVIAINDVRVVTSTYISEGANGL
FT                   ICDGKALNAPYIVKAIGEQNNLANAVNMAGGVGSRLTVKFGASVNVETSDDVKITQTQP
FT                   VTNYKYAKIVE"
FT   gene            926333..926773
FT                   /locus_tag="Balac_0798"
FT   CDS_pept        926333..926773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0798"
FT                   /product="hypothetical protein"
FT                   /note="COG1716 FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46166"
FT                   /protein_id="ACS46166.1"
FT                   /translation="MTDPIPSAGETTIIGMPAIQIPVTTSGERPLTQEDLQTISRLADD
FT                   TALLIATRGALSGSRYLLDEDEVTVGRDPRADILLDDSTVSRQHAVFRRENGAYTVIDA
FT                   GSLNGTYVNRQRVDKATLKNGDEIMIGKFRLIYFTNSAVRNI"
FT   gene            926796..927527
FT                   /locus_tag="Balac_0799"
FT   CDS_pept        926796..927527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0799"
FT                   /product="SoxR-type transcriptional regulator"
FT                   /note="COG0789 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46167"
FT                   /protein_id="ACS46167.1"
FT                   /translation="MESNRETQAQREGRNDGLPLFVDVPLLDVDDSMVQGELFPDSLLE
FT                   TEQVRMGYRGSAASRAAGITYRQLDYWAHKHIVEPSVTASHGSGSRRLYSFNDVLMLAA
FT                   CKKLLDLGVNLQNISQTLQFLRAYRSTQLSHMVIVCDGEHVRACEGETMFADVLQHESA
FT                   VFIIAVGALFRQVESSLAAAESVAVTSDVALRHLSVDSDGPLARLPIVAKGTRLHHRDA
FT                   HVEPPYRDVPLDIDGHSYAVA"
FT   gene            927612..927965
FT                   /locus_tag="Balac_0800"
FT   CDS_pept        927612..927965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46168"
FT                   /protein_id="ACS46168.1"
FT                   /translation="MVCAVTVHCSHFGRADVVVKPVSWAVIIGQLTTFVLFAMPYFLFL
FT                   ANKDSIGTHPRSLYERLGWPSAVVAVVLVFAELALMYVQARRAMRFEPAHVEPLPDDGD
FT                   ADGDETHEGMSII"
FT   gene            927962..928339
FT                   /locus_tag="Balac_0801"
FT   CDS_pept        927962..928339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0801"
FT                   /product="CrcB protein"
FT                   /note="COG0239 Integral membrane protein possibly involved
FT                   in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46169"
FT                   /protein_id="ACS46169.1"
FT                   /translation="MIWPNLSAVAVGAFAGGCLRSLASGWLNRKDYAIPCGTLLVNLAG
FT                   SLLVGIMLGVVAMGSVAEPWKALLITGFCGGLTTFSTFTSEVVSLFEEHSTVRAWIYWI
FT                   GSVVAGICCVAFGFLVTRAFA"
FT   gene            928351..928728
FT                   /locus_tag="Balac_0802"
FT   CDS_pept        928351..928728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0802"
FT                   /product="hypothetical protein"
FT                   /note="COG0239 Integral membrane protein possibly involved
FT                   in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46170"
FT                   /protein_id="ACS46170.1"
FT                   /translation="MELIAVGFGCALGAVCRYLLENGFNNWTMDPISILVINCVGCFLM
FT                   GLFTAIIERREPSKAMAKFMTTGFCGGLTTFSTFSADTYKLLQTNAWQAIALVLASLFL
FT                   GMLLYALGHRLPRRNAHADVV"
FT   gene            complement(929281..930000)
FT                   /locus_tag="Balac_0803"
FT   CDS_pept        complement(929281..930000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0803"
FT                   /product="hydrolase or phosphatase"
FT                   /note="COG0546 Predicted phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46171"
FT                   /protein_id="ACS46171.1"
FT                   /translation="MTEPRRVVLLDLDGTLTESGPGIIKCVIKAFEAVDVPVPNDEALQ
FT                   RFIGPAIIDSMKLNGIPPQKLDEAVRVYRHFYGDANVFNDPNEPGRKVPGRLVNSMYEG
FT                   IPEQLRKMREMGYYLAVCTAKPEYQAIPICEHFHLTDLVDGIYGASKDNSRITKEAVIT
FT                   YALDRIGVDRNAGDRALMVGDRWTDVDGAKLNGLDCLGCGWGYAEPNELREHGAYRVVP
FT                   FVSELADAVNDYFTERQ"
FT   gene            complement(930088..930435)
FT                   /locus_tag="Balac_0804"
FT   CDS_pept        complement(930088..930435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0804"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46172"
FT                   /protein_id="ACS46172.1"
FT                   /translation="MAERSLRGMSIGAKSLESDDNVDFAARVEVAYVCPKGHRTILPFA
FT                   ESADLPNEWECRCGATAHRENEEDEQPDEITKPTRTHWDMLMERRSEDELAALLEKRLK
FT                   MHHDGWIPDYE"
FT   gene            complement(930540..933029)
FT                   /locus_tag="Balac_0805"
FT   CDS_pept        complement(930540..933029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0805"
FT                   /product="helicase"
FT                   /note="COG4581 Superfamily II RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46173"
FT                   /protein_id="ACS46173.1"
FT                   /translation="MQSVAARFADRMPFELDAFQQDANEALEAGSNVLVAAPTGAGKTV
FT                   VADFAIYLAQQRNVKAFYTTPIKALSNQKYHDLVDMYGADKVGLLTGDTSINSEADIVV
FT                   MTTEVLRNMLYEHSTTLNALGYVILDEVHYLADRFRGPIWEEVIIHLPQSVRIIGLSAT
FT                   VSNVEDFADWIESVRGDTKLVVSEHRPVPLDQYVLLQKDPRTEPELFDLYCRDDMGEQT
FT                   VKMNARLMNRLDELDRMEARRARADTHGRSERRQDRGGKRKFVRKPERYQPRRWAVVDE
FT                   LNFLGMLPAIYFVFSRNGCDEAVEQCLNAGLRLTTDEEALHIRKIVDEMIEGQLTREDL
FT                   KTLHFSQFRYALEEGFAAHHAGMIALFKQIVERLFEEGLIKCVFATETLALGINMPARS
FT                   VVVEKLEKYNGTGIVPLTPGEYTQLTGRAGRRGIDTIGNAIVVDHRDFKPETAVALSSK
FT                   RVYPLHSSFKATFNMAVNLLNSSDYETARDTLDHSFAQWEANESAWDLEARIDKLRKAI
FT                   AGYEEAMGNDAGDMVELLRIRMKLSDLQKNERRRLKHEVFKSNEERSRAFRRLDAQIAQ
FT                   LKEQEANHPAKRSADFKTLMKWGHRWVRETKELERLEYRYESRTSSVARQFDRICHSLE
FT                   VLGYLETADENGHIDYRLTEYGQLLRRLYTERDLVLAQAITHGIFDDLNAPELAAVMSS
FT                   LLYEPRRGEGGEPRRYPGGPRGRVMQAANALRDMDGQIIALCEANGLENYLQPLDFGIV
FT                   DLMYNWAYGDSLSEVLEHSDMTGGDFVRTAKRIADVLQQIAVAEPYLGEGGAELAALAH
FT                   EAYERVNRGIVAYSGVD"
FT   gene            complement(933146..933463)
FT                   /locus_tag="Balac_0806"
FT   CDS_pept        complement(933146..933463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46174"
FT                   /protein_id="ACS46174.1"
FT                   /translation="MPWWIWLILALAMLAVLIAGIIYVIIHGLHALQSVQRTGEAVSER
FT                   IALMSDTEGTRHPKERPIFTEPLEVAANRYTQAHTKVDKRKRARRERYARIWSRWASFN
FT                   D"
FT   gene            complement(933553..935490)
FT                   /locus_tag="Balac_0807"
FT   CDS_pept        complement(933553..935490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0807"
FT                   /product="hypothetical protein"
FT                   /note="COG2378 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46175"
FT                   /protein_id="ACS46175.1"
FT                   /translation="MAEGSNGRRRFSDKWGKHELDVLAVLSSAFPQWLTSRQIAQRVKA
FT                   YADSYGELADQAAKAAFAKQFQRDRAKLAAMGIAIESRQPEYSSKSEGQDFASYRLQLG
FT                   DEPRIRLKFQPEDMPVLAAANYLARSMSMSSAPQPQPQHVSRTAPRVPQTPIPGLGLDS
FT                   IAPGLGTQHIPENLVKEVDSRRFAATLSVNGESLNVAYTDTDDLVMFVLEHPNTSIVNP
FT                   PEAVDAFRRRLNAAIGFQLADDSANMSSAKVAAHAIDAGDEAEDEDGANGKGHKKSSFQ
FT                   TGSEVDRRLRLMLFLSAHMGEEYSLSELAVRFIGVPKNDDERKKFVQTIHKDINTLTTV
FT                   SDDGEMAGSQFFDIDWSLLEAEGIVCATNSLGLERLAGISPQYMSMLTASVNYLAHAPL
FT                   LPAEERSQAVDLYDRLRQYVEPGQTPWLSLTGYEVEPRSFGIVKKAIAEHALLDMKYTD
FT                   GSGRIRERLVAPSKIYVDEGVYYVALWTDVEDVAPAALHKIVHKDMTINKETGEPRIWQ
FT                   ILRIARIEEVQEVEPTKPMQIPDVSVSDLRKWSIETSTSAAFITDQPHLEFIRTLGDAE
FT                   VEPCGEGEKVRLQIQSDSWFVAFCIAHARHILAVAPETLRTMIIARAKRELSMLDENGE
FT                   ADSAEEHHAR"
FT   gene            complement(935627..937054)
FT                   /locus_tag="Balac_0808"
FT   CDS_pept        complement(935627..937054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0808"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="COG4284 UDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46176"
FT                   /protein_id="ACS46176.1"
FT                   /translation="MTDAFERTAEKMKAHGLSETAIAQFEHLYDVWQHEDGTTWIREED
FT                   IEPVQDIPNFAQIYETINHDKAVDAFAKTAFLKLNGGLGTSMGLDCAKSLLPVRRHKAK
FT                   QMRFIDIILGQVETARNRLGVELPLTFMNSFRTSADTMKVLNRDKRFHQDDIPMEIIQH
FT                   VEPKIDLSTGEPVSFPSNPDLEWCPPGHGDLYSTLWESGLLDILESHGFKYLFISNSDN
FT                   LGARPSRTLAQHFENTDAPFMIEVSKRTEADRKGGHIVRDKVTGRLMLREMTQVAPEDA
FT                   AEAKNIDKHPYFNTNNIWVRIDSLREKLAQSNGVLPLPVIRNYKTVDPTDASTTEVIQL
FT                   ETAMGAAVSLFNGAICVEVDRMRFLPVKTTDDLFIMRSDRFHLTDQYEMEDGNYIFPNV
FT                   QLDTRFYKNIHDFDDRFPYGVPSLAAAASVTVEGDWTFGRDVNFYGEATLHDEGRPSYV
FT                   PNGEFVGPQGIEPDEWL"
FT   gene            complement(937317..937390)
FT                   /locus_tag="Balac_0809"
FT   tRNA            complement(937317..937390)
FT                   /locus_tag="Balac_0809"
FT                   /product="tRNA-Pro"
FT   gene            complement(937473..939605)
FT                   /locus_tag="Balac_0810"
FT   CDS_pept        complement(937473..939605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0810"
FT                   /product="bifunctional cytidylate kinase/GTP-binding
FT                   protein"
FT                   /note="COG0283 Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46177"
FT                   /protein_id="ACS46177.1"
FT                   /translation="MIRVAIDGPAGVGKSSSSKALADYFGFAYLDTGAMYRACTWWCLE
FT                   RGVDLDADHVDEQQVTEIVAAFFTDGHFDISVDPQHPGVFADDVDISEQIRSQEVSSHV
FT                   SRLAAIMPVRNVLIAAQRAYIAAQSADDSFSHGRGVVAEGRDITDVVEPGAEVRILLTA
FT                   REEVRQARRNRQEQTGGVGSDDVAKRDAADSKVTHFTEASDGVTTIDNSDIDFGETLDL
FT                   MIGLVDDAIEEQAYRQYAANLDDYELDEGDEGLLDGSAFSADGESDRRKAVGVIAVVGR
FT                   PNVGKSTLVNRILGRRAAVVEDTPGVTRDRVSYDAEWAGTDFKLVDTGGWEADVEGIDS
FT                   AIASQAQIAVELADSVIFVVDALTGLTQTDERIVKLLRQAGKPVTVAVNKIDDQISEYM
FT                   AAEFWKLGLGEPYPISAMHGRGVGDLLDEAVAQMKSAEKTSGFLTPSHLRRVALVGRPN
FT                   VGKSSLLNQLSHSERSVVNELAGTTRDPVDEIVTIDGEDYLFIDTAGIKRRQHKLSGAE
FT                   YYSSLRTQAAIERSELALVLFDASIPISDQDLKVMSTAVDAGRAVVLVFNKWDLMDEFD
FT                   RQRMERLWKTEFDRVTWAQRVNLSAKTGWHTNRLAKAMTQALESWDKRIPTGKLNAFLG
FT                   KIQASHPHPVRGGKQPRILFATQASSRPPRFVIFATGFLEHGYRRFLERSLREEFGFEG
FT                   SPIQISVNIREKKRRK"
FT   gene            complement(939602..940