(data stored in ACNUC8465 zone)

EMBL: CP001579

ID   CP001579; SV 1; circular; genomic DNA; STD; PRO; 1220319 BP.
XX
AC   CP001579;
XX
PR   Project:PRJNA32233;
XX
DT   19-AUG-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Brucella microti CCM 4915 chromosome 2, complete sequence.
XX
KW   .
XX
OS   Brucella microti CCM 4915
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Brucellaceae;
OC   Brucella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1220319
RX   DOI; 10.1186/1471-2164-10-352.
RX   PUBMED; 19653890.
RA   Audic S., Lescot M., Claverie J.M., Scholz H.C.;
RT   "Brucella microti: the genome sequence of an emerging pathogen";
RL   BMC Genomics 10:352-352(2009).
XX
RN   [2]
RP   1-1220319
RA   Audic S., Lescot M., Claverie J.-M., Scholz H.C.;
RT   ;
RL   Submitted (30-MAR-2009) to the INSDC.
RL   Information Genomique et Structurale, CNRS UPR2589, Institut de
RL   Microbiologie de la Mediterranee, IM2, IFR88, Parc Scientifique de Luminy -
RL   163 Avenue de Luminy - Case 934 - FR-13288, Marseille cedex 09, France
XX
DR   MD5; e71b1b71928ff9ade8f1c3f4c0edd58c.
DR   BioSample; SAMN02603148.
DR   EnsemblGenomes-Gn; BMI_II1011.
DR   EnsemblGenomes-Gn; BMI_II1047.
DR   EnsemblGenomes-Gn; BMI_II1072.
DR   EnsemblGenomes-Gn; BMI_II1118.
DR   EnsemblGenomes-Gn; BMI_II1119.
DR   EnsemblGenomes-Gn; BMI_II1120.
DR   EnsemblGenomes-Gn; BMI_II1121.
DR   EnsemblGenomes-Gn; BMI_II1122.
DR   EnsemblGenomes-Gn; BMI_II1123.
DR   EnsemblGenomes-Gn; BMI_II319.
DR   EnsemblGenomes-Gn; BMI_II43.
DR   EnsemblGenomes-Gn; BMI_II554.
DR   EnsemblGenomes-Gn; BMI_II581.
DR   EnsemblGenomes-Gn; BMI_II614.
DR   EnsemblGenomes-Gn; BMI_II623.
DR   EnsemblGenomes-Gn; BMI_II824.
DR   EnsemblGenomes-Gn; BMI_II890.
DR   EnsemblGenomes-Gn; EBG00001034831.
DR   EnsemblGenomes-Gn; EBG00001034832.
DR   EnsemblGenomes-Gn; EBG00001034833.
DR   EnsemblGenomes-Gn; EBG00001034834.
DR   EnsemblGenomes-Gn; EBG00001034835.
DR   EnsemblGenomes-Gn; EBG00001034836.
DR   EnsemblGenomes-Gn; EBG00001034837.
DR   EnsemblGenomes-Gn; EBG00001034838.
DR   EnsemblGenomes-Gn; EBG00001034839.
DR   EnsemblGenomes-Gn; EBG00001034840.
DR   EnsemblGenomes-Gn; EBG00001034841.
DR   EnsemblGenomes-Gn; EBG00001034842.
DR   EnsemblGenomes-Gn; EBG00001034843.
DR   EnsemblGenomes-Gn; EBG00001034844.
DR   EnsemblGenomes-Gn; EBG00001034845.
DR   EnsemblGenomes-Gn; EBG00001034846.
DR   EnsemblGenomes-Gn; EBG00001034847.
DR   EnsemblGenomes-Gn; EBG00001034848.
DR   EnsemblGenomes-Gn; EBG00001034849.
DR   EnsemblGenomes-Gn; EBG00001034850.
DR   EnsemblGenomes-Gn; EBG00001034851.
DR   EnsemblGenomes-Tr; BMI_II1011-1.
DR   EnsemblGenomes-Tr; BMI_II1047-1.
DR   EnsemblGenomes-Tr; BMI_II1072-1.
DR   EnsemblGenomes-Tr; BMI_II1118-1.
DR   EnsemblGenomes-Tr; BMI_II1119-1.
DR   EnsemblGenomes-Tr; BMI_II1120-1.
DR   EnsemblGenomes-Tr; BMI_II1121-1.
DR   EnsemblGenomes-Tr; BMI_II1122-1.
DR   EnsemblGenomes-Tr; BMI_II1123-1.
DR   EnsemblGenomes-Tr; BMI_II319-1.
DR   EnsemblGenomes-Tr; BMI_II43-1.
DR   EnsemblGenomes-Tr; BMI_II554-1.
DR   EnsemblGenomes-Tr; BMI_II581-1.
DR   EnsemblGenomes-Tr; BMI_II614-1.
DR   EnsemblGenomes-Tr; BMI_II623-1.
DR   EnsemblGenomes-Tr; BMI_II824-1.
DR   EnsemblGenomes-Tr; BMI_II890-1.
DR   EnsemblGenomes-Tr; EBT00001637891.
DR   EnsemblGenomes-Tr; EBT00001637892.
DR   EnsemblGenomes-Tr; EBT00001637893.
DR   EnsemblGenomes-Tr; EBT00001637894.
DR   EnsemblGenomes-Tr; EBT00001637895.
DR   EnsemblGenomes-Tr; EBT00001637896.
DR   EnsemblGenomes-Tr; EBT00001637897.
DR   EnsemblGenomes-Tr; EBT00001637898.
DR   EnsemblGenomes-Tr; EBT00001637899.
DR   EnsemblGenomes-Tr; EBT00001637900.
DR   EnsemblGenomes-Tr; EBT00001637901.
DR   EnsemblGenomes-Tr; EBT00001637902.
DR   EnsemblGenomes-Tr; EBT00001637903.
DR   EnsemblGenomes-Tr; EBT00001637904.
DR   EnsemblGenomes-Tr; EBT00001637905.
DR   EnsemblGenomes-Tr; EBT00001637906.
DR   EnsemblGenomes-Tr; EBT00001637907.
DR   EnsemblGenomes-Tr; EBT00001637908.
DR   EnsemblGenomes-Tr; EBT00001637909.
DR   EnsemblGenomes-Tr; EBT00001637910.
DR   EnsemblGenomes-Tr; EBT00001637911.
DR   EuropePMC; PMC2743711; 19653890.
DR   EuropePMC; PMC4338773; 25737810.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00489; ctRNA_p42d.
DR   RFAM; RF00490; S-element.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00518; speF.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001579.
DR   SILVA-SSU; CP001579.
DR   StrainInfo; 389142; 1.
XX
CC   Strains and DNA are available under accession number BCCN 07-01 in
CC   the Brucella Culture Collection (http://www.tours.inra.fr/cirm_bp),
CC   INRA,  Nouzilly, F-37380,  France and under accession number CCM
CC   4915 in Czech Collection of Microorganisms
CC   (http://sci.muni.cz/ccm/), Masaryk University, Faculty of Science,
CC   Tvrdeho 14, 602 00 Brno, Czech Republic.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1220319
FT                   /organism="Brucella microti CCM 4915"
FT                   /chromosome="2"
FT                   /strain="CCM 4915"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Brucella microti"
FT                   /db_xref="taxon:568815"
FT   gene            155..1348
FT                   /gene="repC"
FT                   /locus_tag="BMI_II1"
FT   CDS_pept        155..1348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repC"
FT                   /locus_tag="BMI_II1"
FT                   /product="replication initiation protein RepC"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II1"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49143"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGK5"
FT                   /protein_id="ACU49143.1"
FT                   /translation="MEIQLASTPFGSRRMSFALLAAQKKARQIPQGAAADKWQLHRWLC
FT                   EAKTILGINDRSLAVLSALLSFYPEVTLTGEGNLVVFPSNKQLALRAHGMADATLRRHL
FT                   AALVEAGLIARQDSPNGKRYARRAKGGELQIAFGFSLAPLLARAPEFEAAAEEIKTAKA
FT                   QLREMREQLTLLRRDIAKLIEFALIEGLEGPWAHLNQRFRDIVEAIPRRADVQELAMLV
FT                   EQMREIRENVDKLLKTNKKAENLSGNESQNERQLNESKPDSHFDETALSHEDQRVFENS
FT                   QVQKEPSISLDMVLRACPEIETYASGSIRIWQDLIETAGKVRIFLGIDNKLYDMATKTL
FT                   GIHNAAITIAYILQRYDHIRSAGGYLRILSEKAASGAFSIKPLMMSAMCNRKQPARC"
FT   gene            complement(1413..1562)
FT                   /locus_tag="BMI_II2"
FT   CDS_pept        complement(1413..1562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II2"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II2"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49144"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGK6"
FT                   /protein_id="ACU49144.1"
FT                   /translation="MPTHGPVCGLIFFSQSSWMLLCSDKWNFHAGARHFKGFPAIYYGF
FT                   HFVD"
FT   gene            1551..1814
FT                   /locus_tag="BMI_II3"
FT   CDS_pept        1551..1814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II3"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II3"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49145"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGK7"
FT                   /protein_id="ACU49145.1"
FT                   /translation="MRRQIACAKSLFHFEPAACMQPALESAAAKTAARLWNVAGLQLKF
FT                   LCSGRGEQAQEKQDATPDGEHPEYLIGQVVNHVCDPKIDESA"
FT   gene            1963..2076
FT                   /locus_tag="BMI_II4"
FT   CDS_pept        1963..2076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II4"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II4"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49146"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGK8"
FT                   /protein_id="ACU49146.1"
FT                   /translation="MRAGLLWQGFLSGFSWVVYENGLAWKFFPFAAMVRQY"
FT   gene            2092..3033
FT                   /locus_tag="BMI_II5"
FT   CDS_pept        2092..3033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II5"
FT                   /product="ribokinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II5"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49147"
FT                   /db_xref="GOA:C7LGK9"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGK9"
FT                   /protein_id="ACU49147.1"
FT                   /translation="MSHGEAPLKIFVFGSVNVDVSARMAALPRPGQTVNASGYGIGLGG
FT                   KGANQAVAVAKLGGAIRFVGAVGHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAIIQ
FT                   VEETGQNTIAVCAGANARWSSADIDAYGADIAKARITLLQREVPHEANLAVAKAVRAAG
FT                   GTVLLDPAPVGDASQMADLIALSDIISPNETEAAEITGIEPTDLASAEAAGRKLLERGP
FT                   KIVILKLGSRGALLVTADEVKHFTPFKVKVVDTVAAGDSFNGGFAVAFSQARPLHDCVR
FT                   YGSAAGAIAVTRVGAGAAAPTAREVEELIGRA"
FT   gene            complement(3110..4108)
FT                   /gene="iunH"
FT                   /locus_tag="BMI_II6"
FT   CDS_pept        complement(3110..4108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iunH"
FT                   /locus_tag="BMI_II6"
FT                   /product="inosine-uridine preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II6"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49148"
FT                   /db_xref="GOA:C7LGL0"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGL0"
FT                   /protein_id="ACU49148.1"
FT                   /translation="MLSKHAVSCAIPSQRTHQETTMARKIIIDTDPGQDDAVAILLALA
FT                   SPELDILGITAVAGNGPLARTEVNARTVCEVAKKPDTKVFAGSIRPLVRPLVTAENVHG
FT                   KTGLDGYDLPAPTMPLQAQHGVDFIIETLMKEEPGTVTLCPIGPLTNIASALIREPKIA
FT                   GRVKEIVLMGGGYFEGGNITPSAEFNIYVDPHAASVVFSSGIKITMLPLDVTHKVLTTE
FT                   KRIAAIRNIGSHVGEVVAAWLEFFERYDEAKYGTDGAPLHDPNVIAYLIKPELYSGRAC
FT                   NVEIEINSELTIGETVVDWWEVTDRPKNAFFIKDVDADGFFSLLTERLATL"
FT   gene            complement(4131..5042)
FT                   /locus_tag="BMI_II7"
FT   CDS_pept        complement(4131..5042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II7"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II7"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49149"
FT                   /db_xref="GOA:C7LGL1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGL1"
FT                   /protein_id="ACU49149.1"
FT                   /translation="MTTVLAQILDPHFIGTILRVATPLLLAALGVMISDRAGVLNIGME
FT                   GMMLVAALIAVLASAATGSPAVGLLAALVVGALLGWLMSLSVNRLGTDLIMTGIALNIA
FT                   AAAATTLGLYLATGDKGMSGALKSGALPSLAVPFIGNIHVLTFAALLAVPAVSLLMMRT
FT                   RFGLHLRATGVDPKSARAAGIQTGRVQMMALILSGLFGGAAGAYLSLGYVTWFAQNMTA
FT                   GRGFIAIAAEVMGQGTAWGTLVASLVLAAAESIAITLQSLGLPFELMQMIPYLVPVIVL
FT                   TVHAARRQRRARRQITPETQET"
FT   gene            complement(5039..6118)
FT                   /locus_tag="BMI_II8"
FT   CDS_pept        complement(5039..6118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II8"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II8"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49150"
FT                   /db_xref="GOA:C7LGL2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGL2"
FT                   /protein_id="ACU49150.1"
FT                   /translation="MRRFIAYLIPFFLTVLVIGVIMAVLLVPLALMQDNPAAILKTFFL
FT                   GPFGSIRHMGNVVEAATPIMLTGLAITILFRSGLFNLGAESGFFLGALGAVAGAVLLPS
FT                   LGWFSLPVAILCGAVAGSFACTIPAALRLRFGASEMVTSLVLNYAFLFLGLFVLNYVIR
FT                   DPNAGGMMSLRIPADAKLDRLLAGTRLNSGSIIAVLACIAGGIWLYWTRSGLNIRIAGS
FT                   SPGFANHLGLPLKGIIMRAQIVGGLVAGMAGALEVLGLHARFAWLDLPGYGWTGLVVAI
FT                   LARENPFLLIPSALFLGFVQVGGDLLARNMNIPTEVVGLVTAAIMVGATASVIHNHPTV
FT                   LRLIRSLRNRDGEQAGVQA"
FT   gene            complement(6180..7751)
FT                   /locus_tag="BMI_II9"
FT   CDS_pept        complement(6180..7751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II9"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II9"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49151"
FT                   /db_xref="GOA:C7LGL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGL3"
FT                   /protein_id="ACU49151.1"
FT                   /translation="MEKQAETSEGGDAIVAFRPIVAFRDVSKIYPNGTVALRDVSFSIR
FT                   AGSIHAICGENGAGKSTLMKILFGIENATAGEIVVDGKHIASWSPEDAAAQGIGMVHQH
FT                   FSLVPTLTVTENIILGHEPVKAGLIDRAGARKMVETLMQQYDLHADPDAITGTLSVAAQ
FT                   QKVEILKALARRTRLLILDEPTAVLSPPEIEELMRRLKSLRDDGITILFISHKLNEVRE
FT                   LAESVTVLRAGAVAGTEKLADVPDDAIMQMVMGHAVDIPKRAHQRGPGRTVLEMKDVTT
FT                   AAPDPADRIRNVSLTIGAGEIIGVAGVDGSGQRGLVSVLSGLAVAASGTISLNGVDMLR
FT                   ADTASWRKKGLAYLPADRFSQGGAPGLSLAENAIAGAGSVTADRQIFRGPFLRWSAIKA
FT                   RVSGMIRQYSVRAGAITERLDSLSGGNAQKLIAARELATNPKFLIADQPTRGIDVSAAA
FT                   FLHRRIDEVAQGGCAVLLVSADLDELLRLSDRIVVLFNGRIATILDNGPEITPAVLGPY
FT                   MLGTRA"
FT   gene            complement(7754..8860)
FT                   /locus_tag="BMI_II10"
FT   CDS_pept        complement(7754..8860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II10"
FT                   /product="lipoprotein, Bmp family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II10"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49152"
FT                   /db_xref="GOA:C7LGL4"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGL4"
FT                   /protein_id="ACU49152.1"
FT                   /translation="MIKSTRRGIIHLAFALAASTAIGTFATSAAEAKDKIMLIVNGTLG
FT                   DKSFFDSAANGMKMIKDKYGDEVETRILEIGDDPIKWEPVLLDASEQDWDLIIAGTYQM
FT                   AETVGSVAQQYPDKKYILYDASVPYEEGGYDNVYSIQYKQNEGSYLGGLLAASLLKEGK
FT                   LGDGAKNLGFLGGMDIPVINDFLVGYIAGAQSVIPDAKIAVSYAGSFMDAAKGKELGLA
FT                   QYRSGVSLGFVVASQTGLGQLSAAKETGKYVLGVDSDQEAIFKDSDPAIAKQVVSSVLK
FT                   NIDVSLLQAYERYKAGNLPFGKAEALGLKEGAVGIVQDGNMATMATPDIKDAIKKASDE
FT                   ISEGKITVPTAFGMSTEDLNAIRNKVRP"
FT   gene            9103..9711
FT                   /locus_tag="BMI_II11"
FT   CDS_pept        9103..9711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II11"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II11"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49153"
FT                   /db_xref="InterPro:IPR010321"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGL5"
FT                   /protein_id="ACU49153.1"
FT                   /translation="MRKAAVLSVLGFLAASQVMVENGWAEDGWKAVEIVKPYAIAGTTP
FT                   PELYESIGARGPKIGERRVIAHTSYVLTWDREFDRSNGACTVVSATPRLRITYTLPNPS
FT                   QTLAPPVKERWDRFYDGIRRHELVHGDHAKAMTREIVRRTVGLSVPNDPKCRKIRKVLA
FT                   KEITDMVQVQRAQGRDFDHVEMGNGGNVQQLILTFLNGN"
FT   gene            complement(9683..10315)
FT                   /gene="entD"
FT                   /locus_tag="BMI_II12"
FT   CDS_pept        complement(9683..10315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entD"
FT                   /locus_tag="BMI_II12"
FT                   /product="enterobactin synthetase, component D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II12"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49154"
FT                   /db_xref="GOA:C7LGL6"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGL6"
FT                   /protein_id="ACU49154.1"
FT                   /translation="MARYSASKPLIDPSIPAPARAAPRRKAEFVAGQACAREALRLAGG
FT                   PAVMPGRGDDHAPIWPPGMVGSISHSKGCAIAVAARQSRYLGLGIDIERLQTESSARKI
FT                   APQILGESELRQLPEAGRAFLVSLAFSAKESLFKALYPAVQQFQSFHAAAFSFDGDRQQ
FT                   ACLELAVDWSAQWRRGQRFPIRFFCRDGFILTCTAIAAISCRSEMSG"
FT   gene            complement(10398..11174)
FT                   /gene="entA"
FT                   /locus_tag="BMI_II13"
FT   CDS_pept        complement(10398..11174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entA"
FT                   /locus_tag="BMI_II13"
FT                   /product="2,3-dihydroxybenzoate-2,3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II13"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49155"
FT                   /db_xref="GOA:C7LGL7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR003560"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGL7"
FT                   /protein_id="ACU49155.1"
FT                   /translation="MVEAKSYPASWRFAGKRVIVTGAAQGIGRRVAERFLAEGATVIGL
FT                   DRQAGEADAPFRLIRLDITDAAEVRAVSDGLKAEGKPLDILVNVAGVLKLGNSDRLSAE
FT                   DWKTCMDVNASGPFHLLSQWVPVFRDQRHGAIVNVASNAAHVPRLNMAAYCASKAALAS
FT                   FSHCVALELAPYGVRCNVVSPGSTRTAMLGAMLNDPSGEAQLVRGLPEQFKLGIPLGKI
FT                   AMPDDIANVILFLASDQAGHVTMQDIVVDGGATLGA"
FT   gene            complement(11174..12046)
FT                   /gene="entB"
FT                   /locus_tag="BMI_II14"
FT   CDS_pept        complement(11174..12046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entB"
FT                   /locus_tag="BMI_II14"
FT                   /product="isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II14"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49156"
FT                   /db_xref="GOA:C7LGL8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGL8"
FT                   /protein_id="ACU49156.1"
FT                   /translation="MAIPKIADYPMPQKAGFPANKTNWQPDPARAVLLIHDMQRYFLRF
FT                   YDANGPLMGDLIGNLVRLRNWAHENGVPVVYTAQPHEQPAGDRALLNDMWGPGLPAAAP
FT                   EQQLIVDKLTPGATDTVLAKWRYSAFQRSDLLQRMKDWNRDQLIIGGIYAHIGCMVTAI
FT                   DAFMNDIQPFMVGDAVADFSEEEHRLALKYVATRCGAVIDTASLIRKPATETTRDWLQK
FT                   RVLELIEDETELDPQENLILYGLDSLQVMKLSAELKERGVAVGFDDLARVPTLAAWWDL
FT                   IETKQKAAA"
FT   gene            complement(12098..13939)
FT                   /gene="entE"
FT                   /locus_tag="BMI_II15"
FT   CDS_pept        complement(12098..13939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entE"
FT                   /locus_tag="BMI_II15"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase"
FT                   /EC_number="2.7.7.58"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II15"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49157"
FT                   /db_xref="GOA:C7LGL9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011963"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGL9"
FT                   /protein_id="ACU49157.1"
FT                   /translation="MCASLPGRGSWKPPARIPNGPKYRPSLAPCCVPAAFRPETEPLHV
FT                   FVSTHYPTQSRFALRARKLHSFLFQAEQVMTIEFTHWPPARERLYREKGYWIDKPLTRA
FT                   LEEQAAMRPDAPAILCGERRFTYAELDRLSSNLASRLAAAGIGKGDTALVQLPNIAEFY
FT                   IVFFALMKAGIAPVNALFSHRKLELGAYASQIEPRLLIGSRQHELFMDDAFARDLGKNL
FT                   SAPLLTLFAGEADPASSLDHWIATPADKAVPFSPTGAGEVAFFQLSGGSTGTPKLIPRT
FT                   HNDYDYSVRASAEICALTPQTRFLCALPTAHNYPMSSPGALGVFHAGGCVVMAPNPEPL
FT                   NCFSIIERHGVNMVALVPPAVALWLQAAPDHLAALSSLKLVQVGGASFAEALARQVPQV
FT                   LGCKLQQVFGMAEGLVNYTRLDDPDEIVFTTQGRPISPDDEIRIVDEDGEPVAEGQPGM
FT                   LATRGPYTFCGYYRSPEHNAQVFDSEGFYYSGDVVQRTPEGYLRVVGRVKDQINRGGEK
FT                   VAAEEIENLILLHPDVTHAALVAMQDELLGEKSCAFIVSRNPDLKPPVLRRHLLALGVA
FT                   EYKLPDRIRLIETMPLTAVGKIDKKHLRKLSSPSSPG"
FT   gene            complement(13824..14999)
FT                   /gene="entC"
FT                   /locus_tag="BMI_II16"
FT   CDS_pept        complement(13824..14999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entC"
FT                   /locus_tag="BMI_II16"
FT                   /product="isochorismate synthase"
FT                   /EC_number="5.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II16"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49158"
FT                   /db_xref="GOA:C7LGM0"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGM0"
FT                   /protein_id="ACU49158.1"
FT                   /translation="MRTSALKYPTSDADHLIENNTDFSFASGNLKLAASGMREVIATPA
FT                   IGGSNPDSTFQQAIAQAFERAARAGQRNPIVVGAIPFDPGEPSCLYVPEEMDWQEREPA
FT                   SGASAAAMPQLAGQRSVPDEAGFKHAVEHAIINFRLSDVRKAVLSVMRELTFADDIDVD
FT                   AMLANLRAQNHDGYQFRVPLPGGGALVGVSPELLIHKDKGKIVSNPLAGSAKRMADPEA
FT                   DRKNADRLAKSEKDHYEHRLVIEDIRARLQPICTELDIPERPSLIHTAALWHLSTRIEG
FT                   RLHDPDMTALQLACLIHPTPAVCGFPTERARRLIRFVEPFERGLFTGMVGWSDAEGNGE
FT                   WVVTIRCGTVKGNLVRLFAGAGIVEASSPDSEWAEVQTKLGTMLRACGLSA"
FT   gene            15139..16479
FT                   /gene="entF"
FT                   /locus_tag="BMI_II17"
FT   CDS_pept        15139..16479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entF"
FT                   /locus_tag="BMI_II17"
FT                   /product="enterobactin synthetase, component F"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II17"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49159"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGM1"
FT                   /protein_id="ACU49159.1"
FT                   /translation="MARIDFADGWMPLTLPQLDFWEEFSFHPDQPVSTVAHCVEIEGDV
FT                   DVEKLLRAISQTVREAEVLSIRFSDEKEQGRPVQLCDPAHMPDVDFVDLSAFPDPRAEA
FT                   GRRMETDLSAPLDLRRDRMSAHALYRIGARQYIWYIRAHHIIIDGYGLALIEQRCGQLY
FT                   SHFCGQGESGHPFHPFASFIHEEDAYRASPRWEADRKFWQDYLDGPVRLPILDRGAEDY
FT                   GEAGYHHDVAFRDDISIGLRAMAKATDIGWPDLLVLLSGLYLSRMLPMQGEDEGLTLWL
FT                   PFMSRWGSVGAHMPGLLVNILPFHLEFDSGETLFSALRRNMDMLKKHRLHGRYRIEQIS
FT                   ADRGLVSGSRFFFSPLINVLPFSTPQFAGCRVAREVLANGPGDGFNLTYRADVDGAGLT
FT                   LKIEAASNMMDAQTFARIAAGLPAFLKASLAPHLIERPVSDLRRRLP"
FT   gene            complement(16527..17315)
FT                   /locus_tag="BMI_II18"
FT   CDS_pept        complement(16527..17315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II18"
FT                   /product="oxidoreductase, molybdopterin-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II18"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49160"
FT                   /db_xref="GOA:C7LGM2"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGM2"
FT                   /protein_id="ACU49160.1"
FT                   /translation="MTGPRLSRRRFLTFTGMAGSAVLLSGCDAFDYLGSDDNAVRQVLE
FT                   KANDLSYTVQRKLEGPGALAREYGESEIRQGQKPNGETNPSTEEYDRLRENAFADYRLE
FT                   VHGLVEKPLSFSLNELHNMPARTQITRHDCVEGWSTIAKWTGVPLGHILALAKPKAGAH
FT                   YVVFHCFDEVDTPQGPDLFYGSIDLIDAQHPQTILAYGLNGSALPVANGAPLRVRVERQ
FT                   LGYKMSKYVKSIELVSSFAAIQGGRGGYWEDQGYDWYGGI"
FT   gene            complement(17312..18121)
FT                   /locus_tag="BMI_II19"
FT   CDS_pept        complement(17312..18121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II19"
FT                   /product="HupC/HyaC/HydC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II19"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49161"
FT                   /db_xref="GOA:C7LGM3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGM3"
FT                   /protein_id="ACU49161.1"
FT                   /translation="MGQLIYRQRLLTRLTHWIWAASIFFLLLSGLQIFNAHPTLYLGNE
FT                   SGFEYENAVLSIYAVPGDNGPQGRLDILGKTFDTTGVLGVSGTMETPRRQAFPPALTIP
FT                   SYRDLATGRVVHFFFAWVLVATLLLWFTSSLFNGHLKDISPSFTDIRSLPRDFVEHLKF
FT                   RFQHGKSYNPLQKLSYFLVLFGLFPLIVATGLAMSPGADSILPLSEWLGGRQTARTLHF
FT                   VAMLLLVAFFIVHIAMVLAAGPFNELRSMISGWYRIDRTDEKTEKQS"
FT   gene            complement(18182..18496)
FT                   /locus_tag="BMI_II20"
FT   CDS_pept        complement(18182..18496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II20"
FT                   /product="pentapeptide MXKDX repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II20"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49162"
FT                   /db_xref="InterPro:IPR014299"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGM4"
FT                   /protein_id="ACU49162.1"
FT                   /translation="MAPKFNRSFVMTIKRNIIAFSALALIAGFSLTPAAFAEDAMKTDH
FT                   MKSDAMKSDNMSKDAMGKEDAMKGDAMHKDSKKMKKHDAMKGDAMKGDAMKGDAMKSGQ
FT                   "
FT   gene            18651..19175
FT                   /locus_tag="BMI_II21"
FT   CDS_pept        18651..19175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II21"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II21"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49163"
FT                   /db_xref="GOA:C7LGM5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGM5"
FT                   /protein_id="ACU49163.1"
FT                   /translation="MKALMLLALDGNSAAYRTLLEELSRLLKAYFVRRLFGGRVSEAED
FT                   LVQETLLAIHTRRMTYDREMTFLPWVNAIARHKLVDHLRRQGRHDTDVLDEDIAIPGEA
FT                   ANVEARMDVDRMLGGVSERTAGLIRKVKIEGQSIDEAARAGDMSQSAVKVAIHRGLATL
FT                   AQRFGGKKDDR"
FT   gene            19129..19875
FT                   /locus_tag="BMI_II22"
FT   CDS_pept        19129..19875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II22"
FT                   /product="extracytoplasmic function alternative sigma
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II22"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49164"
FT                   /db_xref="GOA:C7LGM6"
FT                   /db_xref="InterPro:IPR009495"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGM6"
FT                   /protein_id="ACU49164.1"
FT                   /translation="MPRWRSGLEARKMTDDLINRLTGELKPVSRHAMQRLLLGHALLGM
FT                   VAGVVIMLAFLGARHDLAAAMATPAFWSKLCYAALLLAVLLPALFALSRPLRQNLPWPA
FT                   LLLIFSCLGAAAIYQWEEASPEVRPVLVWGYTALVCPWLIGLISLPTLASLLLAIRKLA
FT                   PARPTLAGFAAGLVSGGIGVLVYAFHCPESGLPFIALCTRWALWERACWVRLAGASACA
FT                   GNRGEEARINRPDGFCYQLVRLSAER"
FT   gene            complement(19845..20585)
FT                   /locus_tag="BMI_II23"
FT   CDS_pept        complement(19845..20585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II23"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II23"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49165"
FT                   /db_xref="GOA:C7LGM7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGM7"
FT                   /protein_id="ACU49165.1"
FT                   /translation="MKEIATRAAGRATGHLPEEIARQIEKRILDGEFSVGSKLPSEREL
FT                   SVEYGVSRPVVREALSQLKLDGLVEARAGSGVFVIDESNQKAFRIQPLVVEEAQSLEQL
FT                   MELLVAIEVAATRIAAVNRTPEDLKQIKRALIGLEYAIISDKLGDEEDYAFHDAIVIAT
FT                   HNPHFIALCKHLEYGARHVIRQARTNTRSNLKDMLDAVQDEHKAIYEAIELGDPEQAGI
FT                   AAERHLRNATQRMKVYLSADNRTN"
FT   gene            20703..22118
FT                   /locus_tag="BMI_II24"
FT   CDS_pept        20703..22118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II24"
FT                   /product="branched chain amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II24"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49166"
FT                   /db_xref="GOA:C7LGM8"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGM8"
FT                   /protein_id="ACU49166.1"
FT                   /translation="MGNTGDKYRILAFNINDISRYQDWSYFSIDWSYQYGVGILSTGRH
FT                   GKPSKSSGGKMSLKVFLQAGVACAALSLAGAAGASAEPLKIALVETLSGPQASTGLLYR
FT                   AAVLYQLGKINEAGGFNGEKIQILEYDNQGGPVGAADRVKAAIADGAQIIVQGSSSAVA
FT                   GQITEDVRKYNLRNKGKEVLYLNLGAEALELTGSKCHFYHFRFSPNAAIRFKTVAQGMK
FT                   DKGILGERAYSINQNYSWGVDVENTVVANAKEIGYEVVDKTLHEVNKIQDFSPYVAKIQ
FT                   AANVDTVFTGNWSNDLLLLMKAASGAGLKAKFATSFLDQPGNIGNAGAIAEGHIVSTPF
FT                   NPEANGEASMAFAEDYKKVTGHYPSYVEPAAVFGLQLFGEALKNVKPGEGKINTTDIAL
FT                   AIENASVKTPMGDYSMRSDDHQAKFPMVVQEVSKKARIKADGTEYGFLPFKTFTGDESI
FT                   DPVQESCSMKRPG"
FT   gene            22160..23149
FT                   /locus_tag="BMI_II25"
FT   CDS_pept        22160..23149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II25"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II25"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49167"
FT                   /db_xref="GOA:C7LGM9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGM9"
FT                   /protein_id="ACU49167.1"
FT                   /translation="MDRSPVRAELPITDQTMDQILFAVLNGAIYGLLLFMVSAGLTLIF
FT                   GMMGVLNFAHASFYMMGAYFAYTLQPLTGFWLAILIAPVIVGIVGVLVERFILRRVHAF
FT                   GHAHELLVTFGLSVVIAEVIKIFYGNFAVEYRIPAALQFSAFDLGGVSYPFYRLFIGAV
FT                   ALVMFLLIYLLLTRTRIGIVVRSAIYRPRMVEALGHNVPLVFMGVFGVGAFLAGLAGSV
FT                   AGAFYTTNPNMALELGVMVFVVVVVGGLGSLGGAMFASLLIGILSSVAVGVKVSIASLL
FT                   DYVGLGDYAREIGGVLTLEVSSIAATLPFFLMLIVLLVRPSGLFGAKE"
FT   gene            23153..24373
FT                   /locus_tag="BMI_II26"
FT   CDS_pept        23153..24373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II26"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II26"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49168"
FT                   /db_xref="GOA:C7LGN0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGN0"
FT                   /protein_id="ACU49168.1"
FT                   /translation="MTIKQSVVALLVVALLVALPYLVSESMTNAAIQMLIAALFATAFS
FT                   LLCGQAGMLSFGHAAYFGLGSFAAVHAMNAFGGEGLLPTPLLPLAGAGVGLLSGLVAGW
FT                   FSTKRTGVYFAMITLALAELLHALAPHLKGTFGGEAGVSSFRMPAWGFDFGSTTEVYYL
FT                   ALAWVVGSILLLFLLTLTPFGRVTVGLRENTHRLRFLGYNVHVLGTLVFAISAMFAGIA
FT                   GALQAINIEAANYVVFEAGISTAVVLNSFIGGVGTFFGPAIGAAAMTFFGHVTSDVTRS
FT                   WLLYQGLIFVLVMMFLPRGLVGEAVERFRNPKGTGISLGYALGRLVALLVTAAGTIMIV
FT                   ELVQRFFSSDYKALASAGNWPPVTFLGREWLPFAVSTWLIPLALFAAGIALLTIVNRHR
FT                   AKAKGEA"
FT   gene            24373..25125
FT                   /locus_tag="BMI_II27"
FT   CDS_pept        24373..25125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II27"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II27"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49169"
FT                   /db_xref="GOA:C7LGN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGN1"
FT                   /protein_id="ACU49169.1"
FT                   /translation="MTKDILVLDQLNKSFGPAHIIRGVNLAVRDGERHAVIGPNGAGKS
FT                   TLFHLISGNFTPSSGSIRFQGEEIGGLTPAAVNRKGLARSFQITNIFPGLTVFENIRLA
FT                   VMRRYKVQFTFWRPVSSMRKVTAEVESLLEQVRLTARAYTLASQLSYSEQRSLEIGMTL
FT                   ASDPRLIILDEPMAGMSQEETDYTVGLIREITQNRTLMIVEHDMDVVFTLADRISVLVY
FT                   GEIIATGTPKEIRENARVREAYLGEEAH"
FT   gene            25125..25841
FT                   /locus_tag="BMI_II28"
FT   CDS_pept        25125..25841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II28"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II28"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49170"
FT                   /db_xref="GOA:C7LGN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGN2"
FT                   /protein_id="ACU49170.1"
FT                   /translation="MAAENILDVRELHAHYGKSHILQGVTFDLKKGEAISLLGRNGSGR
FT                   STTMKAIMGLVPPTSGEVLLNGKNLAGERSFKICRAGIGFVPEERETFLNLTVDENLQM
FT                   GIQRGAEGATRWTVEQMFDYFPRLKERRNTRAGSLSGGEQQMLTMCRTLLGNPLVMLID
FT                   EPTEGLAPKIVAVVGEMIKDINRQGVSVVLVEQKLTIALKVSSRVCVMGHGRIVFEGTP
FT                   DELTADEKLMEEWLAV"
FT   gene            25893..26375
FT                   /locus_tag="BMI_II29"
FT   CDS_pept        25893..26375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II29"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II29"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49171"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGN3"
FT                   /protein_id="ACU49171.1"
FT                   /translation="MTQMTAPLEVGLAVRDLKRMRAFYEGALGLSFVSEIHVGGEKAKV
FT                   AAMSPDGYTVVRLQTAKGERIKLLQPDRLPQAGQAETGLILERAGASYLTFIVDDLKAL
FT                   VERLIEHGAQPLTGRDPIEVRPGTWLAFLHDPEGHIVEIVQYDDIAAYRPDLAEEK"
FT   gene            26379..27116
FT                   /locus_tag="BMI_II30"
FT   CDS_pept        26379..27116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II30"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II30"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49172"
FT                   /db_xref="GOA:C7LGN4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGN4"
FT                   /protein_id="ACU49172.1"
FT                   /translation="MKFEFENRTLVLTGANGGIGRAIAELFHASGANLVLTDLDREGLD
FT                   AFAASLGSPERIATIKADASSADDAEKTVALAMERFGGIDFLVPSAGIYQAKPFAEMSD
FT                   ADWHRTISINLDGVFYLCKRALPALKEDSSIVTLASLAAYRGAYVNAHYGATKGAMVSM
FT                   TRALSRELAPKTRVNGVAPGIIETPMTSELLKTRMDETMTQTPLKRLGKPSEIASVIAF
FT                   LCSPAASFVTGETIQVNGGIYMA"
FT   gene            27134..27886
FT                   /locus_tag="BMI_II31"
FT   CDS_pept        27134..27886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II31"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II31"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49173"
FT                   /db_xref="GOA:C7LGN5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGN5"
FT                   /protein_id="ACU49173.1"
FT                   /translation="MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKA
FT                   QADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQPEA
FT                   VEVWDRVIGVNLEGAFNVSHALVPALKAAKGNVVHLCSVAGFVSGGSTAGYVVSKGAIR
FT                   SLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNRPGGTDWFMNRVMMKRIGETSEVV
FT                   DPVVFLASPMASYITGTILPVDGGFLAA"
FT   gene            27996..30185
FT                   /locus_tag="BMI_II32"
FT   CDS_pept        27996..30185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II32"
FT                   /product="acetoin dehydrogenase, alpha/beta subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II32"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49174"
FT                   /db_xref="GOA:C7LGN6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGN6"
FT                   /protein_id="ACU49174.1"
FT                   /translation="MPEYKDLVPHSFWREIVPTTEDRAAFDLALGGTMLSQMHLIRAFE
FT                   EKVLELAGQGLVHGPAHSAIGQEGGAVGSAVSMRPSDQINGSHRAHHQFLAKALGYVAQ
FT                   KGIDPKAAFDQDIRMLAQRTLAEILGLSQGFCRGRGGSMHLRWAESGNLGTNAIVGGGV
FT                   PMAAGAAWAHRRAGKGDVVYTYFGDGATNIGSVLETMNLAAAWKLPICFFIENNRYAVS
FT                   THVEEVTAEPRLSSRGLAFGIPSFKVDGMDPIAVWLASEEANAIMRAGNGPTIIEADVY
FT                   RYFHQNGPLPGSAFGYRSKDEEAEWRGRDPLDALAKTLLERQALGEDAIKALRERCVSL
FT                   MDEVAGQLIEMHDGKRRIIPSLWPEESFRDFGLRGDLSEFDGVRFEEQESFSGKLVEDA
FT                   RFIDTVADVMARRMETDERVVVLGEDVHRLKGGTNGATRGLSADYPDRVLGTPISENAF
FT                   TGIAGGMAADGRVLPVIEFMYPDFMWVAADQVFNQIGKARHMFGGDSDMPVVLRTKVAM
FT                   GTGYGSQHSMDPAGIFATAPGWRIVAPSTPFDYVGLMNSALLCRDPVLVLEHVDLYASK
FT                   GAAPAEDFDYFIPLGKAKVVRPGSRVTVLTYLAMVAKTQAVVEALGVDAEIIDLRSLDR
FT                   AGVDWETIEASVRKTGNVLIVEQGASGTSYGGWLADELQRRCFDWLDQPIARVHGAEAS
FT                   PSISKVLEAAAAARPQDIEAGLRAVMAAQGLPIEN"
FT   gene            30204..31469
FT                   /locus_tag="BMI_II33"
FT   CDS_pept        30204..31469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II33"
FT                   /product="acetoin dehydrogenase complex, E2 component,
FT                   dihydrolipoamide acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II33"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49175"
FT                   /db_xref="GOA:C7LGN7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGN7"
FT                   /protein_id="ACU49175.1"
FT                   /translation="MPVEVVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKAT
FT                   MELEAEVDGRIGQLLVKDGARANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETP
FT                   VAASPVPAAPAVSAPASGEVRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERA
FT                   AASKPVPVAAAAAPVAAPAEASSKAIPVGIGEYEAVPHTSMRRTIARRLLEAKTTVPHF
FT                   YLNVDCEIDALLALRSQINEKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLK
FT                   LKDVDIAVAVATEGGLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFS
FT                   ISNLGMYGVKSFSAIINPPQSAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDG
FT                   ALGAQLLAAFKAGIEDPMSLLV"
FT   gene            31570..32355
FT                   /locus_tag="BMI_II34"
FT   CDS_pept        31570..32355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II34"
FT                   /product="shikimate dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II34"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49176"
FT                   /db_xref="GOA:C7LGN8"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGN8"
FT                   /protein_id="ACU49176.1"
FT                   /translation="MTVTGHTRVFAIIADPVHHVRTPQALNALFAARGYDGIVVPAAVP
FT                   ASGLKYAAAALRAFGNWGGFIVTVPHKTEMPAFCDRLTPRAQAAGAVNVIRREADGSLT
FT                   GELLDGVGFVRGLANAGHDVKGRSVYLAGAGGAASAIAFALAEAGVVRLTVVNRSSEKA
FT                   GQLVARLKEHFPAGMFVSQGTPAGHDIIVNGTSLGLKEGDALPVDPQYLRPEMLVAEVI
FT                   MSPEVTPLLQIAKDSGCSIHPGKAMLDGQLAEMFDFFTR"
FT   gene            32635..32928
FT                   /locus_tag="BMI_II35"
FT   CDS_pept        32635..32928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II35"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II35"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49177"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGN9"
FT                   /protein_id="ACU49177.1"
FT                   /translation="MKFTAIALLGARVLARRHPKYSQMSARPASRVPGAEHGTIRPRPV
FT                   AIWKADPSTGRIECHWTTDPNEVSAWLARSCFEQAGLIMAAVQQGRFGMPAH"
FT   gene            complement(32882..33163)
FT                   /locus_tag="BMI_II36"
FT   CDS_pept        complement(32882..33163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II36"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II36"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49178"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGP0"
FT                   /protein_id="ACU49178.1"
FT                   /translation="MLKGSPLMPRCWETLADHLERLRVGHPFSAHFRCLHPSSGLWGGV
FT                   RGRIWQLRRERAMLAQISSVTAPPMMRTCAKNHISAQACQSGPAARQP"
FT   gene            33281..35998
FT                   /gene="mgtA"
FT                   /locus_tag="BMI_II37"
FT   CDS_pept        33281..35998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtA"
FT                   /locus_tag="BMI_II37"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II37"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49179"
FT                   /db_xref="GOA:C7LGP1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGP1"
FT                   /protein_id="ACU49179.1"
FT                   /translation="MNVAVRTANNKNFKKDERRLSMRAVREASNEIELTLANVGSRRDG
FT                   LTEGDAITRLYRDGPNEVARERRIPALVQFALAFKNPFIMVLVVLGAISAFTDIWLPLE
FT                   TGEEADPTKVIIIAVMVLASALMRFIQEYRSGRAAEALKAMVRTTATVWRRVSAGTSSA
FT                   PREIPMRELVVGDIVQLSAGDMIPADLRLIESRDLFISQAVLTGEALPVEKYDTLGAIS
FT                   EKSAMATASQDADMLDLPSICFMGTNVVSGTATAVVVATGQRTYFGSLAKAIVGSRAQT
FT                   SFDRGINSVSWLLIRFMLIMVPVVFLINGFTKGNWVEAMLFGLAVAVGLTPEMLPMIVS
FT                   SNLAKGAVAMARRKVVVKRLNAIQNFGAMDVLCTDKTGTLTQDKIILEHHIDVSGKADD
FT                   KVLRLAWLNSYHQSGVKNLMDQAVVSFANRVPEEVMRTARLYRKVDELPFDFIRRRLSV
FT                   VVEGVGGEHLLVCKGAVEEMLAICTTVRDGETVRALDAVTREKLIATARAYNADGFRVL
FT                   VVATREIPGAETSAQYRIADEAGLTVQGFLTFLDPPKETAGPAIAALAEHGVCVKVLTG
FT                   DNEIVTRKICREVGLEAGIPILGSEIEKLDDEALRVVAEERTVFAKLTPLQKSRVLQAL
FT                   QANGHTVGFLGDGINDAPALRDADVGISVDSGADIAKESADIILLEKSLIVLEEGVVTG
FT                   RETFGNILKYLNMCASSNFGNVFSVLVASAFIPFLPMLAIHLLIQNLMYDISQLALPWD
FT                   KMDKEFLAKPRKWDARNIGRFMIWIGPTSSIFDITTFALMWYVFSANSPQMQSLFQSGW
FT                   FIEGLLSQTLVVHMLRTQKIPFFQSTAALPVMLMSALIIALGIYIPFSPIGEMVGLVPL
FT                   PWAYFPWLAATLVSYCLVAQGMKVIYVRRFGQWF"
FT   gene            36083..36433
FT                   /locus_tag="BMI_II38"
FT   CDS_pept        36083..36433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II38"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II38"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49180"
FT                   /db_xref="GOA:C7LGP2"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGP2"
FT                   /protein_id="ACU49180.1"
FT                   /translation="MQPIDAEGGKMSDTVFVFVDTTQGANPPGGRRPGSPRRRGEPPLP
FT                   GGSPQGLWQWMKGRMDRWICWAYTVLGTNLASITYWLSRQGLIGRRATFRLLRWTSALQ
FT                   ARSVRRLRKASW"
FT   gene            36564..36767
FT                   /locus_tag="BMI_II39"
FT   CDS_pept        36564..36767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II39"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II39"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49181"
FT                   /db_xref="GOA:C7LGP3"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGP3"
FT                   /protein_id="ACU49181.1"
FT                   /translation="MYHFRFSGGYKALPTAVPHRGTLVGSIAVATYLILFALVVLFVVP
FT                   ASQANGPLDGDTQWQGAQAGGK"
FT   gene            36769..37485
FT                   /gene="mgtC"
FT                   /locus_tag="BMI_II40"
FT   CDS_pept        36769..37485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtC"
FT                   /locus_tag="BMI_II40"
FT                   /product="Mg2+ transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II40"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49182"
FT                   /db_xref="GOA:C7LGP4"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGP4"
FT                   /protein_id="ACU49182.1"
FT                   /translation="MVWKPLAHTAACLAGAFLLGGLIGFERQFRHRLAGLRTNTLVAVG
FT                   AATFVVFSSLVSGDSSPTRVAAQIVSGIGFLGAGIIFKEGFNVRGLNTAATLWCSAAVG
FT                   VLCGAGLISHAAVATVFIIAVNALLRPLVQVLEFQAMRRGAFQPTYAIDIICHGDAEAQ
FT                   VRALLLRDIGDHLHIHELESSNIEGTNRVEVSATVRADQRQDRLLEQIVGHLSLEPRIT
FT                   SARWRIEDDSGGLSGL"
FT   gene            37560..38630
FT                   /locus_tag="BMI_II41"
FT   CDS_pept        37560..38630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II41"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II41"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49183"
FT                   /db_xref="GOA:C7LGP5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGP5"
FT                   /protein_id="ACU49183.1"
FT                   /translation="MLKTIIRRNVTGSTPKILLLACLTAAIFIVDTVTDYAIAAAVFYT
FT                   VVILLSARLLTGKAVTGLASTCIALSVISFAFTSKGAFYEGLINTGISIIAIIATTYLG
FT                   LKLVSAEIDVRESRERLLRLARMTTLGQLTSSIAHEVSQPLVAIEISASAGRRWLAQSP
FT                   PNNERAAAAIERISADSHRAIEILDRVRRLSRGEKPHVAPFDINEVVRDIVELAHNEIT
FT                   RHDIALDLDLTPGLPMALADRVQIQQVIGNLVLNAIEAIQEKDPPVRSLKINTALTEGA
FT                   RLQVAVRDSGGGIAPADQERLFDAFWTTKKGGFGLGLTISRTIVESSGGTIALGSTTPH
FT                   GTTILFEVPTTQETEI"
FT   gene            38627..39265
FT                   /locus_tag="BMI_II42"
FT   CDS_pept        38627..39265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II42"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II42"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49184"
FT                   /db_xref="GOA:C7LGP6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGP6"
FT                   /protein_id="ACU49184.1"
FT                   /translation="MNCAYERDPVVFIVDDDHSVRLGLVDLFASIGLKALCFASVNEFL
FT                   KHAREEVPACLILDVRMPGESGTEFHARMKGLDIRLPVIFITGHGDIAMGVKAIKDGAI
FT                   DFLAKPFRNQDLLDAVQQAIRTDRKRLREEHNQHRIIARYQTLNQGERAVFKLVVQGLM
FT                   NKQIAAELDVAEVTVKVRRSHLMHKMRAKSLADLVRMATELNAQPVKEL"
FT   gene            complement(39463..39537)
FT                   /locus_tag="BMI_II43"
FT   tRNA            complement(39463..39537)
FT                   /locus_tag="BMI_II43"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUC"
FT   gene            complement(39651..40013)
FT                   /locus_tag="BMI_II44"
FT   CDS_pept        complement(39651..40013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II44"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II44"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49185"
FT                   /db_xref="GOA:C7LGP7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGP7"
FT                   /protein_id="ACU49185.1"
FT                   /translation="MKRILLAEDDNDMRRFLVKALEKAGYHVTHFDNGASAYERLQEEP
FT                   FSLLLTDIVMPEMDGIELARRATEIDPDLKIMFITGFAAVALNPDSDAPRDAKVLSKPF
FT                   HLRDLVNEIEKMLIAA"
FT   gene            complement(40129..40242)
FT                   /locus_tag="BMI_II45"
FT   CDS_pept        complement(40129..40242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II45"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II45"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49186"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGP8"
FT                   /protein_id="ACU49186.1"
FT                   /translation="MQTLSAWKHIVFMIAEKNPCCKPATLASLLPKTRHNN"
FT   gene            40332..41222
FT                   /locus_tag="BMI_II46"
FT   CDS_pept        40332..41222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II46"
FT                   /product="formiminoglutamase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II46"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49187"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGP9"
FT                   /protein_id="ACU49187.1"
FT                   /translation="MSLERDFGSVPPFEVSAPAQQRIPFVFNSPHSGRHYPLSFVQASR
FT                   LDAISIRNSEDCYVDELFASVMRLGAPLLKANFPRAFLDVNREPYELDPRMFAEPLPPF
FT                   ANSHSARVAGGLGTVPRLVAEGQLIYPGRIPLAEALYRIEDLYKPYHAALDALLEATRQ
FT                   QFGYAVLIDCHSMPGGTSAGEIGSRPDFIVGDRFGRSCSERLTQAAIELLQDLGYTVAH
FT                   NKPYAGGFITEHYGRPAMACHALQIEVNRSLYVNEQNLHKLEGFEALCVALHHFVSDLT
FT                   SLPDDLFIAPPLAAE"
FT   gene            41384..42160
FT                   /locus_tag="BMI_II47"
FT   CDS_pept        41384..42160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II47"
FT                   /product="inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II47"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49188"
FT                   /db_xref="GOA:C7LGQ0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR011809"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGQ0"
FT                   /protein_id="ACU49188.1"
FT                   /translation="MLIDKAFFSEVAAAAAAQTLPRFRQLTEVDNKYSVGFDPVTEADR
FT                   AAERAIRAVIGRTFPDHGILGEEYGAENTDRSHVWIIDPVDGTRAFISGLPVWGTLVGL
FT                   TVDGDARAGMMSQPFTGELFYSDGDGAYLQRGDGAPRRLCVRKNAVLEDATLFTTTPAL
FT                   FKGDDRKAFDRLESAVRLSRYGVDCYAFAMLAGGFVDIVVEAGLQTYDIAALIPIIEQA
FT                   GGVVTRRDGGPAEQGGDIVAAATPALHQAALDLLHI"
FT   gene            complement(42211..43206)
FT                   /locus_tag="BMI_II48"
FT   CDS_pept        complement(42211..43206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II48"
FT                   /product="lysophospholipase L2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II48"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49189"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGQ1"
FT                   /protein_id="ACU49189.1"
FT                   /translation="MSELLFETDANPIPSRIRGGLFHAPDGKALRYALLKAESRPCRGT
FT                   VIVLQGRNEFIENYYETMSDLAGRGFTVATFDWRGQGGSHRLLRDRLRGYVRSFNDYAD
FT                   DLDHFLTGIVLPDCPPPFFILAHSAGALVALSSLERLSSRITRMVLCAPLMGLGGQKIS
FT                   DDNVRRITAALRWIGLGRIYAAGGRTLSAARAFADNPLTSDPLRFMRNVEITRTYTDLA
FT                   LGGPTVRWVWSALETAWRINQPDFYKSPIAPVLIIAAGADRVVSTAVIERFVARTRNIS
FT                   LAVIDGARHEMLQEADFYREQVLAAFDAFIPGSSPVESMPQSLEPDLSQI"
FT   gene            complement(43246..43461)
FT                   /locus_tag="BMI_II49"
FT   CDS_pept        complement(43246..43461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II49"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II49"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49190"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGQ2"
FT                   /protein_id="ACU49190.1"
FT                   /translation="MSTGTQINCSLQPGITKNATVVLTGLPKHSQRKRTSWRNGPCSGC
FT                   FLNRKFAHELPVTFYHDFAHYGGASK"
FT   gene            complement(43556..43954)
FT                   /locus_tag="BMI_II50"
FT   CDS_pept        complement(43556..43954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II50"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II50"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49191"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGQ3"
FT                   /protein_id="ACU49191.1"
FT                   /translation="MKKAALALAALATAATGIATPTLAADNGLRVQIQYYDDDGYRVPR
FT                   QGFDGPGRHDRRPNWGDGYIRREVMNPRRVARSLERRGYDVGDMRLERDTYFVRATRPS
FT                   GRRVVVMVDAYNGNIIGERRAGPRPSGY"
FT   gene            44006..44215
FT                   /locus_tag="BMI_II51"
FT   CDS_pept        44006..44215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II51"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II51"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49192"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGQ4"
FT                   /protein_id="ACU49192.1"
FT                   /translation="MVPVKMATLDQSRYLFRSIYLTQNRCALLLEMLWPRAFERSPKMM
FT                   FILGYRAVRKAKYSSLWIRSCYAK"
FT   gene            44188..44439
FT                   /locus_tag="BMI_II52"
FT   CDS_pept        44188..44439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II52"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II52"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49193"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGQ5"
FT                   /protein_id="ACU49193.1"
FT                   /translation="MDQELLRKVTWCVRARSKSRHAGLQMALLIQAPGPGIEYRVLSIS
FT                   AGLEMKSRHSQMSSAVATEGPPAQEIRHQGSFAAHVRS"
FT   gene            44518..44988
FT                   /gene="ibpA"
FT                   /locus_tag="BMI_II53"
FT   CDS_pept        44518..44988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpA"
FT                   /locus_tag="BMI_II53"
FT                   /product="16 kDa heat shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II53"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49194"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGQ6"
FT                   /protein_id="ACU49194.1"
FT                   /translation="MRHVDFSPLYRSTVGFDRLFTMLDSLASPEGNQSYPPYNIERTGE
FT                   NAYRITMAVAGFSENELEIEAHRNQLTVKGQKADETASDVGEVLYRGIASRAFERRFQL
FT                   ADFVEVSGASLKNGLLHIDLKREIPEQMKPRKIEVTKAGSGTAQPIEAKTAH"
FT   gene            complement(45126..46175)
FT                   /locus_tag="BMI_II54"
FT   CDS_pept        complement(45126..46175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II54"
FT                   /product="threonine aldolase, low-specificity"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II54"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49195"
FT                   /db_xref="GOA:C7LGQ7"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026273"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGQ7"
FT                   /protein_id="ACU49195.1"
FT                   /translation="MHFASDNWAGAHPKIAESLSLHAAGFAAAYGASEIDKRVEQHFNE
FT                   LFEREVAVFFVGTGTAANSLALASVNRPGGVSLVHREAHVIEDECGAPEYFTGGARLHP
FT                   IDGALGRIDPELLKRELKRFNPAFVHAGQPMAVSITQATEVGTLYQPEHIATISQICRD
FT                   AGLPLHMDGARFANALVSLDLTPAEMTWKLGVDIVSFGGTKNGCWCAEALVFMDPARAK
FT                   DLPFIRKRAAQLFSKTRFVAAQFDAYLRDDLWRDLARHSNALAARLANHIHASSQMRLA
FT                   WKPEANEVFAIMKQSVYDRLRDAGAVFYDWNPPHSEVGRIGEGEIFARFVTSFANTEEE
FT                   VDRFGDMIA"
FT   gene            complement(46444..46728)
FT                   /locus_tag="BMI_II55"
FT   CDS_pept        complement(46444..46728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II55"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II55"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49196"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGQ8"
FT                   /protein_id="ACU49196.1"
FT                   /translation="MKSLIDKALDEVPQGRKAAGERCLAPILIRLLTDSTLRTATGARN
FT                   SPCHSRSACHRQASGLPVRRLSLKLYEQRLIAFGSHQRLIGQHCCPNYV"
FT   gene            46818..51569
FT                   /gene="gltB"
FT                   /locus_tag="BMI_II56"
FT   CDS_pept        46818..51569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="BMI_II56"
FT                   /product="glutamate synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II56"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49197"
FT                   /db_xref="GOA:C7LGQ9"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGQ9"
FT                   /protein_id="ACU49197.1"
FT                   /translation="MTHLTPSVSNVVSHNVQNEAVKAATTASTRTTRKTKAAGVPPAQG
FT                   LYDPRNEHDACGVGFIAHMKGRKSHVVVENGLKMLENLTHRGAVGADPLMGDGAGILVQ
FT                   IPDRFFREEMARQGIDLPQPGHYGVGYIFMPRDPDLRAHAEEIVREVIAAEGQTFIGFR
FT                   EVPVDNSSLSKAPHIAATEPFHMQVFIGRSPMLETDDDFERRLFVLRKVISNRIYQEND
FT                   GDDKGFYVVSMSARTVVYKGMFLAYQVGAYYLDLKDPRFESAVALVHQRFSTNTFPSWR
FT                   LAHPYRMVAHNGEINTLRGNVNWMAARQASVDSELFGNDISKLWPISYEGQSDTACFDN
FT                   ALEFLHQGGYSLAHAMMMLIPEAWSGNKLMSDERRAFYEYHAALMEPWDGPAAVAFTDG
FT                   RQIGAMLDRNGLRPARYIVTEDDFVILASEAGVLPVDEKKIVRKWRLQPGRMLLIDMEE
FT                   GRIISDEEIKSQIAQKHPYKQWLANTQLILEDLNPVEPRALRKDVSLLDRQQAFGYTQE
FT                   DTKFLMAPMATTGQEAIGSMGTDTPISAMSDKSKLLYTYFKQNFAQVTNPPIDPIREEL
FT                   VMSLVSFIGPRPNIFDLVGTSRRKRLEVRQPILTNGDLEKIRSIGHTEDRFDTKTLDIT
FT                   YNTGEGATGMHGAIERLCDRAEAAVHGGYNIVILSDRQVGPDRIPIPALLATAAVHHHL
FT                   IRKGLRTSVGLVVESGEPREVHHFACLAGYGAEAINPYLAFDTLLDMHRRREFPPEVDE
FT                   HEVVKRYIKSIGKGILKVMSKMGISTYQSYCGAQIFDAVGVRTDFVDKFFFGTATTIEG
FT                   VGLDEIAEETVRRHTDAFGNDPVLLNALEVGGEYAYRMRGEAHMWSPDAVAKLQHAVRT
FT                   SNPDTFTEYTRMLDAKSSQAKTIRGLFNIRFAEERGLKPVSIDEVEPATDIVKRFSTGA
FT                   MSFGSISREAHTTLARAMNAIGGKSNTGEGGEEPDRFYPLPDGTANPERSAIKQVASGR
FT                   FGVTTEYLVNSDLIQIKVAQGAKPGEGGQLPGHKVDATIAKTRHSTPGVGLISPPPHHD
FT                   IYSIEDLAQLIYDLKNVNPAADISVKLVSEVGVGTVAAGVAKARADHITVSGYDGGTGA
FT                   SPLTSLKHAGSPWEIGLAETHQTLVLNGLRSRVALQVDGGLRTGRDVVIGALLGADEFG
FT                   FSTAPLIAAGCIMMRKCHLNTCPVGVATQDPVLRKRFKGTPEHVINFFFYLAEEVRALL
FT                   AQMGFTRLEQIIGETELLEKQAMIDHWKAKGLDFSRIFYKPEAEKHEIYWTERQHHPID
FT                   DILDRKLIELAAPALEERQPVKIDVEIKNVDRSAGAMLSGEVAKRFRHKGLPEDTISVT
FT                   LRGTAGQSFGAFLARGISFELIGDGNDYIGKGLSGGRIVVRPPEDTRIVAEDSIIVGNT
FT                   VLYGALEGECYFRGVAGERFAVRNSGAVTVVEGVGDHGCEYMTGGVVVVIGQTGRNFAA
FT                   GMSGGVAYVLDEEGDFAQRCNMAMVELEPVPEEDDILEKLHHHGGDLMHKGRVDVSANM
FT                   THHDEERLVQLIANHLHYTGSTRAKDILDNWESYRPKFVKVMPVEYRRALEEMERMQIG
FT                   VAAE"
FT   gene            51651..53105
FT                   /gene="gltD"
FT                   /locus_tag="BMI_II57"
FT   CDS_pept        51651..53105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="BMI_II57"
FT                   /product="glutamate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II57"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49198"
FT                   /db_xref="GOA:C7LGR0"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGR0"
FT                   /protein_id="ACU49198.1"
FT                   /translation="MGKVTGFLEIDRQVAKYQPASDRIRHFREFTIPMTDGEVQKQAAR
FT                   CMDCGIPYCHGPTGCPVHNQIPDWNDLVYNNNWDQAIRNLHLTNNFPEFTGRICPAPCE
FT                   EACTLNLEDMPVAIKTVEQALGDKAYELGYIVPQPAASKTGKLVAIIGSGPAGLAAAQQ
FT                   LARAGHMVDVYERESRPGGLLRYGIPDFKMEKHLIDRRVAQMEGEGVRFHCGVNIGVDK
FT                   PLRGLLDTYDAVLYCGGSETPRPAGIPGADLDGVHDAMPYLVQQNRRVGRENIESVAWA
FT                   SVPILAGGKHVVVVGGGDTASDCVGTAFRQGAVNVTQLDIRPQPPEKEDKLSVWPYWAT
FT                   KMRTSSSQAEGASREFQVATLEFIGEDGRLTHVKCCQVDEKRRPIAGTEFFIKADLAFI
FT                   AIGFAGPVEDSVVKEMDGKLEIATDRRGSKSVKANDRDYRTNVDKLYAAGDIRRGQSLV
FT                   VWAIREGRQAAHAIDADLMGSSVLPR"
FT   gene            complement(53150..54553)
FT                   /locus_tag="BMI_II58"
FT   CDS_pept        complement(53150..54553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II58"
FT                   /product="amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II58"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49199"
FT                   /db_xref="GOA:C7LGR1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGR1"
FT                   /protein_id="ACU49199.1"
FT                   /translation="MNTISKPSVDLHREEEPHLARNLSNRHLQLIAIGGTIGTGLFMGS
FT                   GKAVSLAGPSILLIYAITGFMLFFVMRALGEILLSNLQYRSFADFAGDYLGPCAQFFTG
FT                   WTYWLCWIVTAVAEVVAVSGYVSFWFPHLAPWIPALGLITILLILNLPTVRNFGEIEFW
FT                   FALIKIITIIGLIITGIYMLMTGFVLPNGTQASIAHLWNHGGFFPNGSLGFIAGFQISV
FT                   FAFVGIELVGTAAAEAENPMRNLPKAINNIPIRIVLFYIGALFVIITVTPWNQVDPNSS
FT                   PFVAMFSLAGIGIAAHFINFVVLTSASSSSNSGIYSTSRMVYGLATVGLAPKAFSKLSN
FT                   RKVPVHALIFSCIFLLSSVVLLYAGQSMIQVFTLVTTISALLFIFIWSIILVSYLQYRR
FT                   KHLERHEKSTFKMPGGRASVVMVFIFFAFVLWALTQEPDTLAAMKVTPLWFVLLGIAYW
FT                   VMKLKQKQS"
FT   gene            complement(54771..55922)
FT                   /locus_tag="BMI_II59"
FT   CDS_pept        complement(54771..55922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II59"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II59"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49200"
FT                   /db_xref="InterPro:IPR007407"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGR2"
FT                   /protein_id="ACU49200.1"
FT                   /translation="MREALTSGKFLKLAGMMLAAAALLLTSLAAATAQERPRTLFDLLF
FT                   GSRQAQPQRQYERPAPQRVKPKPKRPRASSPAARAAAPSAAAPAVEIATKKPDAKKILV
FT                   VGDFIGNGLAEGLDAAFATDPDLTVATRVNGSSGFVRDDYFNWPDNIGKILDEEKPAAV
FT                   VVMIGANDRQAITANGNSLQPRSPEWNAEYQKRVAAFTKVISDRHYPLVWVGQPPFRPK
FT                   GMSQDMLALNEIYRNAAEKAGGKFADVWDGFVDEEGNFTQTGFDINGQTARLRANDGIN
FT                   ITSTGKRKLAFYAEKPLHAYLGVSREEGNSLPATHSLDPSKPVDRVAPVSLRDINKDDS
FT                   GILLGGTPAMQAKPLKTEQKKANPSPGRADDFSWPRNGKAPRK"
FT   gene            complement(56173..56691)
FT                   /locus_tag="BMI_II60"
FT   CDS_pept        complement(56173..56691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II60"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II60"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49201"
FT                   /db_xref="GOA:C7LGR3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGR3"
FT                   /protein_id="ACU49201.1"
FT                   /translation="MRTLVMVACAVSLAACSSPPKPPTVSGRHRIPINSPAAQEELRLQ
FT                   VFPQEPTAQATMWPARPPKQTVSVYFPQDVTVFRPTSAQINQLHTLLWPVPKHINVRGL
FT                   TDNNCPPPGDTQVARVRALAIYNWLINQGVPASRITISYAPVKDYASNAPLSPGRVLNR
FT                   RVDIEILRK"
FT   gene            complement(56837..57931)
FT                   /gene="virB11"
FT                   /locus_tag="BMI_II61"
FT   CDS_pept        complement(56837..57931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="BMI_II61"
FT                   /product="type IV secretion system protein VirB11"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II61"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49202"
FT                   /db_xref="GOA:C7LGR4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGR4"
FT                   /protein_id="ACU49202.1"
FT                   /translation="MCMMSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCV
FT                   NRPGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERI
FT                   QIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKEA
FT                   GDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIEDVPELFLPDHP
FT                   NHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAASGHGG
FT                   SITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGR
FT                   HISEVWYDPNTKRALSLQHSEKTQ"
FT   gene            complement(57906..59081)
FT                   /gene="virB10"
FT                   /locus_tag="BMI_II62"
FT   CDS_pept        complement(57906..59081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="BMI_II62"
FT                   /product="type IV secretion system protein VirB10"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II62"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49203"
FT                   /db_xref="GOA:C7LGR5"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGR5"
FT                   /protein_id="ACU49203.1"
FT                   /translation="MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVV
FT                   LLLLLVFHMRGNAENNHHSDKTMVQTSTVPMRTFKLPPPPPPAPPAPPEPPAPPPAPAM
FT                   PIAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTTNAR
FT                   IQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDST
FT                   VPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVI
FT                   DLDSPGADPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNT
FT                   GGGESTSNLASTALKDTINIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK"
FT   gene            complement(59078..59947)
FT                   /gene="virB9"
FT                   /locus_tag="BMI_II63"
FT   CDS_pept        complement(59078..59947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB9"
FT                   /locus_tag="BMI_II63"
FT                   /product="type IV secretion system protein VirB9"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II63"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49204"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGR6"
FT                   /protein_id="ACU49204.1"
FT                   /translation="MKRFLLACILITLASPSWATKIPSGSKYDSRIQYVDYNSGDVVLV
FT                   RALPGVGARIVFAPGENIEDVASGFTQGWEFKASHNILYLKARSMTLSHSNQSIDMAPE
FT                   PGKWDTNLMVTTDQRMYDFDLRLMPGRNNQRVAYRVQFRYPAAAAAAAVAAAQKRVVQA
FT                   RMNARPSPVNWNYTMQVGTNSASIAPTLAYDDGRFTYLRFPNNRDFPAAFLVAEDKSES
FT                   IVNSHIDPSAPDILVLHRVAKQMVLRLGNKVIGIYNESFNPDGVPARDGTTVPGVKRVI
FT                   KSPGENLQ"
FT   gene            complement(59944..60663)
FT                   /gene="virB8"
FT                   /locus_tag="BMI_II64"
FT   CDS_pept        complement(59944..60663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB8"
FT                   /locus_tag="BMI_II64"
FT                   /product="type IV secretion system protein VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II64"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49205"
FT                   /db_xref="GOA:C7LGR7"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGR7"
FT                   /protein_id="ACU49205.1"
FT                   /translation="MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAW
FT                   KIAGAFGTITVLLGIGIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDK
FT                   YWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVRTSV
FT                   TIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARLTNPL
FT                   GFNVTSYRVDPEMGVVQ"
FT   gene            complement(60666..60839)
FT                   /gene="virB7"
FT                   /locus_tag="BMI_II65"
FT   CDS_pept        complement(60666..60839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB7"
FT                   /locus_tag="BMI_II65"
FT                   /product="type IV secretion system protein VirB7"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II65"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49206"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGR8"
FT                   /protein_id="ACU49206.1"
FT                   /translation="MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPP
FT                   LAQPNPVDTYED"
FT   gene            complement(61003..62046)
FT                   /gene="virB6"
FT                   /locus_tag="BMI_II66"
FT   CDS_pept        complement(61003..62046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB6"
FT                   /locus_tag="BMI_II66"
FT                   /product="type IV secretion system protein VirB6"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II66"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49207"
FT                   /db_xref="GOA:C7LGR9"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGR9"
FT                   /protein_id="ACU49207.1"
FT                   /translation="MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLYY
FT                   TAMGILMSVGRIEGPFSQLVISCIKFMLIAAFALNISTYSEWVIDTVHNMESGFADAFA
FT                   GNHGTPSSTIYQTLDNSLGKGWNIAAMLFEKGDNRGLTQIVQGFSELLLSFLVAGSTLI
FT                   LAGPTGAMIVATNAVIAILLGIGPLFILALGWAPTRGFFDRWFGAIVTSILQVALLSAV
FT                   LSISSAIFSRMVAAINLASATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGSSISAA
FT                   TISLGSLAVNTATSGGGAMTSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSPAYRQHV
FT                   LGQFNRD"
FT   gene            complement(62230..62946)
FT                   /gene="virB5"
FT                   /locus_tag="BMI_II67"
FT   CDS_pept        complement(62230..62946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB5"
FT                   /locus_tag="BMI_II67"
FT                   /product="type IV secretion system protein VirB5"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II67"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49208"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGS0"
FT                   /protein_id="ACU49208.1"
FT                   /translation="MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFA
FT                   QQIEQLKQQFEQQKMQFNALTGNRGLGDILRDPTLRSYLPYNWRDLYEAVMSGGYLAAA
FT                   GETANLLRKSQVYDPCASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEIESL
FT                   MQEINKTGDPKAIAELQGRIESENAMIQNEDTRLHLYQQMAKAQDKLLDERQHELDAKD
FT                   NARRGYPQPKALEAAY"
FT   gene            complement(62951..65446)
FT                   /gene="virB4"
FT                   /locus_tag="BMI_II68"
FT   CDS_pept        complement(62951..65446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB4"
FT                   /locus_tag="BMI_II68"
FT                   /product="type IV secretion system protein VirB4"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II68"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49209"
FT                   /db_xref="GOA:C7LGS1"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGS1"
FT                   /protein_id="ACU49209.1"
FT                   /translation="MGAQSKYAQQLNNERSLAPFIPFRSQVGPTTVITRDGDFVRTWRI
FT                   AGLAFETQDKEELLIRKDQLNTLFRAIASNNVALWSHNVRRRTWDHLKSFFSNPFCDAL
FT                   DKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLFNVAVHRSHAEILQEQQLAIRKLDE
FT                   IGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALCSQQLEFYNFLLSGEWQKVRVPSCPL
FT                   DEYLGTGWVYAGTETIEIRTANATRYARGIDFKDYASHTEPGILNGLMYSDYEYVITQS
FT                   FSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDIAIDQLGRGDFVMGEYHYSLLVFA
FT                   EDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYAQLPCNWQYRPRVAGLTSLNFAG
FT                   LSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHYSKGDEDNFDKKLLGNTRIIGQ
FT                   SGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAKGTILAIGGKYLAIRNGEPTG
FT                   FNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRISHAIRTVMRMRPELRRLSTV
FT                   LQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVLDCPQDQIDFNTHSNYGFDG
FT                   TDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKWVDDEAFSEFANNKQLTIRK
FT                   QNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADYHEYTDGFKVTNEEFDIIR
FT                   SMSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNNELLDQVIAEVGDDPSVWL
FT                   PVFQERRKARIASSKSTGR"
FT   gene            complement(65446..65796)
FT                   /gene="virB3"
FT                   /locus_tag="BMI_II69"
FT   CDS_pept        complement(65446..65796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB3"
FT                   /locus_tag="BMI_II69"
FT                   /product="type IV secretion system protein VirB3"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II69"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49210"
FT                   /db_xref="GOA:C7LGS2"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGS2"
FT                   /protein_id="ACU49210.1"
FT                   /translation="MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSI
FT                   VLLSVWISMFILPLIVPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAY
FT                   SPIAFTKRKRES"
FT   gene            complement(65810..66127)
FT                   /gene="virB2"
FT                   /locus_tag="BMI_II70"
FT   CDS_pept        complement(65810..66127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB2"
FT                   /locus_tag="BMI_II70"
FT                   /product="type IV secretion system protein VirB2"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II70"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49211"
FT                   /db_xref="GOA:C7LGS3"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGS3"
FT                   /protein_id="ACU49211.1"
FT                   /translation="MKTASPSKKSLSRILPHLLLALIVSIAAIEPNLAHANGGLDKVNT
FT                   SMQKVLDLLSGVSITVVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAAAEIASYLL
FT                   R"
FT   gene            complement(66563..67279)
FT                   /gene="virB1"
FT                   /locus_tag="BMI_II71"
FT   CDS_pept        complement(66563..67279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB1"
FT                   /locus_tag="BMI_II71"
FT                   /product="type IV secretion system protein VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II71"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49212"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGS4"
FT                   /protein_id="ACU49212.1"
FT                   /translation="MVPFLVLAQQCAPTVAPQTMAAIVQVESGFNPYAIGVVGGRLVRQ
FT                   PVSLDEAITTAQSLEAKGWNFSLGIAQVNRYNLPKYGSTYAQAFDPCKNLKMGSKILED
FT                   CYRRAIVKMPGQEQGALRAAFSCYYAGNFTGGFKTKPGSPSYVQKVVASADVTTKPIAV
FT                   VPMIRKTPDAAAAVAAPVKKRQPADRNSVLVDLHPSSQSMPATGAANAPVRLKTEQPAT
FT                   TDAPPGKDNTDGVVVF"
FT   gene            complement(67783..69021)
FT                   /locus_tag="BMI_II72"
FT   CDS_pept        complement(67783..69021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II72"
FT                   /product="membrane-bound lytic murein transglycosylase B"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II72"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49213"
FT                   /db_xref="GOA:C7LGS5"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGS5"
FT                   /protein_id="ACU49213.1"
FT                   /translation="MLRFPFTPEKKLRIKIAATVALAIIGASLSAGTALADAGFRQWIA
FT                   NFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAV
FT                   GQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYA
FT                   DARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGK
FT                   RDIWNSVPDALGTAANLLHRNGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRA
FT                   NGRAFPDPHEKATLKVPDGHQGPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGGYQG
FT                   LRQDWNRPFTPISMNERLELQTHLKALGYYDGNIDGKIGATSRAAIEAFQQRNGLEPDG
FT                   HPSKEVLSVLRRR"
FT   gene            69433..70326
FT                   /gene="galU"
FT                   /locus_tag="BMI_II73"
FT   CDS_pept        69433..70326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="BMI_II73"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II73"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49214"
FT                   /db_xref="GOA:C7LGS6"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGS6"
FT                   /protein_id="ACU49214.1"
FT                   /translation="MSSIRKIRKAVFPVAGLGTRFLPATKSIPKEMLTVVDKPVIQYVV
FT                   DEAREAGIEHLIFVTGRNKAVIEDYFDAQVELYSTLAERGKTEELNRLQDLQPQPGTTS
FT                   FTRQQVPLGLGHAVWCARELVGNEPFALLLPDMVMQSKKGCLAEMVELYEQTGGNIIAV
FT                   QECDPEEAHKYGIVGKGGAVGNGFEITRMVEKPAKGTAPSNLYINGRYILQPEIFGLLS
FT                   KQEKGAGNEIQLTDAMLKLADQQKFYGFDYRGLTFDCGSKAGFIEANVAFALWREDIRP
FT                   SVEGSIGHLLKTIQPA"
FT   gene            complement(70379..71917)
FT                   /locus_tag="BMI_II74"
FT   CDS_pept        complement(70379..71917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II74"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II74"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49215"
FT                   /db_xref="InterPro:IPR018759"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGS7"
FT                   /protein_id="ACU49215.1"
FT                   /translation="MFIACAPIGGLAPLARRLRCLLLAGVALALPHFAYAQDADLRGSI
FT                   SDDIAAAATDADDAGAGADGFYSPEQDNASSGKGDLSQETPAADPVSEDSTFLLDNIRV
FT                   GAVLPDDDTVRAQRENLRARPGQGRSFTPEADPYAPIGIRAGSFILKPSLEQGIKATSN
FT                   GDNSSNGSRAILNETTLRLNALSDWLQHQASLDASGTFSKSISGQDVSEPQANILGRLR
FT                   LDLANQTTVNAETSYRLRRESASSPNGVVDALKRPLVHTFAGRLGVERDTGLLFGRVTG
FT                   GLEHDMYGNAELASGGTVTQKDRNNTYASVAIRGGFSLSPALKPFAEVELGKRMFDERI
FT                   DSNGYERSGRQYALRGGLIFDRGEKFNGEIAAGYMQADSDDPRLANISGPSINAMVNWS
FT                   PLRGTDMRFFARTMVDTSTTPGVAGSLQHFASLDVTRRVRANLSFNGKLDANIRQNKDG
FT                   TGTDYTLGAEIGATYWLNRMVAIDARLRHEFQTSQVADREYQSNSIYVGMKFQK"
FT   gene            72058..73059
FT                   /locus_tag="BMI_II75"
FT   CDS_pept        72058..73059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II75"
FT                   /product="sugar isomerase, KpsF/GutQ"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II75"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49216"
FT                   /db_xref="GOA:C7LGS8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGS8"
FT                   /protein_id="ACU49216.1"
FT                   /translation="MEKLDITQKLADAEAAITSALRTIKTENAGLVALEEALNNGLSGP
FT                   FVEAVERIVASRGRLVVTGVGKSGHIGSKLAATFASTGTSAFFVHSGEANHGDLGMIGL
FT                   EDVILAISWSGETVELKGIVNYSQRFRIPLIAITSRQDSALGRAADVVLLLPKATEACP
FT                   HGLAPTTSTMMQLAIGDALAIALLEARGFTPSDFKTFHPGGSLGASLIHIRDIMHRGNR
FT                   LPLVKTGTPMPDAMKVLAQKSFGCVVVTDDAGELAGIVTDGDISRNLSRNLSALAVDDI
FT                   MTRSPRTIDQNMLASAALKTINENHIGALIVVEANRPIGLVHFHDLLRIGAA"
FT   gene            complement(73198..73665)
FT                   /locus_tag="BMI_II76"
FT   CDS_pept        complement(73198..73665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II76"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II76"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49217"
FT                   /db_xref="GOA:C7LGS9"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGS9"
FT                   /protein_id="ACU49217.1"
FT                   /translation="MIPEFLFQLGIWNWLVFGLILLILEILAPGFFFIWFGLAALVTGA
FT                   LAFLLSSTAGFGWQLQTVIFLVLAIVFTLAGRRFFGSKSNDTGEPLLNRRGEQLVGQRA
FT                   TLTEPIVNGHGRIHINDTTWRVKGPDLPAGTEIRIVAFDPVSLEIEVGLGE"
FT   gene            complement(73686..74672)
FT                   /locus_tag="BMI_II77"
FT   CDS_pept        complement(73686..74672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II77"
FT                   /product="SPFH domain/Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II77"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49218"
FT                   /db_xref="GOA:C7LGT0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGT0"
FT                   /protein_id="ACU49218.1"
FT                   /translation="MTGFDITLLILVALVLAALIASIKTVPQGYNYTIERFGRYTRTLN
FT                   PGLNLIVPFFDRVGARLNMMEQVLDVPTQEVITRDNAIVGVDAVAFYQVLNAAQAAYQV
FT                   AKLQYAILNLTMTNIRTVMGSMDLDELLSNRDAINDRLLRVVDEAAHPWGIKITRVEIK
FT                   DINPPADIVTSMARQMKAERDKRAQVLEAEGNRNAQILRAEGQKQSQILEAEGKLEAAK
FT                   REAEARERLAEAEAKATTMVSQAVANGNVQALNYFVAQKYTEALSNIASAKNQKIVLMP
FT                   LEASSLIGSLGGIGAIAREVFGDGSQPAGPAPQPPARARSVPPTGRD"
FT   gene            complement(74805..75863)
FT                   /gene="hemH"
FT                   /locus_tag="BMI_II78"
FT   CDS_pept        complement(74805..75863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="BMI_II78"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II78"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49219"
FT                   /db_xref="GOA:C7LGT1"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGT1"
FT                   /protein_id="ACU49219.1"
FT                   /translation="MSGTDKVRVNVSQTAQTPLHTSVKLPKVGVLLVNLGTPDGTSYGP
FT                   MRRYLAEFLSDRRVIEWSRLIWYPILYGIVLNTRPRRSGRLYDRIWNHENNESPLRTYT
FT                   RAQGEKLAKALSDQPNVVVDWAMRYGQPSIESITDRLLQQGCERIVIFPLYPQYSATTT
FT                   ATVNDKFFEALMKKRFMPAIRTVPSYEAEPVYIDALARSVEKHLATLSFKPEVILTSYH
FT                   GIPKSYSDKGDPYRQQCLETTRLLRERLGLGEDEMRATFQSRFGPEEWLQPYTDETVKE
FT                   LAKNGVKSVAVLNPGFVADCLETVDEIGNEAAEEFLENGGENFSHIPCLNDSEEGMKVI
FT                   ETLVRRELLGWV"
FT   gene            complement(76002..76382)
FT                   /gene="omp10"
FT                   /locus_tag="BMI_II79"
FT   CDS_pept        complement(76002..76382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp10"
FT                   /locus_tag="BMI_II79"
FT                   /product="lipoprotein Omp10"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II79"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49220"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGT2"
FT                   /protein_id="ACU49220.1"
FT                   /translation="MKRFRIVAPLALMSLALAACETTGPGSGNAPIIAHTPAGIEGSWV
FT                   DPNGIASSFNGGIFETRTTDTNEKLAEGNYLYLSPQLVEINMRSIVRGTTSKVNCALVS
FT                   PTQLNCTSSAGSRFSLTRRNAG"
FT   gene            complement(76524..77969)
FT                   /locus_tag="BMI_II80"
FT   CDS_pept        complement(76524..77969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II80"
FT                   /product="homospermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II80"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49221"
FT                   /db_xref="GOA:C7LGT3"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR023181"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGT3"
FT                   /protein_id="ACU49221.1"
FT                   /translation="MAREKWQVYGEITGPIIMIGFGSIGRGTLPLIERHFKFDQSQMVV
FT                   IDPSEKNRKILDEKNIRFIKQAITRDNYKDVLGPLLKGVKGQPFVVNLSVDTSSLDLMR
FT                   FVRECGALYIDTVVEPWLGFYFDAQADNAARTNYALRETVRSEKRKNPGGPTAVSCCGA
FT                   NPGMVSWFVKKALVDLAAELKLDFTEPAPQDRHGWAKLMKKAGVKGIHIAERDTQRARK
FT                   PKPFNTFWNTWSVEGFIAEGLQPAELGWGSHEKWKPKNARKQKKGNKAAIFLEQPGGNT
FT                   RIRTWCPTLGAQYGLLVTHNEAISIADFFTLRDKKGKLDFRLTCHYAYHPCNDAIVSLD
FT                   EMFGAGGKAQPVQHVLEENEILDGADELGVLLYGHARNAYWYGSQLTVQEARKLAPYQN
FT                   ATGLQVSSAVLAGMVWALENPQSGIVETDEMDYRRCLEVQMQYLGPVKGYYTDWTPLEG
FT                   RDGLFEEDVDRKDPWQFRNVLVR"
FT   gene            complement(78081..78761)
FT                   /locus_tag="BMI_II81"
FT   CDS_pept        complement(78081..78761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II81"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II81"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49222"
FT                   /db_xref="GOA:C7LGT4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGT4"
FT                   /protein_id="ACU49222.1"
FT                   /translation="MSSESTVRDGSKAVTSEPDYQLIETMRWEPLAGVLRFDLHMARLE
FT                   NSARELNFACNMDVIRQKIAESGTGDQALKLRLTLAPDGVATVAALPYEALPQQTVWRI
FT                   AIARTRLDHTDPLLRYKTTRRQAYIAAREEYSPAEVDEVILLNERGEVCEGTITSIFLD
FT                   IGGTACTTPALSCGLLDGVMRRELLDKGVASEEVVSVDMLKSDRNILVGNSLRGMIRAK
FT                   LIES"
FT   gene            complement(78695..79864)
FT                   /locus_tag="BMI_II82"
FT   CDS_pept        complement(78695..79864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II82"
FT                   /product="para-aminobenzoate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II82"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49223"
FT                   /db_xref="GOA:C7LGT5"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGT5"
FT                   /protein_id="ACU49223.1"
FT                   /translation="MTRPGNKPLILFRDDKAGRDVLFAAPSRIIRADTPDEFEPAWEAM
FT                   QRAHEAGEWLAGYLSYEAGYLLEPKLRPLLPEGRKTPLLCFGVFDGPSDEQLHVRDSEN
FT                   ATYLRNPVAQWSFEDYAPRFERLHRHLREGDCYQGNLTFPVTAQWGGDPLILFNMLAKR
FT                   QPVRYATYCDLGGPVVLSRSPELFFKVDGDGWIETHPMKGTMPRGATPEEDERNRQFLL
FT                   NDPKNQAENRMIVDLLRNDISLVSEVGSLDVPELFRVESYPTVHQMISRMRARLKSGLH
FT                   LRAVFAALFPCGSITGAPKISAMKILRRLETGPRDIYCGSLGWIEPGGRMRFNVAIRTI
FT                   SLLGGNRAIFNVGGGVVFDSTAQAEYEECLLKARFATGQKPLPANRIIS"
FT   gene            complement(79874..81736)
FT                   /gene="pepF"
FT                   /locus_tag="BMI_II83"
FT   CDS_pept        complement(79874..81736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="BMI_II83"
FT                   /product="oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II83"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49224"
FT                   /db_xref="GOA:C7LGT6"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGT6"
FT                   /protein_id="ACU49224.1"
FT                   /translation="MKFMVYRFSSDAILRAPAADAIAAKKHDLGNLPEWNLADLYPAPD
FT                   SPQLASDLEKAMQDSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYA
FT                   GLYYYGDTTDPKRMKLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHY
FT                   RPWLTDLRMDKPYQLDDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPT
FT                   LNMLQDADGAVRKQASEALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHL
FT                   SNRVEREVVDALAKAVEDAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPW
FT                   DEARETVLSAYGNFAPEMADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLN
FT                   YMGKPRDVMTLAHELGHGVHQVLAGSQGALMASTPLTLAETASVFGEMLTFRLLLERTR
FT                   DKRERKAMLAQKAEDMINTVVRQIAFYQFERRVHTERRAGELTSERIGEIWMDVQRESL
FT                   GDAVRLNPGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQNSEKGFQQKYFEML
FT                   KAGGTKHHKELLAPFGLDASDPGFWNKGLSVIEGIIDELEAMED"
FT   gene            82084..83574
FT                   /locus_tag="BMI_II84"
FT   CDS_pept        82084..83574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II84"
FT                   /product="sigma-54 dependent DNA-binding response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II84"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49225"
FT                   /db_xref="GOA:C7LGT7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGT7"
FT                   /protein_id="ACU49225.1"
FT                   /translation="MATRILIADDDPIQRRNLEAIVMRMGYRTILADGGVSALGFISQR
FT                   KDIVLVLLDLTMPDMDGLTVLSRMRAAGVAVPVIVLVHSDDMHRVAQAIRLGAADFMIK
FT                   PVIFERVQVSVANVLKLDALTHEIQRARSSPRVHLSLSEMVAKSPEMERVMVLARRAAA
FT                   LDAPLLVEGETGSGRQTLARAICGGGSRWRGPFVSLDCRGLTMENADDILFGTAKFCPD
FT                   DPIVSAGKLAEADGGVLFLDEVGALPHHTQLRLFTAMQSGQYESNGSRVTSNARIMTSS
FT                   SQPLVDFVHMGRFHAGLYHLLGSFSIAMPPLRERVEDISILVHQFAVRFASEERLSHIT
FT                   GIAPHLLERLKAYQWPGNVRELKNAVYRAVLLCDKSELTVEDFAQLNLGAAGFAGAQAM
FT                   WQKPAAPLSVGRAGTAFSGIDADGEVRTLAAAEEEMIRFAIAHYDGQISEVARRLGIGR
FT                   TTLYRKLKEYGIDVASISGKGKESDLENESCSWGRAAI"
FT   gene            83914..85751
FT                   /pseudo
FT                   /locus_tag="BMI_II85"
FT                   /note="pseudogene corresponding to BRA0083 in B. suis
FT                   (hypothetical protein)"
FT   gene            complement(85817..86554)
FT                   /locus_tag="BMI_II86"
FT   CDS_pept        complement(85817..86554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II86"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II86"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49226"
FT                   /db_xref="GOA:C7LGT8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGT8"
FT                   /protein_id="ACU49226.1"
FT                   /translation="MKRPYADCIGASSICSEALRISSRGCAQPSSEPMSQKTDLLLPIM
FT                   KGQPVIPVLLIDKVEHAVPLARALARGGLPAIEITLRTAAALDAIRAVADEVPEAIVGA
FT                   GTILNAKQYEDAAKAGSRFIVSPGATKYIVAAANDSDVPLLPAAITPGEMLALREEGYT
FT                   HLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANARTYLPLPNVLCVGGSWVAPK
FT                   ELVEAGNWNAITDLAKDAAALKA"
FT   gene            complement(86614..87225)
FT                   /locus_tag="BMI_II87"
FT   CDS_pept        complement(86614..87225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II87"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II87"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49227"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR024408"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGT9"
FT                   /protein_id="ACU49227.1"
FT                   /translation="MFDRPTIEALTTMAKEADIDPAALLAIAEVESGGRALYAVKGNME
FT                   PAIRFEGHYFDRRISGRIRDFARKNGLSAPEAGKIRNPKSQGERWLLLERAMGLSPKGA
FT                   LESTSWGLGQVMGAHWEWLGYRSVDALVAEARESVAGQVRLMLHFIEKAQLVQALRSHD
FT                   WPGFARRYNGPAFTRNNYDKRMAEAHQRWQNQIGSFKKAA"
FT   gene            87347..88273
FT                   /locus_tag="BMI_II88"
FT   CDS_pept        87347..88273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II88"
FT                   /product="rhodanese family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II88"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49228"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGU0"
FT                   /protein_id="ACU49228.1"
FT                   /translation="MDPMSNLPFTVAALYCFAPLPQYESLREPLAQLCCANGIKGTLLL
FT                   AAEGINGTVAGSAGAIEKLIAHITAIPGLGEPELKYSHASEMPFHRMKVRLKREIVTMG
FT                   VEGIDPLKSVGTYIAPKDWNALIADENTVVVDTRNDYEYAIGTFEGAIDPQTRTFREFP
FT                   EWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKGGILKYLEEVPREQS
FT                   MWNGECFVFDERVAVGHGLAESDVELCRACRRPLTPQDKLSQFFEEGVSCAGCYAERTP
FT                   EDRARYAERQKQVKLAEKRGANKHIGS"
FT   gene            88308..88514
FT                   /locus_tag="BMI_II89"
FT   CDS_pept        88308..88514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II89"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II89"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49229"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGU1"
FT                   /protein_id="ACU49229.1"
FT                   /translation="MNHTMVAPILERYEFVTEFSGRLLHGRPCIKGLTASGSRLPPSHP
FT                   SSQVEASDRVRCLSVNSAGFSGG"
FT   gene            88554..89309
FT                   /gene="modA"
FT                   /locus_tag="BMI_II90"
FT   CDS_pept        88554..89309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="BMI_II90"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdenum-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II90"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49230"
FT                   /db_xref="GOA:C7LGU2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGU2"
FT                   /protein_id="ACU49230.1"
FT                   /translation="MKKLIAAFLITIAAGAASVAQAAEKVTVFAAASMKDVIEEAARQI
FT                   KARDGTEVVASFASSSALARQIEQGAPAQIFISADLDWMDYVEKAGLIDKASRKIIAGN
FT                   ALVIAAQKDTPKGDARELLSAGRFAMGDPSNVPAGKYGKAALEKLDIWKEVEKNAVFTE
FT                   NVRVALRYVSLAEVKTAIVYASDRVAAPELVEAYRFPADSHAPILYPAALLKKNESDAA
FT                   RTFLAFLESDAGQAIIKDKGFVGAAEAAE"
FT   gene            89320..90006
FT                   /gene="modB"
FT                   /locus_tag="BMI_II91"
FT   CDS_pept        89320..90006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="BMI_II91"
FT                   /product="molybdate transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II91"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49231"
FT                   /db_xref="GOA:C7LGU3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGU3"
FT                   /protein_id="ACU49231.1"
FT                   /translation="MIMESNIWQIVLLSLRVAGIAIIIALPLAFLVGWLLARFHFPGKS
FT                   LVQAIVTMPLVLPPVVTGYLLLILFGARGPLGAPLQEWLGLSFAFRWTGAALAAGVMAF
FT                   PLLVRPIRLSIEGLDRGLEEAARTLGASRFTAFFTVILPPLLPGILAGAVLGFAKALGE
FT                   FGATITFVSNIPGETQTLSLAIYTLLQTPSGDAEAFRLIAVSATISIAAVVLSEWLQRR
FT                   LAGGVK"
FT   gene            90003..91082
FT                   /gene="modC"
FT                   /locus_tag="BMI_II92"
FT   CDS_pept        90003..91082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="BMI_II92"
FT                   /product="molybdenum ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II92"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49232"
FT                   /db_xref="GOA:C7LGU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGU4"
FT                   /protein_id="ACU49232.1"
FT                   /translation="MSGLTVSIRGRNGAFAIEAGFAAEGGVTALFGHSGAGKTTLLKMI
FT                   AGTLRPENGRIAVGDFTLFDAQKGINLPPEKRRIGYVFQDARLFAYMSVKRNLTYARWA
FT                   GHRQATRSFDEVVALLGIGHLLDRRPSTLSGGERQRVAIGRALLSDPALLLLDEPLSSL
FT                   DHARRQEILPFIERLRDESHVPIVYVSHEIDEVARLADQIVLLSAGRVTASGAAADIFP
FT                   LIDAESEGGGVLLEGIVSAYDERYKLAEIDLGGASFQLSDAGLKQTMHVRLRVRARDVS
FT                   IARKIPEAISIRNLLPVTVTGIERGEGPNAHVFLDFRGRRLGARLTRRSVDDLGLSVGD
FT                   QVVALVKAVSVDRAAIREK"
FT   gene            91152..91829
FT                   /locus_tag="BMI_II93"
FT   CDS_pept        91152..91829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II93"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II93"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49233"
FT                   /db_xref="GOA:C7LGU5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGU5"
FT                   /protein_id="ACU49233.1"
FT                   /translation="MTDLQNWTPRPKPERKIFEGRYVRLEPLNAQKHGDELFAASSVED
FT                   AEQRFTWLFETPPATRAEFEPWLDKASKSDDPLFFAVIDKASGKVAGRQALMRIDPANG
FT                   VIEIGSIYWGPLISRRPAATEAQFLFMQYVFDVLGYRRYEWKCHNENGPSRRAAERFGF
FT                   RFEGIFRQHMVVKGRNRDTAWFSVLDSEWPALKQAYQAWLAPENFDSAGQQKKTLQEFR
FT                   DLG"
FT   gene            91816..92025
FT                   /locus_tag="BMI_II94"
FT   CDS_pept        91816..92025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II94"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II94"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49234"
FT                   /db_xref="GOA:C7LGU6"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGU6"
FT                   /protein_id="ACU49234.1"
FT                   /translation="MILAERKESNPAIAAAIILIGFGVLAYFVPSIMLVLSKHSQIAAI
FT                   IFPIVFLLGFFAIFWLRSKGQNKN"
FT   gene            complement(92097..92827)
FT                   /pseudo
FT                   /locus_tag="BMI_II95"
FT                   /note="pseudogene corresponding to Meso_1225 in
FT                   Mesorhizobium sp. BNC1, hypothetical protein"
FT   gene            complement(92969..94072)
FT                   /locus_tag="BMI_II96"
FT   CDS_pept        complement(92969..94072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II96"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II96"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49235"
FT                   /db_xref="GOA:C7LGU7"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGU7"
FT                   /protein_id="ACU49235.1"
FT                   /translation="MRRTAGFMITLCLTMIVAQAYAQSSLGIGANEVAMKPTGPFAHII
FT                   LWMNEQQRSFYLAMTTALKAMREDPLQAAWGLVGLSFIYGIFHAVGPGHGKAVISSYMI
FT                   ANETALRRGIFLSFISSLLQAIMAVAVVGLAWLVLRGTGISMNQTAHYMEIASFALVLF
FT                   FGLWLLVRKLPQLFRKRDHAGAGPASPLFAAAPQPAIVSGPAWQGSISQATRTAATSST
FT                   VKLNYKPATAATDHIFIGEGDVCAACGNAHIVDPSTLGDDFNWKTAWSAIFSVGLRPCS
FT                   GALIVLTFALLNGLMVGGLLSVFAMALGTFITVAVLATLAVTAKNTALRFAGSKAMSGR
FT                   LKAAIEVCAALFITLTGALLLSAALVK"
FT   gene            complement(94072..94776)
FT                   /locus_tag="BMI_II97"
FT   CDS_pept        complement(94072..94776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II97"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II97"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49236"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="InterPro:IPR016537"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGU8"
FT                   /protein_id="ACU49236.1"
FT                   /translation="MKFSMLVSLWPRRSFVRSAAIALLAGCLPTLAHAHPHVFAEARLE
FT                   LTIAPDGTVQQLAHVWRFDDVFSSTVLMEFDKKGDLQLDHKELVDLAHVINSSIAEFKY
FT                   FQSVLADGKDVKMARPTDLAAAFTDNRLLIVFTSKPEKPLKLAPGHKVSFGVYDPTFYT
FT                   AIDYVKDSDLVVKGLPAGCTSKVIRPDPDEAIAQNQATLTDAFFNDPTGTDMSKIFATR
FT                   LEIDCAAKGKTG"
FT   gene            complement(94816..95709)
FT                   /locus_tag="BMI_II98"
FT   CDS_pept        complement(94816..95709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II98"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II98"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49237"
FT                   /db_xref="GOA:C7LGU9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGU9"
FT                   /protein_id="ACU49237.1"
FT                   /translation="MDTLTRMRAFIDVVEAEGFSAAARKIGRSKALLSKYVRELEDELG
FT                   ARLLNRTTRQFSLTEAGHTYYHRALEIIREIDALQDAVSETSSDARGRIKLSAPRTFAD
FT                   AVIGQSLIDFCLAHPEIVLDVRLDDRFVDLVEEGFDLAIRITRLQDSSLIAKRLSPFHS
FT                   VLCGAPELIARVGKPQRPEDLTDRPCIVDTNARARNNWHFRNMDGSMMTVPVSGPIEIN
FT                   SPVATKNAALAGLGFCMLPAFIAEDEIEQGKLITCLDEFIVRDGGIYAVYPHRRYLPAK
FT                   IRALVDFMTQWFKERE"
FT   gene            complement(95713..96918)
FT                   /locus_tag="BMI_II99"
FT   CDS_pept        complement(95713..96918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II99"
FT                   /product="amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II99"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49238"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGV0"
FT                   /protein_id="ACU49238.1"
FT                   /translation="MANLDPFNALIAKPEKPLAHAASGPLAGERLAVKDIYDIAGMVTG
FT                   CGNPQILAESPVARKSAPVVEKLLAAGAEFIGKAQTDEVAFSMMGQNSHYPYPINPAAP
FT                   DRVTGGSSSGSAAAVAGKLADIALGSDTGGSIRTPASFCGLIGLRSTHGRIPLEGIMPL
FT                   APSLDTIGWFARDIALYEKVGAVLLGDDAQEFKLTQLLYMPVLEQLLLGQAETDAYRAM
FT                   FAKVRPHFATLKAASQPTLSIDELYLAFRQIQGAEAWENHGAWISSGNRQLGPGIADRF
FT                   AYGAEMTADMVKNQRARRARFAEEFEAIIGESAVLALPTVPGAAPLTGEPFEALQAYRE
FT                   QALRLLCLSGLSGLPQITLPLGSLRPGGTMHDAPFGISFIGPRGSDRTLIALAQTIISE
FT                   RS"
FT   gene            97502..98635
FT                   /locus_tag="BMI_II100"
FT   CDS_pept        97502..98635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II100"
FT                   /product="decarboxylase, ornithine/DAP/arginine
FT                   decarboxylase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49239"
FT                   /db_xref="GOA:C7LGV1"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGV1"
FT                   /protein_id="ACU49239.1"
FT                   /translation="MATQRIIDFLNTRRPEGPCLVVDTDVVRENYQGFEKALPYSRIFY
FT                   AVKANPAPEILRLLASLGSSFDTASVAEIEMALEAGATPDRISYGNTIKKERDIARAFD
FT                   LGIRLYAVDCVEEVEKIARVAPGSRVFCRVLTDGEGAEWPLSRKFGCVPAMAKDVLRRA
FT                   KALGLDAYGVSFHVGSQQTDLTAWDRALADAAAVFRTLADEGIILRMVNMGGGFPTRYL
FT                   KDVPTAQAYGMAIFDALSRHFGNRIPETIIEPGRGMVGNAGVIKTEVVLVSRKADNDNV
FT                   RWVYLDIGKFGGLAETMDEAIRYQIVTPHDGSETEPCVLAGPTCDSADVLYEKTPYPLP
FT                   VSLTIGDEILIEGTGAYTTTYSAVAFNGFEPLRSYVI"
FT   gene            complement(98711..100429)
FT                   /locus_tag="BMI_II101"
FT   CDS_pept        complement(98711..100429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II101"
FT                   /product="polysaccharide accessory transport protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II101"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49240"
FT                   /db_xref="GOA:C7LGV2"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGV2"
FT                   /protein_id="ACU49240.1"
FT                   /translation="MDGEDKRKSGSEGKPLLAFSDSPVSDSKKSRSTEDQASPTPPWTP
FT                   PASPRERAQYYRSHQSASSALTDEEIAELREIGRDAASSEDKASPSDKEQPASDADENW
FT                   PRRSNAAQDAEWKPLIDPRIAIDVIRGSRRLLLATTIFGGIVATLYALSLPQTYIASTD
FT                   ILVDPRNIKVVGTELTPGQLPTDASLAVAESQARMIDSSSVLLKVINKAHLIQDPEFNG
FT                   TLVPTGIVGFFAQLKDLIGKKEQSDSQTMETRVLDNLRKSLTIHRDAKTFIYSISVTTR
FT                   EANKSASLANEISSVFQDELASLQSDAARRTSEELFQRLADLRASVEGAEKAVADFRAT
FT                   HDLIDVDGRLISNNELGRLNEQLTNQRAETVRLQARINVLKDATPDSVVAGTLPEGLRS
FT                   NTLTALRAQYAQARQAANGMATRLGPRHPQLIQLNSQANAVLNDISAELQRVRSSLQVE
FT                   VQRSQQQETALSARLAQLKARQANDAKDLVKLRELEREAAARRSIYEAFLLRSRETSEQ
FT                   EGLNTVNIRVLSAARPPLEPAGSTRKLIVIAGLIAGFLAGLAITIIRNFGRLLRL"
FT   gene            complement(100446..100583)
FT                   /locus_tag="BMI_II102"
FT   CDS_pept        complement(100446..100583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II102"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49241"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGV3"
FT                   /protein_id="ACU49241.1"
FT                   /translation="MISGASSIFEAEAHWNIWQVSLYSTAYFNHLFSIKKYSHASSWYS
FT                   "
FT   gene            complement(100555..101457)
FT                   /locus_tag="BMI_II103"
FT   CDS_pept        complement(100555..101457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II103"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49242"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGV4"
FT                   /protein_id="ACU49242.1"
FT                   /translation="MARRQNMAEGRSPVKTAIVTASWDQDFERCKLLCETVDKYTTGFT
FT                   KHYILVESKDVALFRQLESSRRIIIDERDLLPSWLHAFWDPTHLWRRRIWLSLKTKPLR
FT                   GWHVQQLRRIALAGAMEEDGFLYMDSDMAFLRPFDCSTLWHGEKLRLFVRPNALANPKW
FT                   PEHPVWAANAAKLLGIQNGKSGLNDYIGQLVSWRRDSVISMCERIEAHTGQHWVAALGK
FT                   IRRFSECILYGRYVDDILKGVGHFHDTGDLCRVYWFSPPPTEDEFRAFIAGLEPHQVAI
FT                   GMQSFIGLSVDDIRRVINI"
FT   gene            complement(101415..102176)
FT                   /locus_tag="BMI_II104"
FT   CDS_pept        complement(101415..102176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II104"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II104"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49243"
FT                   /db_xref="GOA:C7LGV5"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGV5"
FT                   /protein_id="ACU49243.1"
FT                   /translation="MDMSDDKVSYRNILGTRVACFTWDSAFAFFEKRIESRSFMKQSWL
FT                   NAHNANIAYENPVFRKALEDFLILPDGIGVDIASKVFYGERFPANLNGTDFVPGLLQHM
FT                   KRPLKIGLLGGLPGVAANAAQLFKKQVSRHDYRVISDGYFKPANLDAILARLKDFHPDI
FT                   LLVAMGVPRQEFFIDAHITGEHCTIASGVGALFDLHTGRVQRAPQWMRKLRMEWVYRLL
FT                   QEPQRLAKRYLLGNPAFLWRVAKTWLKGDHR"
FT   gene            complement(102177..103331)
FT                   /locus_tag="BMI_II105"
FT   CDS_pept        complement(102177..103331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II105"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49244"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGV6"
FT                   /protein_id="ACU49244.1"
FT                   /translation="MPHAIAATGYEVANAAVIDGLRRAGADVTVLGFTWPGHRAAEDPD
FT                   TIVLGEVEVRTENAGLKRKVCWVLKSFLTGLTVSSAKLRVIPEQKLRETIRQLGEFDAY
FT                   VLNGVTLAGAFVDVFKDKPCLFVAHNVEHRSAEENAQNAGGIQKFLFQREAGILKGLET
FT                   RLCQQASFVFTFAQDDGPALGLDQDHFATLPLVTPGGMQIAQDRPVEYDLALIGTWTWH
FT                   PNRIGLEWFLHEVKPLLPQDISIAIAGSTPADLIEAWPGVNFVGKVPDATAFVEAGALI
FT                   PLISRAGTGVQLKTIETFELGMPSVATSHSVRGISQVPANCTIANNPSDFAAAVIKQLE
FT                   KIRTGDRQKLDGKIFTRSQIKGMDQAIARGLAALRRRLGNTDCI"
FT   gene            103325..103453
FT                   /locus_tag="BMI_II106"
FT   CDS_pept        103325..103453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II106"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49245"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGV7"
FT                   /protein_id="ACU49245.1"
FT                   /translation="MAQEMLQKGDETIAIQPLKGLIGYKAGVFYSHEMNVSLNVYQ"
FT   gene            103503..104495
FT                   /locus_tag="BMI_II107"
FT   CDS_pept        103503..104495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II107"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II107"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49246"
FT                   /db_xref="GOA:C7LGV8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGV8"
FT                   /protein_id="ACU49246.1"
FT                   /translation="MSALPDHIEVISKTSDLRFEDIDIVVTLPTFRRPDHLIRTLDTLK
FT                   AQKTEKRFAVIVIENEAEKREGAEVAAPLFADGTYRGMLIVESHRGNCNAYNAGWLTAM
FT                   TCFPNFKYILVIDDDELADPMWIENMVSAAGRFDASLVGGPQYPVFEKPNSQQWAKHPV
FT                   FMPPYTKTGAVPIIYSSGNLLIARPVLEAIGYPFLDLMFNFTGGGDSDFVGRSKAKGFR
FT                   IAWCAEGIVRETIPARRLEGDWIRARGLRNGVLSTLTEQRRRKDEPCGQIRVFLKSLAL
FT                   LAYSPIKALRRGLAAGFAPAGMYFIYVGLGRVLAHFGYLNEQYRNPDKN"
FT   gene            104464..105789
FT                   /locus_tag="BMI_II108"
FT   CDS_pept        104464..105789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II108"
FT                   /product="exopolysaccharide production protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II108"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49247"
FT                   /db_xref="GOA:C7LGV9"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGV9"
FT                   /protein_id="ACU49247.1"
FT                   /translation="MSNIVTRTRTDARMPDATGPQARIRRIALVIASVIFGVLLISFRP
FT                   FTPAGGAETETGGDIINQLGFSCVGAVALASMAMFANLRKLAGIIRPGWLVMLVFLFAS
FT                   IFASSDPATAVRGVLLTTVGIVAIIAVLVLPQDGDGYSALLVSVASVVIVISYAGVVLL
FT                   PSLGTHGADAIEPQNSFLWRGVFSHKNIAGPVMAVFAFAGLYLWRRGWKTSGLLIGLSA
FT                   LGFVSQTGSKTTMALVPFAMLLVVLPGLMGLRKLTAGLIFAIQLAFATFTFGVVLFEPI
FT                   RRLVENMDVDATFTGRVSIWKFALEALSKRPWTGYGYESFWSSAYARHAARPYYLDWDV
FT                   RGIVHGHNSYLDVAMTMGIPALLCAIAVIIVMPLVHYARCRPVRENMLLADFFLMIVLF
FT                   GTLNAMMESFFFRRMDPVWLTLILAIFGLGMTAKVVIPKRSV"
FT   gene            105803..106939
FT                   /locus_tag="BMI_II109"
FT   CDS_pept        105803..106939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II109"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II109"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49248"
FT                   /db_xref="GOA:C7LGW0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGW0"
FT                   /protein_id="ACU49248.1"
FT                   /translation="MNIAIIGTGFVADYYMTTLRNYPELSLRGVYDRSPERLKAFVAHY
FT                   NVPAYESYEALLADPDVQIVVNLTTPESHFAVSHAALCAGKHVYSEKPLAMDFDDAKAL
FT                   LELARQSGLTLAAAPANGLSDAHKLVSSLIKTIGTPRLVYAEMEDGPVFRDKWSTWRSQ
FT                   SGAPWPGLHEFEIGCTLEHAGYALSWLVSLFGPVESVSAFSAITFPDKGPGTEHLHMAP
FT                   DFSVGCLVFKSGLVARLTSGLAMPKDRSLTVVADKGSIVVDDLWDNRSAVRLERVEEKR
FT                   RFFARLFANLERRLGKFLSWKPGVGRKIAYPKTGKYAQPSFPSQIDFMRGVADQARSIS
FT                   SGEKAFFSGDVALHITEIALALNNAGQGAAVYRMKSSF"
FT   gene            complement(106936..107985)
FT                   /locus_tag="BMI_II110"
FT   CDS_pept        complement(106936..107985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II110"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49249"
FT                   /db_xref="GOA:C7LGW1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGW1"
FT                   /protein_id="ACU49249.1"
FT                   /translation="MTQNERIGGDFRWGIWGTDMIASSFAADIAASAGMRVVAVCSHTT
FT                   QTAQAFCRHIGINKAFGNPHAFLADPEIDAVYIASPNMLHVEQALDAIMAGKACLIEKP
FT                   LSLDPEGARQIETASKARNIFAMEAMWTRFLPAVQAVKHAIDASRIGTVTHIEADLSYS
FT                   RAYDPESRFFSPALGGGAAFDLGVYPLSLALYFLGLPEKVDGHCQRAASGVDLRSEFNL
FT                   GWPSATAWISCGFDRDGENRMLIEGTDGAILIHPPFLKAQRLTFFSRSALHSPFGPKNS
FT                   KGRIGNIINRLPLPGRTIETHAFAGNGLQFQAQAVRDAIRRGEISTPIMPLAQSAAVAD
FT                   IISRVLVSG"
FT   gene            108302..109711
FT                   /gene="gnd"
FT                   /locus_tag="BMI_II111"
FT   CDS_pept        108302..109711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="BMI_II111"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II111"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49250"
FT                   /db_xref="GOA:C7LGW2"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGW2"
FT                   /protein_id="ACU49250.1"
FT                   /translation="MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIEK
FT                   AGRLRDKIIPCPTFEELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDAGN
FT                   SDYRDTVRRLKALGPNDPTFVGMGVSGGAEGARHGPSMMVGGTEQAYERIAPILLAVAA
FT                   KYQGEPCCALVGPDGAGHFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEK
FT                   WNEGPLNSYLIEITAKVLKSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILGVPATG
FT                   IEAAVAARSLSSMKGEREEAAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIAAYAQGF
FT                   AVMEAASREHGWNIPLATTARIWRAGCIIRSQLLDDIAQAFEGNESRNLLMAPAFVPRM
FT                   ETSVKSLRQIVAQAALASLPLPALGSALSYFDSYTQALGTANLIQGQRDFFGSHGFKRI
FT                   DKEGDFHGPWG"
FT   gene            complement(109807..110868)
FT                   /locus_tag="BMI_II112"
FT   CDS_pept        complement(109807..110868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II112"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II112"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49251"
FT                   /db_xref="GOA:C7LGW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGW3"
FT                   /protein_id="ACU49251.1"
FT                   /translation="MAFLNIKNLKKSFGTNTVVHDFNLAVEKGEFVSFLGPSGCGKTTV
FT                   LRMIAGFETPDNGSIEIDGKDVVNLRPNQRNIGMVFQAYALFPNMTVAQNVSFGLRVSG
FT                   KSRSEIDATVKEMLSLIRLDHLADRYPYQMSGGQQQRVALARALATKPQVLLLDEPLSA
FT                   LDAKIRISLREEIRAIQQKLGITTVFVTHDQEEALSISDRIVVMHEGRADQIGSPFDIY
FT                   NRPASRFVASFVGTLNMLEASVSEPAQNSIDLDGRQITVQETLAHHPKGKPLTLALRPE
FT                   AVSLEARKSHDTSLEATIDDVHFLGSVIRTRVILGKNRLSFDTFNDPTHPPPQRGDKVT
FT                   VHFASHDLLVLAD"
FT   gene            complement(110874..111692)
FT                   /locus_tag="BMI_II113"
FT   CDS_pept        complement(110874..111692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II113"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II113"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49252"
FT                   /db_xref="GOA:C7LGW4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGW4"
FT                   /protein_id="ACU49252.1"
FT                   /translation="MKSKGSNLRKISAQKIGAWIAFFVGAIYFLVPLIGTFEFSLRMRR
FT                   GEYSFDAYRVVFADANFQATFTYSIVLGLLTIIFGVLLVVPTAYWVRLRLPQLRPVMEF
FT                   ITLMPLVIPAIVIVFGYLRIYNSSSWLPFTASTRATDVLLMFGYMTLSLPYMYRAVDTA
FT                   MRTIDVNTLTEAAQSLGAGWGRIMFKVIFPNVISGVMSGAFITFAIVIGEFTLASLLNR
FT                   PAFGPYLQLVGANRAYEPSALAIISFGITWLSIIMLQLVSRLNKFKTTAG"
FT   gene            complement(111689..112618)
FT                   /locus_tag="BMI_II114"
FT   CDS_pept        complement(111689..112618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II114"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II114"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49253"
FT                   /db_xref="GOA:C7LGW5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGW5"
FT                   /protein_id="ACU49253.1"
FT                   /translation="MCSGRHPLKKERMSSVAETTAPTSGVRKRQLPLSWLGVAPFFLFA
FT                   ILFLIWPTMYLIIGAFQDPAGNFTLQNIHDLFQPQIMSAYWISIKVSFASAVGGAIIGF
FT                   FLAWAVVLGNLPSWLRPTVLTFSGVASNFAGVPLAFAFLATLGRTGFVTILLREWFGFN
FT                   LYSTGFNLLSFFGLTLTYLFFQIPLMVLILTPALDGLKKEWREASSILGATHMQYWRMV
FT                   AFPILWPSLLGTTLLLFANAFGAIATAYALTGSSLNIVPILLYAQIRGDVLHNQNLGYA
FT                   LALGMIVITGVSNLLYIWLRIRAERWHR"
FT   gene            complement(112791..113894)
FT                   /locus_tag="BMI_II115"
FT   CDS_pept        complement(112791..113894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II115"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II115"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49254"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGW6"
FT                   /protein_id="ACU49254.1"
FT                   /translation="MLSYTARLLSLSTAIAVAGVSIATAEPSAELIAAAKAEGELTTIA
FT                   LPHDWCGYGDIIKSFKDKYGIKVNELNPDAGSGDEVEAIKANKNNKGPQAPDVIDVGFA
FT                   FGTSAKKDGLTQAYKVSTWDEIPDSAKDPEGHWYGDYYGVLAFEVNKDIVKDAPQDWED
FT                   LLKSDYANAVALAGDPRVSAQAILGVHAAGIARGAEPGEAAGKKGLEFYKELNANGNFV
FT                   PVIGKAASLAQGSTPIVIRWDYNSLADRDTLNGNPEVETIIPKSGVIAGVYVQAISAYA
FT                   PHPNAAKLWMEHIYSDEGQLGYLKGYCHPIRFNAMAKAGKIPQELLDKLPPAAAYEKAI
FT                   FPTIEQIEAAQATITKDWDSVVGANVQ"
FT   gene            complement(114303..115892)
FT                   /locus_tag="BMI_II116"
FT   CDS_pept        complement(114303..115892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II116"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II116"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49255"
FT                   /db_xref="GOA:C7LGW7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGW7"
FT                   /protein_id="ACU49255.1"
FT                   /translation="MAADTTIGTVGGKNPADDRIDPKKTIGFMAMVFGMFMAILDIQIV
FT                   SASLSEIQAGLGASTDEISWVQTSYLIAEVIMIPLSGFLGRLLSTRVLFTISAAGFTLA
FT                   SMLCATATNIEQMIVYRAIQGFIGGGMIPSVFAAAFTIFPPSKRSIVSPMIGLVATLAP
FT                   TIGPTIGGYLSHAFSWHWLFLVNVGPGILVTIAAWNLIDFDEGDLSLLDKFDWWGLFGM
FT                   AAFLGSLEYVLEEGPRNDWLQDHTIFIMSIILTVGAIVFFYRVFTAEQPIVDFRAFRNM
FT                   NFAFGSLFSFVMGVGLYGLTYLYPLYLSMIRGYDALMIGEALFVSGLAMFFTAPVAGFL
FT                   SNRMDPRLMMMIGFVGFAIGTWLVTGLTADWDFNELLMPQILRGCSLMLCMVPINNLAL
FT                   GTLPPSLMKNASGLFNLTRNLGGAVGLAVINTILTRRGDMHYARLAEHVRNGNAEAENM
FT                   IANLTAKYNAAGMDGASIAIAKLSGMVRQQATLLSFIDVFFILTMMFCSLAICAMLLRK
FT                   PSPAAGGGGGGH"
FT   gene            complement(115984..117225)
FT                   /pseudo
FT                   /locus_tag="BMI_II117"
FT                   /note="HlyD family secretion protein pseudogene"
FT   gene            117326..118069
FT                   /locus_tag="BMI_II118"
FT   CDS_pept        117326..118069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II118"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II118"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49256"
FT                   /db_xref="GOA:C7LGW8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGW8"
FT                   /protein_id="ACU49256.1"
FT                   /translation="MKPARNTSRIGDISDDKKGELRSAPDKAELSASCLPETECGRTRL
FT                   AAGQDPAKRSQILEGAQSVFLRMGFDAASMNDITREAGVSKGTIYVYFNSKEDLFVALC
FT                   EHYRQTLFSSFIGQLEKGFSNRQELIDFGVALTTLITSSIAIRAQRIVVGVSERKPELA
FT                   ARFYERGPKRSHAIMAQSLQAMIDAGVLEQHDVTRTAYQLSNLFFAGLYRPRLFGALAE
FT                   APSEQAIRDNVESAVDFFFRAYGKK"
FT   gene            118344..119123
FT                   /locus_tag="BMI_II119"
FT   CDS_pept        118344..119123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II119"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II119"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49257"
FT                   /db_xref="GOA:C7LGW9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGW9"
FT                   /protein_id="ACU49257.1"
FT                   /translation="MSLDLVHFPNYKKTFFGSSFQSDTLALLTRIRDEIGCRYITHTYR
FT                   GRVGDCTKVNSADLTVLMTLPATWVARYSSKNYFAIDPVFQEDAPYYRNDTSAIARDLK
FT                   EDADICPAVAELLHDAEKHGLGNLFIAVSACNPKGVAGCTVFTFEVEDEDRTQFLARMR
FT                   PRLLSLAGIIHGTVCGCKDANSVASLLTPREVDCLRWAANGKTDGEIAEILSIARWTVV
FT                   TYLQNAKIKLNCSNRTSAVATALSLGIIDMPEVQHLV"
FT   gene            complement(119091..119620)
FT                   /pseudo
FT                   /locus_tag="BMI_II120"
FT                   /note="pseudogene corresponding to BRA0120 in B. suis
FT                   (hypothetical protein)"
FT   gene            complement(119731..120801)
FT                   /gene="flhB"
FT                   /locus_tag="BMI_II121"
FT   CDS_pept        complement(119731..120801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="BMI_II121"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II121"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49258"
FT                   /db_xref="GOA:C7LGX0"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGX0"
FT                   /protein_id="ACU49258.1"
FT                   /translation="MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFLV
FT                   IAVFVAAPAATRLAVFLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIIIPL
FT                   AGIAASAFQNAPRFVGERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASVIVF
FT                   LVFFKGNSLFTDAVATDPGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHWRQEL
FT                   RMTRQEVKDELKQSEGDPLVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRY
FT                   KPNEDAAPVVVAKGQDLIALKIREIAASHSIPVFEDVQLARALYKQVNVDQMIAPEFYK
FT                   AVAELIRIINTRRAIS"
FT   gene            complement(120818..121858)
FT                   /gene="fliG"
FT                   /locus_tag="BMI_II122"
FT   CDS_pept        complement(120818..121858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="BMI_II122"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II122"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49259"
FT                   /db_xref="GOA:C7LGX1"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGX1"
FT                   /protein_id="ACU49259.1"
FT                   /translation="MSDTEQHILAETGAAGPGNSIVDTLTGPQKAAAILVAIGRPAAAR
FT                   LLKHFNAEDLRKLAGHARTLEPISPLDFEQLVKQFEDLFAEGAPVSEAAQRFEGLLRDT
FT                   LPQEEVDAVLEDRVQPQLVQESVWIQVARLPMESLQAYLGNQHPQIIAYIVSRLPSDLA
FT                   ARLFVALPPQLRNAVVQRSLHIGNVAPAAAELLEDVLRRDLLGRSDAGPLKAHHGQIAN
FT                   IFNQLDRSEMEELMASLQDLNRIKAKLFTFEDIERLSQRARLLLFDEVQTEQIATALRE
FT                   ADPKLQELVLSSLSARGRRMVESELSAEQGNITSQNIAEARRIIARIAIDLSERGIITL
FT                   DATPET"
FT   gene            complement(121875..122195)
FT                   /gene="fliN"
FT                   /locus_tag="BMI_II123"
FT   CDS_pept        complement(121875..122195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="BMI_II123"
FT                   /product="flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II123"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49260"
FT                   /db_xref="GOA:C7LGX2"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGX2"
FT                   /protein_id="ACU49260.1"
FT                   /translation="MQQELNEAIEELREEKPRSAQKSASKPNLDLIMGIPVDVQVVLGG
FT                   TTMPVSSLMKLGRGAVITLDKQIGDPVDIVVNGRVIARGEVIVLEDDSSRFGVSLTEII
FT                   GK"
FT   gene            complement(122219..122680)
FT                   /locus_tag="BMI_II124"
FT   CDS_pept        complement(122219..122680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II124"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49261"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGX3"
FT                   /protein_id="ACU49261.1"
FT                   /translation="MSLLLANVLSTLMALASLATLIVVGRKANETIRLGKMLALRVAAA
FT                   SNGLERAVKAIRNERTDLTDASAKLDGRLAETQRVRREMDEAIEELNRLRKALSRDMRQ
FT                   ARILAETPPPRQEKTPSAAEQPLPADKNALPVFVRRAVKKATVELAGQA"
FT   gene            complement(122661..123611)
FT                   /gene="fliM"
FT                   /locus_tag="BMI_II125"
FT   CDS_pept        complement(122661..123611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="BMI_II125"
FT                   /product="flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II125"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49262"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGX4"
FT                   /protein_id="ACU49262.1"
FT                   /translation="MDDATTLEHNRKNDALAENLLRAAGLSGDDLKSLAHVFKDASSHF
FT                   CARLKQGSAAAFDAETGSVESTDKTAFNDIFDKAAIITPLKAERWGCSLYLALDAVLVF
FT                   SVIEAMFGAQGNLGPVDADRPFGMVEQKIANLLAGHLAGALDRVFNTSSSQPLFAPGDC
FT                   IDTADFDRENFELSRLFTCRIAVTAAGKTGQMHLLLPRSTHKPMQDAVAAFLRRPMDQA
FT                   DPAWAKKLRQEVSRARIELEAFMQQGSMSLDALSRLEIGQVLKLPVDAMEQVRLRAGNQ
FT                   QLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELVAG"
FT   gene            complement(123613..124485)
FT                   /gene="motA"
FT                   /locus_tag="BMI_II126"
FT   CDS_pept        complement(123613..124485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="BMI_II126"
FT                   /product="flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II126"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49263"
FT                   /db_xref="GOA:C7LGX5"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGX5"
FT                   /protein_id="ACU49263.1"
FT                   /translation="MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTF
FT                   FVANPFSLVKDTGRACMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNP
FT                   KESPIFLAYPSVLKKEDLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQ
FT                   AMITISEALPALGIVAAVLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGP
FT                   IANKIKSTREKNNRLYIVVKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETM
FT                   ASVPTQQAA"
FT   gene            124643..125419
FT                   /locus_tag="BMI_II127"
FT   CDS_pept        124643..125419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II127"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49264"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGX6"
FT                   /protein_id="ACU49264.1"
FT                   /translation="MTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFM
FT                   ADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAG
FT                   KGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKA
FT                   LLTMVQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMHEMNNPT
FT                   ASSPASIASFLLGGTSSIGISMNILATLQNFKPGGR"
FT   gene            125419..126150
FT                   /gene="flgF"
FT                   /locus_tag="BMI_II128"
FT   CDS_pept        125419..126150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="BMI_II128"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II128"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49265"
FT                   /db_xref="GOA:C7LGX7"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGX7"
FT                   /protein_id="ACU49265.1"
FT                   /translation="MQNNSIYVGLSSLITLERRMDAIAHNVANVSTVGFRGEGTKFDTI
FT                   VSDKASDDVSFATAGKSYIRTEAGPLIKTDNPLDVAVKGDAWMSFSTPQGQVYSRDGRM
FT                   KMLSTGDLVSVTGNAILDVGGAPIVLNPGGGAPRISSDGAIYQNGVQVGAIGLYTIPAD
FT                   ADLAYAGTSGVIPSKPAQPVVDDNSVGVVQGMIEGSNVDAMTEMTRLISISRAFEQVNN
FT                   LLSQQEATVSEAIKTLGSKNG"
FT   gene            126147..127508
FT                   /gene="fliI"
FT                   /locus_tag="BMI_II129"
FT   CDS_pept        126147..127508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="BMI_II129"
FT                   /product="flagellum-specific ATP synthase FliI"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II129"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49266"
FT                   /db_xref="GOA:C7LGX8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGX8"
FT                   /protein_id="ACU49266.1"
FT                   /translation="MTPDLPLTRLAAFVRQQTIAPEPLTGIGGTVSDVSRSSIAVRGLS
FT                   RDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMPSLGAAVFEEGPLRIRPA
FT                   PEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARVDRGLRTGVNVIDIFTP
FT                   LCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGREVREMLEETMAGHLGK
FT                   TITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTRFAHAAREVAIAAEE
FT                   PPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDHNDPVSDTIRGTLD
FT                   GHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMVARFEETRDLRAI
FT                   GAYQKGHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALRGDRQAQNA"
FT   gene            127592..128110
FT                   /locus_tag="BMI_II130"
FT   CDS_pept        127592..128110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49267"
FT                   /db_xref="GOA:C7LGX9"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGX9"
FT                   /protein_id="ACU49267.1"
FT                   /translation="MKKPLSKGDRYLMIAVIALAAASALLPIVTYLQRVDFNPANKAER
FT                   KIIDPLDRSEQKTVRRFPSFRPSEQVTPASEVDKTMTGSVMSNGKGLPGAGKGEGEIGD
FT                   GRGQPFPKPVFALRDVVGGMAMIEDASGYWFVEKGSLLPDGSRLVSIGRGAGTWQLTTS
FT                   SGDIIDMRR"
FT   gene            complement(128135..129112)
FT                   /locus_tag="BMI_II131"
FT   CDS_pept        complement(128135..129112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II131"
FT                   /product="PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II131"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49268"
FT                   /db_xref="GOA:C7LGY0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGY0"
FT                   /protein_id="ACU49268.1"
FT                   /translation="MKQAHGPDDNRSMWMLMGIGIVCVFGFFIQILVLSRYLDRPLALF
FT                   MASQKGTALVDIAAHITKFGKAYWFLVPAAALFVFYRFINRSPQKSFNCFFIIASIAVS
FT                   GIVIKILKIIFGRARPGVLIDDGFYGFTFFRLDREFNSFPSAHTGVAIAAGVALALIMQ
FT                   KHRWVPIILGIVIASSRIIINAHYLSDVVASSLISTVTVLLLYDILGYFGYRAGEPDRH
FT                   SPDMQGSLKLMSNVIGAPVAEHENGQRPQDGLTTRIIGVMNIAAILILIGLIFDFVLIE
FT                   WFEWQYQPAELIPGWWLPAAITLCALGVGASLYVGRAGRGCARR"
FT   gene            129100..129255
FT                   /locus_tag="BMI_II132"
FT   CDS_pept        129100..129255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II132"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49269"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGY1"
FT                   /protein_id="ACU49269.1"
FT                   /translation="MLVSFAILFHTLVVIEKWEPRPDNQIKVLFGASHGEYRASAMLVP
FT                   EFSGRF"
FT   gene            complement(129410..129628)
FT                   /locus_tag="BMI_II133"
FT   CDS_pept        complement(129410..129628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II133"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49270"
FT                   /db_xref="GOA:C7LGY2"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGY2"
FT                   /protein_id="ACU49270.1"
FT                   /translation="MSYLDFQPQLVQRRSSEPERRTTPIFAVKADEYRGPHPEFIGIIP
FT                   IFTSLFLQIMRFFCIIKMCDIRKISVY"
FT   gene            129656..130051
FT                   /locus_tag="BMI_II134"
FT   CDS_pept        129656..130051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II134"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49271"
FT                   /db_xref="GOA:C7LGY3"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGY3"
FT                   /protein_id="ACU49271.1"
FT                   /translation="MAPRAMFKRFPIFVGGSAIGAVIDYVVTLSASNYINLYPPVALAL
FT                   AMLISGSVVFFFHIRITFQYSTHKIFRQYALFMGWTCAIYFLRAAMLQICLYAGLPLAV
FT                   ALILAIGLASVINFVISSVIIFAKSPS"
FT   gene            130048..131028
FT                   /locus_tag="BMI_II135"
FT   CDS_pept        130048..131028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II135"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II135"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49272"
FT                   /db_xref="GOA:C7LGY4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGY4"
FT                   /protein_id="ACU49272.1"
FT                   /translation="MNAKTLCIIVPVYNEAEGLSDLLDRLHSAADSIASQFTLNIEFIF
FT                   IDDGSSDGSFALLKAHDFGSRPVRLLRFSRNFGKEAALSAGIDAAEGADAAILMDADLQ
FT                   HPPEMIADFVRIWQEEDADSVYAYKASRLASEGPVKAALSRAFFWVINRDQRYKIPPGA
FT                   GDFRLVNRRFMAALRSLPESDRFMKGLYGWVGFNQVGLPLQPPPRMRGTSYYNPLQLLL
FT                   MSLGAMTSFSTTPLRLMALAGIVVAGLSAAYGLYVLSEYFFFPGVPVGLTSILALTAFF
FT                   GGIQLMFLGLLGEYIGKSVLEAKKRPIYILAEDIRRKESDDADRG"
FT   gene            131012..131761
FT                   /locus_tag="BMI_II136"
FT   CDS_pept        131012..131761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II136"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49273"
FT                   /db_xref="GOA:C7LGY5"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGY5"
FT                   /protein_id="ACU49273.1"
FT                   /translation="MRIADDFGLGRGHDRVILSLLETGRLDGTSVMMNDAMNPEDIARL
FT                   RKLRAGGAKVGLHLNLTQALPGGGPIWPLGELIRPLLGAPFLGAITASLVRQVDAFVTQ
FT                   FGSLPDYYDGHQHCHCFPAIAPLVARLSYGPATWVRVPLPATWEGRWLNIRAGGAKVLL
FT                   ILALAARARAIFVRAGLKTNHDFSGFLRLGDPASVRRWLPELLARATPDCLIMLHPGDG
FT                   ADPVQCAGHAAGSRAIEARILFESPIK"
FT   gene            131758..133194
FT                   /locus_tag="BMI_II137"
FT   CDS_pept        131758..133194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II137"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II137"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49274"
FT                   /db_xref="GOA:C7LGY6"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGY6"
FT                   /protein_id="ACU49274.1"
FT                   /translation="MMKNRAIVWGLFLLLFVRLLAMIWVPLTDPTEARYAEIARKMVET
FT                   GNWITPQFDYGVPFWAKPPLHTWLSAAGIAIFGTTAFTARLGILLASLATLTILWQWAC
FT                   TLTDRRTATIAVLVAASSGLFYVSAAFVQTDMVLTLGVTASMAGFYNGLAGSRRWGWLF
FT                   FLGLAIGLLAKGPVAVVLSATPIAVWMLWRGNWRDLKHLPWAGGLTLCAVLVIPWYAAA
FT                   EIATPGFLKYFLIGEHIQRFLQPGWSGDLYGAGREHARGSIWLFWIVATLPWSPLLPVL
FT                   IWRLRKNGMPDGKGLHLYLLLFALTPLVFFTPAANILLAYVLPGVPAAALLAVILWTRT
FT                   GPAGAGWLKLGVVEVLLIFLVITIGSFFGLGRSFLPTQAPLIASYSGPGRLAILGGRSF
FT                   SAEFYTQDKIVRFQTLNELAAWLKPGDGVLVPKSAYDAFAARFGNAVKPISEDRKYLLF
FT                   IPIPAASVAKGTGAAAGAVI"
FT   gene            133438..134394
FT                   /locus_tag="BMI_II138"
FT   CDS_pept        133438..134394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II138"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II138"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49275"
FT                   /db_xref="GOA:C7LGY7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGY7"
FT                   /protein_id="ACU49275.1"
FT                   /translation="MKPMYEIIMDPNDRSYELSGSAKLYASGLITIGTTTFNTQSYART
FT                   PKIIAQGGLDFYVLQLLTGGHLLGDFDGTDVAAKPGDIVIIDMAKTLVSRAFKGSRTTV
FT                   FIPRAELEEVVGGRNLHGLVLSGTRPITRLLFSYIQELNAVVPDLSMDEAIAAQKVMLT
FT                   FLRTGITGLEEDLVGFLPVNLPMKKRILSFIDQNLSDPLLGPRTIIQNFHVSRSHLYRA
FT                   FENDGGVAKTIRDKRLDRAFRILAEERNRTVYSKEVAYRCGFNDPAQFASAFKNRFGMS
FT                   PRDVQASGATLLSLDVDGFSFPKYISQEIAKVVPPSS"
FT   gene            134656..134760
FT                   /locus_tag="BMI_II139"
FT   CDS_pept        134656..134760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II139"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49276"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGY8"
FT                   /protein_id="ACU49276.1"
FT                   /translation="MPKMGSQSQAEYRMMICAQWGIIRTIDGAFIDGH"
FT   gene            134750..135187
FT                   /locus_tag="BMI_II140"
FT   CDS_pept        134750..135187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II140"
FT                   /product="SyrB family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49277"
FT                   /db_xref="GOA:C7LGY9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGY9"
FT                   /protein_id="ACU49277.1"
FT                   /translation="MATEFEHGPDMYTPEDVIKNFKDHSSQSRSRGTKTLENEKHTANG
FT                   RMVKRYTPEERRKVFSEIATSVKSGQSSLKDALATAGISEQTYYNWKKIFTGNGPASST
FT                   TLGKDLQELIELEAENQRLRQELADKLRMENAELRRRLGKV"
FT   gene            complement(135381..136682)
FT                   /locus_tag="BMI_II141"
FT   CDS_pept        complement(135381..136682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II141"
FT                   /product="phthalate transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II141"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49278"
FT                   /db_xref="GOA:C7LGZ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGZ0"
FT                   /protein_id="ACU49278.1"
FT                   /translation="MKNSNTAITSPEVVENMTYRKVAFRIIPLLMICYIIAYLDRVNVG
FT                   FAKLQMSEELGFSEAIYGLGAGLFFIGYFFFEIPSNILLHKLGARLWIARIMITWGLLS
FT                   ALFAFVQTEWQFYILRFLLGAAEAGFYPGVILYLTYWFPSHRRGKMFALFQAGSPAAGI
FT                   FGNPLSGWIMDQFHDTAGWQGWQWMFVLEAIPAVVLGVVILLYLDNSVKAAKWLTEEEK
FT                   AIISRDIEADSKGKAASHSLMSLVKNPMLWVMTLIYFCFVMGQYGLTLWMPTLIRASGV
FT                   TSNVTIGLLGAIPFICAIIAMVIFSRSADHYRERRWHLVVPALLGAVGFVVAASATNTT
FT                   VSIIFLSMAAAGVLACAPLFWSLPTAILSGAAAAAGIALINSVANLAGFISPYMVGIIR
FT                   DATHSSELGMYVLAGFLILGAAIVLCIPASEVNR"
FT   gene            complement(136708..137340)
FT                   /locus_tag="BMI_II142"
FT   CDS_pept        complement(136708..137340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II142"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49279"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGZ1"
FT                   /protein_id="ACU49279.1"
FT                   /translation="MTEQEIRELIVELGASLFARGYCVGSAGNISVRLADGYLMTPTNS
FT                   CLGRLRADRLSKLDKGWNHIGGDRPSKEVFMHRAVLGARPQAGAVVHLHSTYATAISCL
FT                   SSPADTMPITPLTPYFVMRIGKHLPTIPYYRPGDPAMEREIHDAAQNASAMLLANHGPV
FT                   VSGNSLVDAVYAAEELEESARLSIMLQGLPARKLTDEQIEDLLHTFK"
FT   gene            complement(137366..138331)
FT                   /locus_tag="BMI_II143"
FT   CDS_pept        complement(137366..138331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II143"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49280"
FT                   /db_xref="GOA:C7LGZ2"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGZ2"
FT                   /protein_id="ACU49280.1"
FT                   /translation="MAKIVVTGGAGFLGSRLIRGLLASRGQNGVPSFDSIVSVDLVACS
FT                   IDDPRITSVTGDIADPAFARSVITKGTVGVYHMAAALSGQSEAEFDVGMRVNIDGTRAL
FT                   LEAARATQEAPKFIFTSSLAVFGGEMPDVVPENLALLPQSSYGAEKAIGEFLVGDYSRR
FT                   GFIDGRICRLPTIVVRPGKPNSAASSFASGIIREPLAGITSNNPVPPATRMWLSSPDIA
FT                   ARNLVHAITVEGSALGINRVLNLPGICVTVADMLDSLERIAGKDVRALVSAEPEQRVID
FT                   IVCSWPGEFDIARPLALGFTRDADFDAVVRQYRDEFAHSS"
FT   gene            complement(138331..139122)
FT                   /locus_tag="BMI_II144"
FT   CDS_pept        complement(138331..139122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II144"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II144"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49281"
FT                   /db_xref="GOA:C7LGZ3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGZ3"
FT                   /protein_id="ACU49281.1"
FT                   /translation="MIPAERQALIVSRLSARGILSIAELAEMLGVSPMTVRRDIHSLEE
FT                   QGRALSVAGGVQLPERIFSEPSHIVKAALYHNEKAAIGQLAAQMIRPGTVIYLDAGTTT
FT                   LEIAYRLTDRQDLTVVTNDFVIAAFLSQESNCKLFHTGGEVERENQSCVGSAAGEAIRR
FT                   FNFDLAFISTSSFGARGVSTPSENKIAVKHAVVESAVRRVLVTDSSKYGLIGTFNAIPL
FT                   DVLSAVVTDAGLPENARETITQRGVELHLVEAGTGKVEGKI"
FT   gene            complement(139119..139904)
FT                   /locus_tag="BMI_II145"
FT   CDS_pept        complement(139119..139904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II145"
FT                   /product="hydroxypyruvate isomerase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II145"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49282"
FT                   /db_xref="GOA:C7LGZ4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGZ4"
FT                   /protein_id="ACU49282.1"
FT                   /translation="MPRFAANLSTMFNEVPFLERFRLAAEAGFGGVEFLFPYDFDADVI
FT                   ARELKQHNLTQVLFNMPPSDWAAGERGMAAIPGREQEFRDNVDIALHYALALDCRTLHA
FT                   MSGITEGLDRKACEETFIENFRYAADKLAPHGITVLVEPLNTRNMPGYFIVHQLEAVGL
FT                   VKRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPDEGELNYPY
FT                   LFSVLESVGYRGWVGCEYNPRGKTESGLAWFAPYRDQSA"
FT   gene            complement(139904..141178)
FT                   /locus_tag="BMI_II146"
FT   CDS_pept        complement(139904..141178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II146"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49283"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGZ5"
FT                   /protein_id="ACU49283.1"
FT                   /translation="MRLGVIADDFTGATDIAGFLVGNGLRTIQLNGVPADDLAVDADAV
FT                   VISLKTRSCPTGQAIAESLAALKWLQKNNCQQFFFKYCSTFDSTPKGNIGPVTDALLEA
FT                   LGEEFTVICPALPVNGRTIYNGYLFVNGVLLSETGMRNHPVTPMTDSNIMRVMESQSRG
FT                   RAGNISSTIVDQGSDAVRDALRKLQSEGIRYAVLDALNDQHIETLGRAVSQMKLVTGGS
FT                   GLADGMARAWTQLRGKNVAAAEAAGAPVKGRTVILSGSCSQMTNAQVAAYKAKAPALAM
FT                   DVEKAINDAAYIDVLAEWVLAQSGDALPPLVYATMPPEALKAVQERFGGERASAAIEDL
FT                   FGQLAKRLEAEGFTRFIVAGGETSGAVTQALAIDGFTIGPQIAPGVPWVRGIGKPLSLA
FT                   LKSGNFGTEAFFFEAQKIANQEGDK"
FT   gene            complement(141180..142088)
FT                   /locus_tag="BMI_II147"
FT   CDS_pept        complement(141180..142088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II147"
FT                   /product="3-hydroxyisobutyrate dehydrogenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II147"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49284"
FT                   /db_xref="GOA:C7LGZ6"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGZ6"
FT                   /protein_id="ACU49284.1"
FT                   /translation="MIMVSSDYSVCIVGLGSMGMGVAQSCIAAGLRTYGIDLDPAKCEA
FT                   IIKAGAIGASSRCEAAGKLDALVLLVVNAAQCKAVLFGENGLAAQMKPGAAVMVSSTIS
FT                   AADAKEIAAALEAYNLLMLDAPVSGGAAKAASGDITVMASGSREAFEKLRPVLNAAAGK
FT                   VYEIGQEIGLGATVKIIHQLLAGVHIAAGAEAMALAARSGIPLDIMYDVVTHAAGNSWM
FT                   FENRMKHVVDGDYTPKSAVDIFVKDLRLVTETGLSMNFPLPLATTAYSLFANASNAGFG
FT                   KEDDAAVIKTYAGIKLPDRSA"
FT   gene            142238..142375
FT                   /locus_tag="BMI_II148"
FT   CDS_pept        142238..142375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II148"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49285"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGZ7"
FT                   /protein_id="ACU49285.1"
FT                   /translation="MQEIQTIKGSFRQLQIAACYERRLWNRAEVSLQSLCAETSIPVQA
FT                   "
FT   gene            142452..142832
FT                   /gene="flgB"
FT                   /locus_tag="BMI_II149"
FT   CDS_pept        142452..142832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="BMI_II149"
FT                   /product="flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II149"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49286"
FT                   /db_xref="GOA:C7LGZ8"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGZ8"
FT                   /protein_id="ACU49286.1"
FT                   /translation="MSSIHLFDLAARQAQWLSVRQATVAGNVANANTPDFRARDVQPFA
FT                   DVLDKTQLTMTATSPLHLEAEADGIAATRLRPDDVTEQTHSGNTVDVEQEMMKAGEIAR
FT                   EYSLNTSIVKAFHRMMLSVAKG"
FT   gene            142835..143257
FT                   /gene="flgC"
FT                   /locus_tag="BMI_II150"
FT   CDS_pept        142835..143257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="BMI_II150"
FT                   /product="flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49287"
FT                   /db_xref="GOA:C7LGZ9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C7LGZ9"
FT                   /protein_id="ACU49287.1"
FT                   /translation="MSSDALQSTLKIAASGLSAQSTRLRIVSENIANAQSTARTADTDP
FT                   YRRKTVSFRTELEQGTGAAEVRVAEVGKDTSPFIEQYDPSHPAADARGYVKYPNVNMVV
FT                   EMADMREANRSYEANLQVVRQARELISMTIDLLRST"
FT   gene            143257..143592
FT                   /gene="fliE"
FT                   /locus_tag="BMI_II151"
FT   CDS_pept        143257..143592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="BMI_II151"
FT                   /product="flagellar basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II151"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49288"
FT                   /db_xref="GOA:C7LH00"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH00"
FT                   /protein_id="ACU49288.1"
FT                   /translation="MYDSIMSVSARNALSRLSETVAEKGVGSASAPQAVPAAPGASFGE
FT                   VLSQMTGSVSQKLQAAEATSIQGIKGDAPVRDVVSSVMEAEQSLQTAIAIRDKIVQAYL
FT                   EISRMPI"
FT   gene            143678..144466
FT                   /gene="flgG"
FT                   /locus_tag="BMI_II152"
FT   CDS_pept        143678..144466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="BMI_II152"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II152"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49289"
FT                   /db_xref="GOA:C7LH01"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH01"
FT                   /protein_id="ACU49289.1"
FT                   /translation="MKALMIAATGMNAQQLNLEVIANNIANINTTGFKRARAEFTDLLY
FT                   QSERTAGVPNQANQAIVPEGALVGLGVQTAAVRNLHIQGSFNQTGNPYDVALTGRGWFQ
FT                   IQSPTGETLYTRAGAFNKNADGQLVTLDGNPVEPAITIPPDAIEVTITDTGQVFAKLQD
FT                   QINQVDLGQLTLANFTNEAGLEPLGGNLYRETEASGGPLVGVPGDPGYGSIKQGYLEAS
FT                   NVDPVKEITDLITAQRAYEMNSKVIQAADEMAATVSKNLR"
FT   gene            144478..144960
FT                   /gene="flgA"
FT                   /locus_tag="BMI_II153"
FT   CDS_pept        144478..144960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="BMI_II153"
FT                   /product="flagellar basal body P-ring biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II153"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49290"
FT                   /db_xref="GOA:C7LH02"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH02"
FT                   /protein_id="ACU49290.1"
FT                   /translation="MDRVKAIFQAARLALAGGFLLAAMAGAGAADRIAFVVPSATVYPG
FT                   QIVSDTALLEKQFFINAPAATQYVLSLDQAVGKVARKTLLPGKPILVSALGEPSLVTRG
FT                   IPAPLVFTAGTLTITAMGTPLESGVAGDFIKVRNVDSGIIVSGTVLANGRIQVGMQ"
FT   gene            144996..146330
FT                   /gene="flgI"
FT                   /locus_tag="BMI_II154"
FT   CDS_pept        144996..146330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="BMI_II154"
FT                   /product="flagellar P-ring protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II154"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49291"
FT                   /db_xref="GOA:C7LH03"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH03"
FT                   /protein_id="ACU49291.1"
FT                   /translation="MALFCVPVLMYVQYTALRYSKITIFASACRFWIQALRKTCATLIT
FT                   ASALIFQPAAGFADESARNVREFGSAVDADADWLGAGGDPSKMTYAELGRGSAVARLKD
FT                   IATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNSTRSKNT
FT                   AAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQGNMIV
FT                   SGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVRAAD
FT                   TINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDERT
FT                   GTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPFSDGETAVEPNTDIAVNQQNAKI
FT                   GILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ"
FT   gene            146327..146887
FT                   /locus_tag="BMI_II155"
FT   CDS_pept        146327..146887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II155"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49292"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH04"
FT                   /protein_id="ACU49292.1"
FT                   /translation="MIMAHKMIRYGSAVALFLAASVPAFADPPALGNLDEIRKFCGNID
FT                   DQAADARYALQAKQLTELKADVEERMRALEEKRREYELWLKRRDEFVSKAQDALVDIIS
FT                   KMKPDAAAAQMALIGDEAAAALILKLNPRVSSIILNEMPPEKAAKLARVIVGSQRTSSA
FT                   AQPVKDQSGRDQRAAAQTGNTVQ"
FT   gene            146896..147612
FT                   /gene="flgH"
FT                   /locus_tag="BMI_II156"
FT   CDS_pept        146896..147612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="BMI_II156"
FT                   /product="flagellar L-ring protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II156"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49293"
FT                   /db_xref="GOA:C7LH05"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH05"
FT                   /protein_id="ACU49293.1"
FT                   /translation="MNKAILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQF
FT                   NGYPARPGKASYSLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVSKG
FT                   IYGGGGSFATSSITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLP
FT                   NGNLIIRGSQEVRVNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRVSEI
FT                   QQPPYGQQILDQFSPF"
FT   gene            147625..148116
FT                   /gene="fliL"
FT                   /locus_tag="BMI_II157"
FT   CDS_pept        147625..148116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="BMI_II157"
FT                   /product="flagellar protein FliL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II157"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49294"
FT                   /db_xref="GOA:C7LH06"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH06"
FT                   /protein_id="ACU49294.1"
FT                   /translation="MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMISAGQ
FT                   QASAKPSGKEDKPKPGSFESRSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIP
FT                   PAMAANVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVVE
FT                   "
FT   gene            148113..148853
FT                   /gene="fliP"
FT                   /locus_tag="BMI_II158"
FT   CDS_pept        148113..148853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="BMI_II158"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II158"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49295"
FT                   /db_xref="GOA:C7LH07"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH07"
FT                   /protein_id="ACU49295.1"
FT                   /translation="MKHSLGLGVILTLALTVSAQAQQALPLDKLLPAGSGAASGQIVQL
FT                   FGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALFMTFYVMAP
FT                   AFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLRLFEDLADPSFRTSD
FT                   DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMMLPPTVISLP
FT                   FKILFFVLIDGWNILVGSLIRSFS"
FT   gene            148947..149439
FT                   /pseudo
FT                   /locus_tag="BMI_II159"
FT                   /note="pseudogene corresponding to BRA0161 in B .suis
FT                   (hypothetical protein)"
FT   gene            149455..149871
FT                   /locus_tag="BMI_II160"
FT   CDS_pept        149455..149871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49296"
FT                   /db_xref="InterPro:IPR018696"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH08"
FT                   /protein_id="ACU49296.1"
FT                   /translation="MLAACGKPMNIMALISILHLSSGGVALAADTGRIIIRNDLAACVD
FT                   MRVEKPPFEYPNGSNIVAINANFKLRKPIGACGCMSALARYASSVNERESRLFLQQGLF
FT                   NLKKSDTKTLPLATEPALVKDGNIEIMVGCARPR"
FT   gene            complement(150067..150951)
FT                   /locus_tag="BMI_II161"
FT   CDS_pept        complement(150067..150951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II161"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II161"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49297"
FT                   /db_xref="GOA:C7LH09"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH09"
FT                   /protein_id="ACU49297.1"
FT                   /translation="MRFDVTDLRLFVSIAETGSITHGAAMVNMALGAASARVRGMEELA
FT                   GVALLNRERLGVSITPAGRALLQHGRIVLQQLGRMHSELDEFAHGLKGHVRLFSNTNAL
FT                   AEFLPVALSSFLMDNPGVNIDLQEHLSDEIVRSVVEGIADIGIVAGTVDVASLETFPFR
FT                   EDYLVVVVPQGHPFARRRRIAFKDTLDYDFIGLSQGAALQNFLSAHAMRMGQRLRLRVQ
FT                   LRSFDSICQMVESRAGIAIVPASAAKRLRRIMAIRIIALDDAWALRRLTICVRSLQDLP
FT                   AHAARLVEHLRQT"
FT   gene            151003..151134
FT                   /locus_tag="BMI_II162"
FT   CDS_pept        151003..151134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II162"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49298"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH10"
FT                   /protein_id="ACU49298.1"
FT                   /translation="MRMVIRTRSRFNSSNGSRTPLCAFAENILDFHHSNFQAGAYTP"
FT   gene            151131..152348
FT                   /locus_tag="BMI_II163"
FT   CDS_pept        151131..152348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II163"
FT                   /product="CAIB/BAIF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II163"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49299"
FT                   /db_xref="GOA:C7LH11"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH11"
FT                   /protein_id="ACU49299.1"
FT                   /translation="MTAPFSVQPPESALRPLDGITVVSLEHAIAAPFATRQLADLGARV
FT                   IKVERPGVGDFARAYDDRVNGMASHFVWCNRSKESLAIDLKHPDARGILHDLVSKADVL
FT                   VQNLAPGAAARLGLSAEALRADCPHLIVCDISGYGSDGPYRDRKAYDLLIQSEAGFLSV
FT                   TGTPDEQAKAGISIADIAAGMYAYSGILSALLMRERTGQGSHIEVSMLEALGEWMGFPL
FT                   YYTYGGKEPPPRTGASHATIFPYGPFPTGDGKTVMLGLQNEREWAIFCEKVLHQPALAQ
FT                   DERFVSNVLRVRNRDALTEIIVASFAASNAEAITMQLDEAGIANARVRTMAEVWDHPQL
FT                   QARGRWTEITTPAGQVPALLPPAFPNGMEPRMDPVPALGAHNISILTELGLDEAQIAAL
FT                   REAGAI"
FT   gene            152416..153252
FT                   /locus_tag="BMI_II164"
FT   CDS_pept        152416..153252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II164"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49300"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH12"
FT                   /protein_id="ACU49300.1"
FT                   /translation="MELNIEQLRSWIGREETRHELVTPSLVERFNATFDHEGDTANDAV
FT                   APLLIHLCLTQPAALTSRLGPDGHPARGGFLPPVPLPRRMWAGGAFTFRDDIRVGDIVT
FT                   RTSRIQDVVVKEGRTGTLCFVTVGHEFHSNGRHAVTERQDIVYRGADMSNPAAKTQPAV
FT                   PHGPHCRFITPSAPLLFRYSALTFNGHRIHYDAPYVRNVENYPGLIVHGPMQATMLVRF
FT                   ATEIRGKPPVRFDFRSLSPLFDDADFTLNAIDDGEGLKLWTSYANGPVAMEARALW"
FT   gene            153246..154070
FT                   /locus_tag="BMI_II165"
FT   CDS_pept        153246..154070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II165"
FT                   /product="citrate lyase, beta subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II165"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49301"
FT                   /db_xref="GOA:C7LH13"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH13"
FT                   /protein_id="ACU49301.1"
FT                   /translation="MVSIASIRAPLFVPADRPDRFSKAAASGTDCVILDLEDAVAPKAK
FT                   DAARAALDTSFTDLPVMVRINPHGTPWHEADMAAVARLDVAGVILPKAETAERIEAAAR
FT                   MLDLPLIALVETARGLANARSIAAASGVVRLAFGSIDFCADLACAHMREILLPARVELV
FT                   MASRLAGIAAPIDGVTPGFNDPVMCHQDAAHARALGMMGKLCIHPRQISEVLRAFAWSD
FT                   QEIDWARRVLASGEGAISIDGMMVDEPVRIRARTILEQADIGAAPVLTKPTG"
FT   gene            154103..154255
FT                   /locus_tag="BMI_II166"
FT   CDS_pept        154103..154255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II166"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49302"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH14"
FT                   /protein_id="ACU49302.1"
FT                   /translation="MHGRIGYGADELAPALAIKPEFDAWSRQREQDFLKADFQKIPTQI
FT                   ETRSR"
FT   gene            complement(154265..154450)
FT                   /locus_tag="BMI_II167"
FT   CDS_pept        complement(154265..154450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II167"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49303"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH15"
FT                   /protein_id="ACU49303.1"
FT                   /translation="MTRIFSKNRFTLFGMRSKGASLIGTSEMTLFRINYPLKIKVSGFL
FT                   NFNEVERCIFLVPHLR"
FT   gene            154520..155098
FT                   /locus_tag="BMI_II168"
FT   CDS_pept        154520..155098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II168"
FT                   /product="cytochrome b561, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II168"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49304"
FT                   /db_xref="GOA:C7LH16"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH16"
FT                   /protein_id="ACU49304.1"
FT                   /translation="MTQSRAIFDSPIGYGVVSRVLHWAMALMFAWQFTSAILHYFAKGS
FT                   AIFKFFWAAHFQLGFALLLLVLLRGVWGLINCNRRPRAESSGGRIVALGHGLIYILMIA
FT                   VPTVAMLRSYNSGRGFSFLGMEIFAKTAVQNPAGGAPAAAVNAGLSLHGLLGWILLAVV
FT                   IAHILLALAHHFIMQDNTLRYMTGRRAVS"
FT   gene            155597..155941
FT                   /locus_tag="BMI_II169"
FT   CDS_pept        155597..155941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II169"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49305"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH17"
FT                   /protein_id="ACU49305.1"
FT                   /translation="MLICSYLILINKSVDGGGNIGTKLGRGVESRRTLGSHINSASQLY
FT                   SGCLCCANRVTLWHRCILSLVPKIHRSISLGALLVYGAPSSGTRWWDNFISRVGRVREL
FT                   RRLVLRKKAY"
FT   gene            155889..160757
FT                   /locus_tag="BMI_II170"
FT   CDS_pept        155889..160757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II170"
FT                   /product="outer membrane autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49306"
FT                   /db_xref="GOA:C7LH18"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH18"
FT                   /protein_id="ACU49306.1"
FT                   /translation="MDGFASCGVWFSERKHIDMRSVRTIIRPGAAFIAMLYATVSVHAG
FT                   GQGGYGGLNMNPYGYPGGNGNSATGMGGDGGQGYNNPDPTGAGGTVGNLITSPTTIISN
FT                   ITGGAGGRSVDQDGFGGNAGGGGGTGVATASDVTNNATVIGGQGGAFSLGAWSGAGAGG
FT                   GGGAGVATSANFTNNSTVIGGAGGDGANAGPGQNSGGGGGGAGVYVVGNSTLVTITNNG
FT                   TITGGAGGLNSAWPVYYGATGGAGEGGAAGSIRTGGSQGTSSQGGAGIIGANIAVINNG
FT                   TITGGIGGTGGLNAGVQNDAVTFQSGTNSLTLTTKSVISGVVSANGNDDTLTLQNTLSK
FT                   IDGGQSDGANISATQYKGFEHLVVNGGRWTVGGSAIVSGETTLNGGALVVTGPAALGVQ
FT                   AITAQGGAIEASGDQVLNQSFVLKNNPYGASTSGLVVQGADNLVLSGVLSDVGRLTKNG
FT                   SGTLTLTADNTYTGGTVFAGGVVSVDKEVRLGGGDLTFNGGTLQVTGTGWTSTSRAVSL
FT                   QAGGGTFDIEDAANNFAVTQGVTGAGGLMKSGTGTVTLSGANSYTGGTKVSAGTLVVAN
FT                   DNTGGGTTTVDAGAGLQIGTGGTSGSLAGDIANNGALVVNRSDALNLAGAISGTGSLTK
FT                   NGAGTLTLSGANSYTGATTVSAGTLTLTGDNTGGGTTTVDVGALLQIGTGGTSGSLAGD
FT                   IANDGTLVVDRSDAIGLSGAISGAGGLTKNGAGTLTLSGANSYTGATTVSAGILTLTGD
FT                   NTGGGTTTVDARAELHIGTGGASGSLAGNIVNDGALVVDRSGVIGLSGVISGTGGLMKS
FT                   GTGTVTLSGVNTYTGGTTLTAGTLAAASDNNLGGASGGLTFNGGTLQVMGTSWTSTNRA
FT                   VSLQAGGGTFDIEDAANNFAVTQGVAGAGGLTKSGSGTLTLSGANSYTGATTVSAGTLV
FT                   VANDNTGGGTTTVDVGAGLQIGTGGVSGSLAGDIVNNGTLVVDRSNAFDLANVISGTGS
FT                   LTKNGAGTLTLSGVNSYTGGTTVSAGILTLTGDNTGGGTTTVDAGAVLQIGTGGTSGNL
FT                   AGDIANNGALVVNRSDALNLANAISGAGSLMKSGAGTLTLSGANSYTGATTVSAGTLTQ
FT                   GAAGGFSTASSRYDVDTDGTLDLGGFDTMLAALYNAGTINMNVGAAGSTLMVNGDYVGH
FT                   DGTIVFNTVLGDDNSKTDKLMVGGDTAGNTNVQVVNRDGLGAQTVKGIEIITVGGQSNG
FT                   VFSLVSDYRTKDGQKAVVGGAYAYTLHQGPARGANDGNWYLISQLEDIKPDNPATRRVS
FT                   DTPDAPDTPAPRYSANVPVYEGYVQTMQALNKPSTLQERVGKRYMTGENGDGRTSGGMV
FT                   DAHGIWARIQGAHDRLEPTTLTGMKQEINTFILQAGVDGQFYEDENGKLIAGITGQYGT
FT                   ARSNIVARDGDGRISTNAWSLGATATWIGNDGFYVDTQGQVTWFESDLNSDTADVGLAS
FT                   GRKATGYALSVETGKRIALNGNWALTPQAQLIWSSINADDFEDVWQANISVARGNSFAA
FT                   RFGLAASYDSSWQGSDGRVVNTSVYGITNLYQEFLGGTRVNISGVDFSTDNDRTWAGIG
FT                   AGGTYAWAGGKYLIFGQGTINTSLDHFADSYAIKGDVGFKVKW"
FT   gene            160994..161389
FT                   /gene="cycA"
FT                   /locus_tag="BMI_II171"
FT   CDS_pept        160994..161389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycA"
FT                   /locus_tag="BMI_II171"
FT                   /product="cytochrome c2"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II171"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49307"
FT                   /db_xref="GOA:C7LH19"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH19"
FT                   /protein_id="ACU49307.1"
FT                   /translation="MRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIGEG
FT                   AKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKMVY
FT                   AGLKDEGKIDDLIAFLKQYDLGGKIKE"
FT   gene            complement(161613..161852)
FT                   /locus_tag="BMI_II172"
FT   CDS_pept        complement(161613..161852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II172"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49308"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH20"
FT                   /protein_id="ACU49308.1"
FT                   /translation="MSNTPHTLGEEFPGQLEAIHALKAKDAHFARILEEYDSVNDLIHR
FT                   AETNIQPVSQEEETNLRKQRLALKDKIASALAAA"
FT   gene            162282..162419
FT                   /locus_tag="BMI_II173"
FT   CDS_pept        162282..162419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II173"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49309"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH21"
FT                   /protein_id="ACU49309.1"
FT                   /translation="MTAKNATLLTVLMVSAIVFMAVGIFTVDAGNQTAPTDGYGISSAH
FT                   "
FT   gene            complement(162497..163309)
FT                   /locus_tag="BMI_II174"
FT   CDS_pept        complement(162497..163309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II174"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II174"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49310"
FT                   /db_xref="GOA:C7LH22"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH22"
FT                   /protein_id="ACU49310.1"
FT                   /translation="MADTVFSRIQASRTADDVVHQIESLILEGVLRGGDRLPGERELAR
FT                   QFDISRPILRDALKRLETAGLLTSRHGGGTFVADVIGQVFSAPVVKLFADHHKATADYL
FT                   EYRREIESVAAEYAALRATPADRALLTEIMNAMEKAHGADDFATEARLDVELHNAIGEA
FT                   AHNIVLLHTLRSCYQLLKDGVFYNRSVIYNHPGVADVFLSQHRAIYDAVMAGNPQAARE
FT                   AVQKHIRFVEQATHDRALNDERERVARLRYRQRAGSKELKEIREDESE"
FT   gene            complement(163431..164351)
FT                   /locus_tag="BMI_II175"
FT   CDS_pept        complement(163431..164351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II175"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II175"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49311"
FT                   /db_xref="GOA:C7LH23"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH23"
FT                   /protein_id="ACU49311.1"
FT                   /translation="MMSSLADMEIFARVVATGSMSAAARDLGLSPAVVSKRLGRLEERL
FT                   GTRLLQRTTRQIALTEAGQGYHERVLAILANIEEAEAFVARRSADARGTLKISAPTTFG
FT                   RMHIAPYLVPFMRANADLTVNMQLSDEMVDIVGDGYDLAIRIGELSDSTLVARRLAPVR
FT                   RIFVAAPRYLKERGTPQTIEDLQDHICLAPHNNDPWRLEGPKGPIVIRPTGPLQTNSSE
FT                   IVREAVLAGLGIAQRSTWDVGPELAAGKLVQVLPDYAASRNVAIHAVYPSKQFLPAKVR
FT                   LFIDYLADLYGPVPYWESGTFPEEN"
FT   gene            complement(164511..164630)
FT                   /locus_tag="BMI_II176"
FT   CDS_pept        complement(164511..164630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II176"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49312"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH24"
FT                   /protein_id="ACU49312.1"
FT                   /translation="MPSSHIRPEFLFSRNSGETRVPVFLEFFQSAPCALFVKW"
FT   gene            164702..166198
FT                   /gene="glcD"
FT                   /locus_tag="BMI_II177"
FT   CDS_pept        164702..166198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="BMI_II177"
FT                   /product="glycolate oxidase, subunit GlcD"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II177"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49313"
FT                   /db_xref="GOA:C7LH25"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH25"
FT                   /protein_id="ACU49313.1"
FT                   /translation="MSGLIMPEPDAGVLQRREQIVADLRVIVPGEGVVDTVNAMRVFET
FT                   DGLTAHRQLPLVVVLPETVEQVAQVLRYCHDNAIRVVPRGAGTSLSGGSMPLEDAVLLV
FT                   MSRFNRILEIDYPNRVAVVQPGVTNLGITKAVEHEGFYYAPDPSSQIACSIGGNVAENA
FT                   GGVHCLKYGLTANNVLGIEMVLITGEVMRLGGKHLDSEAYDLLGLMTGSEGLLGVVTEI
FT                   TVRILQKPETARAIMVGFPSSEQAGQCVADIIGAGIIPGGMEMMDRPAIKAAEDFVRVG
FT                   YPLDVEALLIVELDGPPVEVDYLLGRVEKIALQNGSTTCTLSQSEEQRLAFWAGRKAAF
FT                   PAVGRISPDYLCMDGTIPRKELPRVLSGMRALSEKYGLRVANVFHAGDGNLHPLILYDA
FT                   NNPGELEAAEDFGADILRLCVKVGGVLTGEHGVGIEKRDLMPEMFNETDLDQQMRVKCA
FT                   FDAKHLLNPGKVFPQLRRCAELGRMHVSRGALAFPDLPRF"
FT   gene            166214..167446
FT                   /gene="glcE"
FT                   /locus_tag="BMI_II178"
FT   CDS_pept        166214..167446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcE"
FT                   /locus_tag="BMI_II178"
FT                   /product="glycolate oxidase, subunit GlcE"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II178"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49314"
FT                   /db_xref="GOA:C7LH26"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH26"
FT                   /protein_id="ACU49314.1"
FT                   /translation="MSDANILKPQDEAGVLEMVQAALASSTPLEIIGHGSKRGIGRPVE
FT                   AGHVLDVSGLSGVTLYEPDELVLSARAGTPMAEIQKLLADHNQCFHFEPMDYGPLLGAE
FT                   PGRGTIGGTLAANLAGPRRLKAGAARDHVLGVRVVSGRGEVFKSGGRVVKNVTGYDLSK
FT                   GMANSWGTLGVATEVTFKVLPAPETVATLAVRGLDDEQAARVMALAMGSREEVSSAAHL
FT                   PPTVAWRFLDGKLGGDAATILRLEGFAPSVAHRSRQLQDLLGRTGIIDVLDDSQSRQLW
FT                   REVRDVLPYAQAGDGRAVWRVSMAPMQGWRMVDEFRRHAGVDAYYDWQGGLIWMRMEAE
FT                   PEADVLRKLIARHGGGHATLIRAPERVRGSVDVFQPQPAALAALSARLKQQFDPENILN
FT                   PGRMYPHQAGA"
FT   gene            167451..168752
FT                   /gene="glcF"
FT                   /locus_tag="BMI_II179"
FT   CDS_pept        167451..168752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcF"
FT                   /locus_tag="BMI_II179"
FT                   /product="glycolate oxidase, iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II179"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49315"
FT                   /db_xref="GOA:C7LH27"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH27"
FT                   /protein_id="ACU49315.1"
FT                   /translation="MQTHFSPEQLRDPGVLEAEKILRKCVHCGFCTATCPTYVTLGNEL
FT                   DSPRGRIYLIKDMLENGRPADEEIVRHVDRCLSCLACMTTCPSGVNYMHLVDHARAHIE
FT                   KTYKRPFMNRLLRSVLAQVLPYPARFRLALKLAKLGKPFASLFRKSPVLRPVAAMLDLA
FT                   PQSLPAMPAATNAVRGEKRGRVAILNGCAQPVLNPGINAATLRLLNRFDIEVATPKGEG
FT                   CCGSLVHHMGREEQALEQARHNVDVWTREIETGGLDAIIVTASGCGTTIKDYGYMLRLD
FT                   PAYKDKAARVSALAKDITEYLATLELPEPDAPKTLTVAYHSACSMQHGQKIVREPKDLL
FT                   VKAGFTVKEPLEGHLCCGSAGTYNIMQPEIATKLRDRKVKNIEATGAALIATGNIGCMT
FT                   QIATGSDLPIVHTVELIDWAYGGPTPQALEKAGA"
FT   gene            complement(168975..169802)
FT                   /locus_tag="BMI_II180"
FT   CDS_pept        complement(168975..169802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II180"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49316"
FT                   /db_xref="GOA:C7LH28"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH28"
FT                   /protein_id="ACU49316.1"
FT                   /translation="MTVPTVKLNDGNHIPQLGYGVWQISNDEAVSAVSEALKAGYRHID
FT                   TATIYGNEEGVGKAINGSGIARADIFLTTKLWNSDQGYESTLKAFDTSLKKLGTDYVDL
FT                   YLIHWPMPSKDLFMETWRAFIKLKEEGRVKSIGVSNFRTADLERLIKESGVTPVLNQIE
FT                   LHPQFQQDELRLFHGKHDIATEAWSPLGQGKLLEDPTLKSIAEKHAKSVAQIILRWHIE
FT                   TGNIVIPKSITPARIKENFDIFDFTLNGTDHDAITKLDMADGRIGPNPSVFSA"
FT   gene            complement(170078..170812)
FT                   /locus_tag="BMI_II181"
FT   CDS_pept        complement(170078..170812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II181"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II181"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49317"
FT                   /db_xref="GOA:C7LH29"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH29"
FT                   /protein_id="ACU49317.1"
FT                   /translation="MKPRHLLLIGSLTAIAVSIVSTGMAFADDRYSDLPPVRVSQAISA
FT                   PWVAQLQDAPARPRIARQETRKTKTHYNKVSYQRPATNPATTARKKQFDPIYLPQIVSY
FT                   SGKEKPGTIVIDTASRFLYLVQADGKARRYGVGVGKQGFSWKGTQRISRKAEWPTWTPP
FT                   SEMIARERKKGRFLPARMDGGINNPLGARALYLGSTLYRIHGTNQPWTIGKAMSSGCIR
FT                   MRNEDVTDLYERTPVGTRVVVR"
FT   gene            171052..171708
FT                   /gene="tag"
FT                   /locus_tag="BMI_II182"
FT   CDS_pept        171052..171708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="BMI_II182"
FT                   /product="DNA-3-methyladenine glycosidase I"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II182"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49318"
FT                   /db_xref="GOA:C7LH30"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH30"
FT                   /protein_id="ACU49318.1"
FT                   /translation="MSDMAEARAGLVVGADGRTRCFWPGELPDYLAYHDNEWGVPVADD
FT                   FRLFEKICLEGFQSGLSWLTILRKRENFRAAFDGFNFHRIATYDESDVERLLADKGIVR
FT                   HRGKIVSVINNAGRAIELIEEKGSLAAYFWSFEPGAENRPAVVDYPTLVANPITATSTR
FT                   ISKDLKKRGWSFVGPTTVYAFMQAMGLVNDHIEGCHCRATIEKLRQNFKRPGKKL"
FT   gene            171827..172444
FT                   /locus_tag="BMI_II183"
FT   CDS_pept        171827..172444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II183"
FT                   /product="transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II183"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49319"
FT                   /db_xref="GOA:C7LH31"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH31"
FT                   /protein_id="ACU49319.1"
FT                   /translation="MDLMSLVAFAGILVVAAGTPGPNVGALVARVISRGHKGVFPFMFG
FT                   LWLGDAVWLSLAVWGLSALTHTFQTAFLVLKYAGVAYLIYLSWKMWFAPVDEEADENTI
FT                   PRQGEGKRLFLSALGVTLGNPKIMVFYLAILPTVVDITHVSLTGWVELLLVMFMVLAAV
FT                   DTAWVVLAAQARKFLRSPRMMRLANRTSAGMMAGAAVAIAAR"
FT   gene            172555..174063
FT                   /gene="hisS"
FT                   /locus_tag="BMI_II184"
FT   CDS_pept        172555..174063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="BMI_II184"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II184"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49320"
FT                   /db_xref="GOA:C7LH32"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH32"
FT                   /protein_id="ACU49320.1"
FT                   /translation="MADKADKMKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFEP
FT                   VETPLVEYTDALGKFLPDQDRPNEGVFSFQDDDEQWLSLRYDLTAPLARYVAENFETLP
FT                   KPYRSYRNGWVFRNEKPGPGRFRQFMQFDADTVGAPNVSADAEMCMMMADTLERLGIQR
FT                   GDYAIRVNNRKVLDGVLDAIGLEGEGNAAKRLNVLRAIDKLDKFGPEGVRLLLGKGRLD
FT                   ESGDFTKGAQLPEAAIEKVLAFTAAGGADGAQTIANLQAVVAGNAKGEEGVQELADMQA
FT                   LFFAGGYEGRVKIDPSVVRGLEYYTGPVFEAELLFDVTNEDGQKVVFGSVGGGGRYDGL
FT                   VSRFRGEPVPATGFSIGVSRLMTALKNLGKLDVSDTVGPVVVLVMDKDTQNLGRYQKMV
FT                   SDLRKAGIRAEMYVGGSGMKAQMKYADRRAAPCVVIQGSQEREAGEVQIKDLVEGKRLS
FT                   AEIEDNITWRESRPAQITVREDGLVDAVREILDAQARDRAEQSK"
FT   gene            174072..175202
FT                   /locus_tag="BMI_II185"
FT   CDS_pept        174072..175202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II185"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II185"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49321"
FT                   /db_xref="GOA:C7LH33"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH33"
FT                   /protein_id="ACU49321.1"
FT                   /translation="MVGSRTSPIFNALRVELNAREAELVEIPLIQPADPFLDMAGEDLR
FT                   RRIFLTENENGDSLCLRPEFTIPVCRNHIALNAATPKRYAYLGEVFRQRRDGAAEFLQA
FT                   GIEDLGAADEAASDARSLADALSCVKAIAPDAPLEIVLGDQSVFAGMLKALGLPQGWRK
FT                   KLLRSFGDAHSMDLALAELTGTQRRDPLPESLAVLVAEGDEIGLARMLEAEMLEAGISP
FT                   GAGRTPVEIARRLIEKEDLAATHFPAAALDLLRQFLAIRVSLDTAAVTLRAFAADNALD
FT                   LGAVLQKFEARADAIAQAGIEMKDIIYDASFGRPLDYYTGLVYEIRDASNRQDGVLAGG
FT                   GRYDRLLTMLGACEAIPGVGFSIWLDRLQALAGEKQ"
FT   gene            175199..175894
FT                   /gene="hisG"
FT                   /locus_tag="BMI_II186"
FT   CDS_pept        175199..175894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="BMI_II186"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II186"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49322"
FT                   /db_xref="GOA:C7LH34"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH34"
FT                   /protein_id="ACU49322.1"
FT                   /translation="MSVTLALPSKGRLKEKTLAVLEKAGYKVVLPDDDRNYRARVEGED
FT                   DLDILFLSASEIARELGYGSVDLGVTGEDLVRETLAHADERVAIEAQLGFGHADVVVAV
FT                   PEVWRDVTTMADLDDVAADFRQRHGRRLRIATKYWRLTQQFFSQKHGIQVYRIVESLGA
FT                   TEGAPAAGSADMIVDITSTGSTLRANRLKVLEDGIILRSQACLVSARRSHTSRRVEEIA
FT                   ARIRAGLEI"
FT   gene            complement(175967..177205)
FT                   /locus_tag="BMI_II187"
FT   CDS_pept        complement(175967..177205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II187"
FT                   /product="glucose/galactose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II187"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49323"
FT                   /db_xref="GOA:C7LH35"
FT                   /db_xref="InterPro:IPR005964"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH35"
FT                   /protein_id="ACU49323.1"
FT                   /translation="MATSIPTNNPLHTETSSQKNYGFALTSLTLLFFMWGFITCLNDIL
FT                   IPHLKNVFQLNYTQSMLIQFCFFGAYFIVSLPAGQLVKRISFKRGIVVGLIVAAIGCAL
FT                   FIPAASYRVYALFLGALFVLASGVTILQVAANPYVTILGKPETAASRLTLTQAFNSLGT
FT                   TVAPVFGAVLILSAATDATVNAEADAVRFPYLLLALAFTVLAIIFAILKLPDVQEDEPA
FT                   LSDKKEGSAWQYRHLVLGAIGIFVYVGAEVSVGSFLVNFLSDPTVAGLSETDAAHHVAY
FT                   FWGGAMVGRFIGSAAMRYIDDGKALAFNAFVAIILLFITVATTGHIAMWSVLAIGLFNS
FT                   IMFPTIFSLALHGLGSHTSQGSGILCLAIVGGAIVPLIQGALADAIGIHLAFLMPIICY
FT                   AYIAFYGLIGSKS"
FT   gene            complement(177491..177892)
FT                   /locus_tag="BMI_II188"
FT   CDS_pept        complement(177491..177892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II188"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49324"
FT                   /db_xref="GOA:C7LH36"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH36"
FT                   /protein_id="ACU49324.1"
FT                   /translation="MSSITPKANGAATLIIRVFLSVLFIIAGYNKLTALDGTADYFASI
FT                   GLPMPIVTAVVVGLIEFVGGLAILFGFKTRIAAVIVGLFTLGATLVAHMDFAEGMNLLI
FT                   AQKNLAIAGGLFLLFLHGAGSLSIDARRG"
FT   gene            complement(177995..179386)
FT                   /gene="fumC"
FT                   /locus_tag="BMI_II189"
FT   CDS_pept        complement(177995..179386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="BMI_II189"
FT                   /product="fumarate hydratase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II189"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49325"
FT                   /db_xref="GOA:C7LH37"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH37"
FT                   /protein_id="ACU49325.1"
FT                   /translation="MAATRTETDTFGPIDVPADRYWGAQTQRSLQNFRIGGERMPLPLV
FT                   HALGVVKRAAAETNIALGKLDPVLGQVIAVAASEVIEGKLDDHFPLVVWQTGSGTQSNM
FT                   NANEVISNRAIELLGGEMGSKKPIHPNDHVNMSQSSNDSFPTAIHIATAVETVNRLYPA
FT                   LEHLTKALKVKEEAFKDIIKIGRTHTQDATPVTLGQEFSGYRAALEYARHRLEQSLADV
FT                   FLLAQGGTAVGTGLNAPVGFDKGFAEAVSEITGLSFKTAPNKFEALASHGAVLNFHGSL
FT                   NALAADLFKIANDIRFLGSGPRSGLGELSLPENEPGSSIMPGKVNPTQAEAMTMVATQV
FT                   FGNQTAVTVAASQGHFELNVFKPVIAYNVLQSIRLLSDTMVSFADHCVEGIEPNTARIK
FT                   ELLERSLMLVTALAPAIGYDNAARIAKTAHKNGTTLREEALASGLVSEEDYDRLVRAER
FT                   MIAPQ"
FT   gene            complement(179537..179824)
FT                   /locus_tag="BMI_II190"
FT   CDS_pept        complement(179537..179824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49326"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH38"
FT                   /protein_id="ACU49326.1"
FT                   /translation="MKPEETGTENHMRKELPIETAPKDGRKITVIWIDDDDQRNESIAQ
FT                   YRTLEQLRAGGGQWDEADTGWWTFTDSKTQRKIEPTAWIRETDDDESQED"
FT   gene            complement(180121..180342)
FT                   /locus_tag="BMI_II191"
FT   CDS_pept        complement(180121..180342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II191"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49327"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH39"
FT                   /protein_id="ACU49327.1"
FT                   /translation="MLLPIMSSNPVSILALPRYVLLMQAFLPPVESLPNPGEPPLPGLT
FT                   FLTVPDARNGHTNSVKLSPFFPAPHNHF"
FT   gene            complement(180544..182184)
FT                   /gene="groEL"
FT                   /locus_tag="BMI_II192"
FT   CDS_pept        complement(180544..182184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BMI_II192"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II192"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49328"
FT                   /db_xref="GOA:C7LH40"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH40"
FT                   /protein_id="ACU49328.1"
FT                   /translation="MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFG
FT                   APRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGA
FT                   KAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIA
FT                   EAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILL
FT                   HEKKLSNLQALLPVLEAVVQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKA
FT                   EIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDA
FT                   LNATRAAVEEGIVAGGGTALLRASTKITAKGVNADQEAGINIVRRAIQAPARQITTNAG
FT                   EEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITT
FT                   EAMIAELPKKDAAPAGMPGGMGGMGGMDF"
FT   gene            complement(182275..182571)
FT                   /gene="groES"
FT                   /locus_tag="BMI_II193"
FT   CDS_pept        complement(182275..182571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BMI_II193"
FT                   /product="co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II193"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49329"
FT                   /db_xref="GOA:C7LH41"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH41"
FT                   /protein_id="ACU49329.1"
FT                   /translation="MADIKFRPLHDRVVVRRVESEAKTAGGIIIPDTAKEKPQEGEVVA
FT                   AGAGARDEAGKLVPLDVKAGDRVLFGKWSGTEVKIGGEDLLIMKESDILGIVG"
FT   gene            182660..182950
FT                   /locus_tag="BMI_II194"
FT   CDS_pept        182660..182950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II194"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49330"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH42"
FT                   /protein_id="ACU49330.1"
FT                   /translation="MVLEIEAACFFVKEDCRSGWRFLRGTAGFPACFGLWRNAHSTLSG
FT                   GLQHVVQAMWAIMIAKGFNLHKNVCPWLIRHEIMMRQFVLLKRGDRMGRLG"
FT   gene            183049..183900
FT                   /locus_tag="BMI_II195"
FT   CDS_pept        183049..183900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II195"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II195"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49331"
FT                   /db_xref="GOA:C7LH43"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH43"
FT                   /protein_id="ACU49331.1"
FT                   /translation="MMILPERLDDLTDRYDAIFCDVWGVVHNGETSFAPAIAALQRARA
FT                   KGVTIILVTNSPRPHPGVVAQMSLLGVPEDAYDRVVTSGDVTRDLIAEGPRRIFHIGCE
FT                   RELAIYDGLDVELVEEFEAAGVVCTGLYDDEVETPEDYRELLQRLRSRNLPFICANPDI
FT                   MVERGPRLIWCAGALAREYGQLGGRTLIAGKPHRPIYEAALRAVESIRGGSVDKRRILG
FT                   IGDGVLTDAKGAADFGLDVLYISGGVHAADYAVNGDLDMAKMEAFLEKHGHRPIASLHA
FT                   LV"
FT   gene            183936..184049
FT                   /locus_tag="BMI_II196"
FT   CDS_pept        183936..184049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II196"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49332"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH44"
FT                   /protein_id="ACU49332.1"
FT                   /translation="MPLLFQALTLLRRLFSNNEEIKLSAPHRNRGFAASPA"
FT   gene            184030..184977
FT                   /gene="ribF"
FT                   /locus_tag="BMI_II197"
FT   CDS_pept        184030..184977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="BMI_II197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II197"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49333"
FT                   /db_xref="GOA:C7LH45"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH45"
FT                   /protein_id="ACU49333.1"
FT                   /translation="MPPALHDCVVAIGNFDGVHRGHQAVLERALELAERESRPAVVLTF
FT                   EPHPRSFFKQDQPVDRLTDAAEKAEILRLMGFDAVVEQPFTAEFSQRSAEDFVQHILVE
FT                   KLRASRVVTGYDFHFGKGRRGTPEFLCEAGKKAGFSVTLVDAFTDEGGMLVSSTRIRNL
FT                   LSEGEVAEAAGLLGYRYRICGEVIHGKKLGRTLGFPTANMALAPQTSLKHGIYAVRFRL
FT                   DDAMLYDGVASFGRRPTVDDEGAPLLETFLFDFSGDLYGKTAAVSFFGFLRGEVKFDGL
FT                   DPLIDQMKQDEAQARALLADVRPISGLDRMLSFN"
FT   gene            185321..188239
FT                   /gene="ileS"
FT                   /locus_tag="BMI_II198"
FT   CDS_pept        185321..188239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="BMI_II198"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II198"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49334"
FT                   /db_xref="GOA:C7LH46"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH46"
FT                   /protein_id="ACU49334.1"
FT                   /translation="MTDTTKIDYSKTLYLPQTEFPMRAGLPQREPLFVQRWEEMNLYKK
FT                   LREQAKDRPLYVLHDGPPYANGNIHIGHALNKILKDVITRSFQMRGYNSNYVPGWDCHG
FT                   LPIEWKIEEKYRAAGKNKDEVPINEFRKECREFASNWIKVQTEEFKRLAILGDFENPYT
FT                   TMNFHAEARIAGELLKFAASGQLYRGSKPVMWSVVERTALAEAEVEYHDIESDMIWVKF
FT                   PVAGEVATENDLSGSAVVIWTTTPWTIPGNRAVSYSSRIEYGLFEITEAENDFGPRPGE
FT                   RLVFADKLVEECCAKAKLQFKRLRSVSAEELGKIVLDHPLKGFGGGYEFVVPMLDGDHV
FT                   TDDAGTGFVHTAPSHGREDFEAWMDNARQLEARGIDPNIPFPVGDDGFYTKDAPGFGPD
FT                   REGGPARVIDDNGKKGDANKVVIEQLIAADKLFARGRLKHSYPHSWRSKKPVIFRNTPQ
FT                   WFVYMDKNLGDGTTLRSRALKAIDETRFVPAAGQTRLRSMIEGRPDWVLSRQRAWGVPI
FT                   CVFVDEEGNILQDDAVNKRIMDAFEKEGADAWFADGARERFLGARAGEGWTQVRDILDV
FT                   WFDSGSTHTFTLEDRPDLKWPADVYLEGSDQHRGWFHSSLLESCGTRGRAPYNAVVTHG
FT                   FTMDEHGKKMSKSLGNTVTPQDVIKESGADILRLWVMTTDYWEDQRLGKSIIQTNIDAY
FT                   RKLRNTIRWMLGTLAHDEGENVAYADLPELERLMLHRLTELDELVRSGYDTFDFKRIAR
FT                   ALVDFMNVELSAFYFDIRKDALYCDAPSSIRRKAALQTVREIFVRLTTWLAPMLPFTME
FT                   EAWLDRYPQSVSIHAEQFRPTPAEWRDDVLAEKWRKVRAVRRVVTGALELERADKRIGS
FT                   SLEAAPVVYIADKSLSDSLEGLDFAEICITSGISVSDAAAPEGAFTLGDVKGVAVVPER
FT                   AKGEKCARSWRYTTDVGADPEFPEVSARDTAALRELQALGKL"
FT   gene            188431..189102
FT                   /locus_tag="BMI_II199"
FT   CDS_pept        188431..189102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II199"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49335"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH47"
FT                   /protein_id="ACU49335.1"
FT                   /translation="MKIEGRVLVLMTALAGLSLSGCVSSPTYGTDKSAGAQLLDDVSNM
FT                   ASFGQGKKKERIDYKPRPDLVRPAPGDKGYLPAPQQSLASSSDPNWPESPERRRKRVRD
FT                   EITAHRDDPNYVSPVLQDAPVADNIRTALPRGNSRREDYASRTPTSDPAKVAALKAARA
FT                   QQNQGSATTRRYLSEPPLAYRQPASTAAVGELGPDEAQKERERKKAASGSRGWRDYLPW
FT                   N"
FT   gene            189447..190007
FT                   /locus_tag="BMI_II200"
FT   CDS_pept        189447..190007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II200"
FT                   /product="cytochrome b561, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49336"
FT                   /db_xref="GOA:C7LH48"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH48"
FT                   /protein_id="ACU49336.1"
FT                   /translation="MSSKTYIWDDRSGYGLVSRGFHWLMALLFLWQFASAILRVFAKDT
FT                   PIYSFFWSAHFQLGFALLVLALLRGVWGLMNIHRRPHKDGAIGKLAVLGHLAIYVLMIT
FT                   IPSLALLRAYGSGRGFSFLGMPIFAKTDIQNAMLTAPANALHGPLGWVLLAAIVGHVAM
FT                   ALVHHFALRDDTLRYMTGHGTPN"
FT   gene            complement(190061..190534)
FT                   /locus_tag="BMI_II201"
FT   CDS_pept        complement(190061..190534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II201"
FT                   /product="cytidine and deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II201"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49337"
FT                   /db_xref="GOA:C7LH49"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH49"
FT                   /protein_id="ACU49337.1"
FT                   /translation="MRKAASITKANSATPMDIALEEAHAAGERGEVPIGAVIVRDGEII
FT                   ARAGNRTREFNDVTAHAEILTIRQAGEMLGSERLIDCDLYVTLEPCAMCAAAISFARIR
FT                   RLYYGASDPKGGGIEHGGRFYTQPTCHHAPEIYPGFCEADARKILKDFFREKR"
FT   gene            190585..192420
FT                   /locus_tag="BMI_II202"
FT   CDS_pept        190585..192420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II202"
FT                   /product="RNA pseudouridylate synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II202"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49338"
FT                   /db_xref="GOA:C7LH50"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH50"
FT                   /protein_id="ACU49338.1"
FT                   /translation="MICYCIIPEIETDLRTELYGVPVANNLWRAMMAQGDAVTLLKGLY
FT                   QMTTEDDNKGGKPPHGRKGHSDRPGRPDRDSRPRREGGDRDKPRKFGSRGAPVEEETSE
FT                   RIAKRLARAGIASRREAETMIAAGRIAVNGKVLESPAVNVKRTDIITVNGKPLRQTERT
FT                   RLWLYHKPAGLVTTNRDPEGRPTVFEALPPEMPRVLSVGRLDINTEGLLLLTNDGGLSR
FT                   VLELPSTGWLRRYRVRAHGKVTQQQLDELKNGIAVDGVFYGSVEAELERVQGANVWISI
FT                   GLREGKNREVKNILGALGLTVGRLIRVSFGPFQLGDLEEGAVREIKGRTLRDQLGDKLI
FT                   EESGADFDAPVLNEFSNAAVQGRTRREMEEGELPQEGERRRAPREREWISSTGERRRGR
FT                   EEKTEKVEPRRRGNANVWMAPGARPKGEKEAAKPARVEHQQPHRSAKFSGDLQMRPRRF
FT                   SEEERGGEESGERRYKRPEGRFEREGGRPDNREKYEKHEGAGKERRPGKRERAELRNAE
FT                   GQTTERGKGGFEGRKPGKPGGPRSEGRFGGADRDTRSGPRGSGPRGAGDGPRRGHDGKP
FT                   GGKPGGKPTGRPGGKPGTKPGGGGRSGGGGADRRR"
FT   gene            192401..192964
FT                   /locus_tag="BMI_II203"
FT   CDS_pept        192401..192964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II203"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II203"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49339"
FT                   /db_xref="GOA:C7LH51"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH51"
FT                   /protein_id="ACU49339.1"
FT                   /translation="MRIVGGKFRGRALVTPSTNAIRPTTDRTRESLFNILAHSFPDKVE
FT                   GVRVLDLFAGTGALGLEALSRGARYATFVEESAEGRGILRQNIEALGLQGHTKILRRDA
FT                   CQLGIVGTMEPFDLVFADPPYGRRMGEKAFLSALQGGWLNPDALLVLEEDAQAALELDD
FT                   RFAVREERNYGGTVIRLIELKAAS"
FT   gene            193050..194594
FT                   /locus_tag="BMI_II204"
FT   CDS_pept        193050..194594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II204"
FT                   /product="peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II204"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49340"
FT                   /db_xref="GOA:C7LH52"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH52"
FT                   /protein_id="ACU49340.1"
FT                   /translation="MNNPSLRRLLLSTVLGFALALPLAGGAVRAEMQPAAPAETQPAPA
FT                   APAAPVAQAALPEISRLDGVSNFTLPNGMQVVVIPDHRAPVVTQMVWYHVGAADEAPGV
FT                   SGIAHFLEHLMFKGTKNHPAGEFSARIASIGGQENAFTSYDYTAYFQRVSPEALEMVMD
FT                   FESDRMENLVLDEEAVKTEREVILEERRMRIDSNPGAMLMENTDAVLFYNHPYRKPVIG
FT                   WQQEMEKLSLKNAIDFYNQYYTPNNATLVIAGDVTPERVRELAMKTWANVHKRAEVLLR
FT                   ERPQEPAKHAARVVTLHDERVSTPSFRISWLVPSYANEKRFANVKPGDAPALDLLSEIL
FT                   GGSQLSRLYQQLIVKQGIAAETGASYDGDALDDGTFSVYGVPRNGASLGDVEKAVAAQV
FT                   DRIIRDGVTQAELDQARNLFLKAVIFARDSQTGMARIYGSALSVGQTVDDIQKWPDLIK
FT                   SVTVDQIKDVARRYLVKDQAVTSYLLPPDTEAESARKKPNAPANDASASGAGGAIQ"
FT   gene            194594..195958
FT                   /locus_tag="BMI_II205"
FT   CDS_pept        194594..195958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II205"
FT                   /product="zinc protease"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II205"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49341"
FT                   /db_xref="GOA:C7LH53"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH53"
FT                   /protein_id="ACU49341.1"
FT                   /translation="MNLSMSNFKRAFPLRGALHDARAVAGLLAASFTMLIVCALPARAI
FT                   EIQEVVSPKGIHAWLVEDNSVPLVSMRFSFKGGASQDPSGKEGIANLMTGLFDEGAGDL
FT                   DSDAFQERIDNLGAEMSFSASQDSVSGGVRMLAENRDAVTDLVALAVNEPRFDQEAIDR
FT                   IRQQIVAGIEAAQRNPSTIASRKFAEVLYGNHPYARDDEGTVKSLQSISRDDLANFHRK
FT                   NFARDKLTVGVVGAINAKDLGVMLDRIFGDLPASAELVPVPDAKLALGTTTSLNFDMPQ
FT                   TSISFVYPAIPRKDPEFFAAYLMNHILGGGFTSRLYNEVREKRGLAYSVSSSMVMHDHV
FT                   SELMISTATRPDKAQDSLKIIREQVAAMANDGPTEEELAAAKSFLKGSYAVNNLDSSGA
FT                   IANTLVSLQEAGLPSDYIDKRSELIDAVTLDQVKAIARKLLQAEPAILIYGPAQS"
FT   gene            195969..196850
FT                   /locus_tag="BMI_II206"
FT   CDS_pept        195969..196850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II206"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49342"
FT                   /db_xref="GOA:C7LH54"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH54"
FT                   /protein_id="ACU49342.1"
FT                   /translation="MDKALSSSPRFAVAFGGGGARGIAHIHVVDVLNELGIQPVAIAGS
FT                   SIGSIIGSSMANGMSGKDIYDYMASIFTNRSEVVRRMWQTRPAHWAELFKGGLRVSQFN
FT                   IEKVLDVFLPDSFPSNVEDLKIPMTITAVDFHGAREIHISDGDLRSAIAASCAIPPVFA
FT                   PVRRNGRILVDGGLFNPVPFDLLFDKADIVIGIDVVGGPVGPDDHMPTTFEAVIGTSQL
FT                   TMCSIIENKFRYRPPHIFVRPNVERIGLLDFLKFEQVISQSAAVRDELKRAIEQALDGK
FT                   VAPILPEKLPDL"
FT   gene            complement(196863..198770)
FT                   /locus_tag="BMI_II207"
FT   CDS_pept        complement(196863..198770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II207"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II207"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49343"
FT                   /db_xref="GOA:C7LH55"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH55"
FT                   /protein_id="ACU49343.1"
FT                   /translation="MPKSGVFKATSSTIFKYQEHSMVANGGSLYLQSLMILGGAIIAAP
FT                   LFKRLGLGTVLGYLAAGITIGPVARLIADGEEFLHFSELGVVFLLFIIGLELNPSRLWS
FT                   LRHSIFGLGTAQVLLCGAALAALGVYLAGLDTEAAIIIGFGLALSSTAFAMQVLEDRAE
FT                   TNQKHGQRAFAILLFQDLAIVPILAIIPALSPNEPSQASAGFHLATAIASIAALVIAGR
FT                   YLINPMFRIIANTGAREVMIAAALFVVLGSASLLQYAGLSMAMGAFIAGVLLAESSYRH
FT                   ELEADIEPFRGIFLGLFFVAVGLSLNLSVILEYWAVILAAVPIFMATKIVIIYLLCRIF
FT                   RSSHNDAVRIAFLLPQGGEFAFVLFSAASAAAIISSALGSELVAAVTVSMALTPLSVAI
FT                   GSRLLIKDKADDIIEENFDGAGSDVLMIGFSRYGQIAAQILLAGGIDVTVIDSSSNRVR
FT                   AAGKFGFRIYFGDGTRKDVLEAAGIRKAKIVAICTHKKSTTNHIVNLIQSEYPDVRLFV
FT                   RSYDREHTLQLRAQGVEYELRETFESGLLFGQRTLEGLGLSEANAYAIREDVRQRDEDR
FT                   LHVQASEGIMAGRHLLFNKPVTPEPLVKPTREGQRIDKSDDGQRAPSPQETAAAPVAAE
FT                   "
FT   gene            198909..200252
FT                   /gene="pmbA"
FT                   /locus_tag="BMI_II208"
FT   CDS_pept        198909..200252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="BMI_II208"
FT                   /product="pmbA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II208"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49344"
FT                   /db_xref="GOA:C7LH56"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH56"
FT                   /protein_id="ACU49344.1"
FT                   /translation="MISDNSADKLVERAAELVAAAKRAGADEVDAVVMRARSVSVSVRL
FT                   GKVEGTESSESDDFALRVFVGRRIASVSANAGADPHRLAERAVAMARVAPEDPYERLAD
FT                   PSLLVKSPRDLDLFDATEIDTARLTEDALAMEAAALAVSGVTNSGGAGASRSLGGMVLV
FT                   TSTGFSGHYAATRFGRSLSAIAGEGTGMERDYDFSSRLHFADLDAPEAIGRSAGERAVR
FT                   RLGARQAKTGPVTVVYDPRLARGIAGHLASAINGASVARKTSFLRNSLGKPVLKQGINV
FT                   TDNPLRVRGPSSRPFDGEGIEGQPLTMVEDGVLQHWLLSGSSARELGLQGNGRGVRSGS
FT                   GVTPASTNFAIEPGTQSPEELIRAVGTGFYVTEVFGQGVDMISGQYSRGASGFWIENGE
FT                   LAYPVSEVTIASNLKDMFLNMTPASDIDRNFGMAAPTLVIEGMTLAGN"
FT   gene            200284..201048
FT                   /locus_tag="BMI_II209"
FT   CDS_pept        200284..201048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II209"
FT                   /product="inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II209"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49345"
FT                   /db_xref="GOA:C7LH57"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH57"
FT                   /protein_id="ACU49345.1"
FT                   /translation="MLREAAREAGRIAMHYFGRSPEVWLKDGVSPVSEADLAVDRFLKE
FT                   TLLAARPDYGWISEETVDERAAAERSRAFVVDPIDGTRAYIGGQDQWCVSIAIIENGSP
FT                   VAGVLECPVREELLEAGKGLGARQNGCRIHTKVPLAGEEITIAFARNQINALPEQWRGP
FT                   VRVHPYVPSLAYRIAMVARGDIAGTFIRPNSHDWDLAAADLILSESGGAILTSKALPLV
FT                   YGGPTRSHGALVAASGNLLREMLSVVADQPLS"
FT   gene            201087..201338
FT                   /locus_tag="BMI_II210"
FT   CDS_pept        201087..201338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49346"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH58"
FT                   /protein_id="ACU49346.1"
FT                   /translation="MSDAGDNKQLLHLVFGGELKKLDSLEFRDLQNLDIVGIYPDYESA
FT                   KTAWKSKAQQTVDNAHMRYFIVHLHRLLDPNNMTLKAE"
FT   gene            201402..202145
FT                   /locus_tag="BMI_II211"
FT   CDS_pept        201402..202145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II211"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49347"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH59"
FT                   /protein_id="ACU49347.1"
FT                   /translation="MQKKKGGLAKRLWRRIRGPLARSAAVKSILVWLIASYLKLVHATN
FT                   PRLKDSASSEDIVHDFAPFIVTFWHGQHLMGPFLRPKGLELVAMFSRSADAELNARVAE
FT                   KLGLLTVRGSGGRGTRANPEKGGARALLTLKNALRKGQSTSMIADIAHGKAREAGEGII
FT                   LLAKLSGRPIIPLAYAFSRNHVLEKTWDKTTIPLPFGRSTIVRGDPVWVDADADDVQLE
FT                   EKRVELTRQLNRATDRAYAALEKAK"
FT   gene            202142..203482
FT                   /gene="kdtA"
FT                   /locus_tag="BMI_II212"
FT   CDS_pept        202142..203482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="BMI_II212"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II212"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49348"
FT                   /db_xref="GOA:C7LH60"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH60"
FT                   /protein_id="ACU49348.1"
FT                   /translation="MSERWARSILSAYRFLGSAAYPFVGSYIAYRASRGKEDRSRRGER
FT                   YGKSAIARPQGPVIWAHAASVGETIALVPLVERIVATGIHVVMTTGTVTSAKVVADQLG
FT                   SRVIHQYAPLDLQPAVDHFLDHWKPDLVIGCESEVWPATVLSLGSRHIPHVLVNGRMSD
FT                   RSFAAWQKRPALAEALFENFAHVVAQSELDGERFRALGARPVSVSGNLKVDTPPPPSDS
FT                   QALSLMQRQVAGRRTWAAISTHDGEEEIAAEVHQMLKMRYPRLITIIVPRHPDRAPAIE
FT                   AMLAAKGLKVARRSTGQPIEADTDVLLGDTIGEMGLYLQLTEIAFIGNSLTKEGGHNPL
FT                   EPAMMGTAVLTGRNVQNFRESFQRLIKNGGARIVKDRNMLAGAINFLFNNPQHLRAMIN
FT                   AGVTTVRDMRGALDRTLAALEPFIQPLVLQAQLPGNRNEPAFSLDEH"
FT   gene            203485..204510
FT                   /gene="lpxK"
FT                   /locus_tag="BMI_II213"
FT   CDS_pept        203485..204510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="BMI_II213"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II213"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49349"
FT                   /db_xref="GOA:C7LH61"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH61"
FT                   /protein_id="ACU49349.1"
FT                   /translation="MASEAPPFWWDEPDWRALALAPAAWIYGRVSGRRLIRAVPPRVSL
FT                   PVLCVGNFTVGGAGKTPTAIAFARGAIARGMKPGIVSRGYGGNYSGLHLVDPGHDGARH
FT                   VGDEPLLLARHAAVALSPDRVKAAEYLKSLGCDFIIMDDGFQSARLHADFSLLVVDASR
FT                   GIGNGRVIPAGPLRAPLTDQMRKTDALLCIGKGNGADFVIRQAARAGRPIYHAQLRPSS
FT                   SATVAGRRWLAFAGIGNPDKFYESVRQAGGEVVETHSFADHYSFEPDDIRGLVDMARRQ
FT                   GLGLITTAKDHVRLATMPGVPPEFLSKLAVLDVDLEFDRTDALDHILDTVVERFKSRLH
FT                   G"
FT   gene            complement(204524..204760)
FT                   /locus_tag="BMI_II214"
FT   CDS_pept        complement(204524..204760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II214"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49350"
FT                   /db_xref="InterPro:IPR018661"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH62"
FT                   /protein_id="ACU49350.1"
FT                   /translation="MNRFESPRSSEAVLRYLDGDYEIVKHGSFVSCAVTGAPIPLDELK
FT                   YWSVARQEPYASGLISFERELEMNPELRSRKKA"
FT   gene            complement(204858..206729)
FT                   /gene="mutL"
FT                   /locus_tag="BMI_II215"
FT   CDS_pept        complement(204858..206729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="BMI_II215"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II215"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49351"
FT                   /db_xref="GOA:C7LH63"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH63"
FT                   /protein_id="ACU49351.1"
FT                   /translation="MKIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEVV
FT                   TAGGGKTLLRVTDNGSGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGSVS
FT                   KLTLKSRPQDADSGFEVCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKTDRA
FT                   EATAITDVVKRIGIAFPHIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREFGENA
FT                   LAIDAERDGVRLAGFVGIPTFNRGNALHQFAYVNGRPVRDKQIFGALRGAHSDVIARDR
FT                   HPVAVLFLTLDPALVDVNVHPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRPATSGAE
FT                   AMLQAFRAEGFGAQQSAPRPANSYSPASWRTAPPAPRSEWSPQTAHPAHRPLDLQAAPA
FT                   LRENGQAVLGDVAVPAADARASVAEAPVELMQKPLGAARAQIHENYIVAQTEDSLVIVD
FT                   QHAAHERLVYEALKNALHARPIAGQMLLIPEIVDLPEEDAQRLAGHAETLARFGLGVEQ
FT                   FGPGAIAVRETPAMLGEMNVQQLIRDLADEIAEHDTADGLKAMLHHVAATMACHGSVRS
FT                   GRRLKPEEMNALLRDMEATPGSGTCNHGRPTYIELKLTDIERLFGRR"
FT   gene            complement(206913..208196)
FT                   /gene="mucK"
FT                   /locus_tag="BMI_II216"
FT   CDS_pept        complement(206913..208196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mucK"
FT                   /locus_tag="BMI_II216"
FT                   /product="cis,cis-muconate transport protein MucK"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II216"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49352"
FT                   /db_xref="GOA:C7LH64"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH64"
FT                   /protein_id="ACU49352.1"
FT                   /translation="MRTINENTATKTSRAAVRPEHNRIWILVFIFSFLGLMIDGADLML
FT                   LSYSLTSIKAEFGLTSVEAGSLGSITLAGMAIGGIYGGWACDRFGRVKTVSWTIVLFSI
FT                   GTAVLGLTHSYFQFAVARFVSSLGLGALYVACNTLMAEYVPTKYRTTALGTLQAGWSVG
FT                   YIVATVLAGAILPVYGWRYLFFVAIVPVIIALLMHKGVPEPESWVRAKAERESGGSKFT
FT                   TAKRESAFKAIFGNPRVRTLFIFWALTAGFLQFGYYGVNNWLPSYLETEMGMNFKSMTA
FT                   YMIGSYTAMILGKVLAGVAADWLGRRAVFALGALGTAAFLPIIVLYHSPDTILWMLVVF
FT                   GFLYGVPYGVNATYMAESFEAKYRGTAVGGAYNIGRAGAALAPVAIGFFASQISIGFGF
FT                   LVMGGAYFICGVIPALFIREKQFDPEKQ"
FT   gene            complement(208294..209448)
FT                   /locus_tag="BMI_II217"
FT   CDS_pept        complement(208294..209448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II217"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II217"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49353"
FT                   /db_xref="GOA:C7LH65"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH65"
FT                   /protein_id="ACU49353.1"
FT                   /translation="MIRDPETLEILRDTVSQFVSETLIPRENEVAETNAIPADIIAQMK
FT                   ELGFFGLTIPEEFGGLGLTMEEEVNVAFELGRASPAFRSYIGTNNGIGSIGILIDGTDE
FT                   QKRNYLPRLASGELLSSFCLTEPDAGSDAASLKTTAVRDGDFYILNGTKRFITNAPIAD
FT                   IFTVMARTAADVKGADGISAFIVERNSPGLSLGKPDQKMGQKGALTSDVIFENVRVPAS
FT                   QLIGGVEGKGFKTAMKVLDKGRLHIAALSTGAAERMLADTLAYALDRKQFGKPIADFQL
FT                   IQAMLADSKAEIYAAKCMVLDAARKRDSGQNVSTEASCAKMFATEMCGRVADRCVQIHG
FT                   GAGYVSEYAIERFYRDVRLFRICEGTTQIQQIVIARNMIREARR"
FT   gene            complement(209505..210359)
FT                   /locus_tag="BMI_II218"
FT   CDS_pept        complement(209505..210359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II218"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II218"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49354"
FT                   /db_xref="GOA:C7LH66"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH66"
FT                   /protein_id="ACU49354.1"
FT                   /translation="MRSRTGSDASRRQERSAEMRKPTMLTPLEAGVEEEDRQFVTALAR
FT                   GLEVLRCFTPTENTLGNQEIAHKTGLPKPTVSRLTHTLVRLGYLRQDALSGLYQLDIGI
FT                   LRLGYAMLSNLMIRTVASPLMQVLADYAKAAVAMAARDRLSMVYLDVVQGEGNMTMRRQ
FT                   IGSTLPLAGSSVGRACLAAMPEDERTFILEHIREREPENWPSIRKGLDRALRDFEDYGY
FT                   CLSIGEWHRDVNSVAVPLVHKQYGVLVFNCGGPSFQLPREKLEDDIGPRLIEMVHNISS
FT                   AVP"
FT   gene            210619..211380
FT                   /locus_tag="BMI_II219"
FT   CDS_pept        210619..211380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II219"
FT                   /product="enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II219"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49355"
FT                   /db_xref="GOA:C7LH67"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH67"
FT                   /protein_id="ACU49355.1"
FT                   /translation="MSVERHADGVATVRINRPEARNALNLTTRQQLAEHFRALSGDESV
FT                   RAIVLTGGETCFVAGADVREFASAGPIEMYLRHTEYLWDAIASCAKPVIAAVNGYALGG
FT                   GCELAMHCDIIVAGEGAVFGQPEVKLGLMPGAGGTQRLIRAVGKFQAMRIALTGCMVPA
FT                   AEALSIGMISEMTANERTLPRAHELAVEIARLPALAVAQIKEVMLVGADLPLDGALALE
FT                   RKAFQLLFDSKDQKEGAAAFLEKRKPAYNGR"
FT   gene            211385..212914
FT                   /locus_tag="BMI_II220"
FT   CDS_pept        211385..212914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II220"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49356"
FT                   /db_xref="GOA:C7LH68"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH68"
FT                   /protein_id="ACU49356.1"
FT                   /translation="MERSINHIAIVGAGVMGTGIAQIAAQAGLVTQIFDAREGAAAASR
FT                   DRLASTLAKLAEKGKISAEDAQTAVSRIEICSSIQELADCDLVVEAIVEKLDAKQALFL
FT                   ELEAVVSGNCILATNTSSLSVTSIARVCRHPERVAGFHFFNPVPLMKVVEVIDGLTTDP
FT                   AVGDALLVLAKRMGHHGIRAKDMPGFIINHAGRAYGTEALKILGECVAPRGDIDRILRE
FT                   SAGFRMGPLELFDLTGLDVSHPVMESIYNQFYQEPRYRPSALTRQMLEGGYVGRKVGQG
FT                   FYRYEDGKMVAPPVPQPVPAVDIMPSVWISADCDEDKEQLYALLRSLGATVETGALPSA
FT                   EALCLLAPYGYDATTACELAGSDPARTVCIDMLPGLDRHRTLMMTPATSPAFRDAAHAL
FT                   LARDGVNVTVIRDSVGFVAQRTLAAIVNLACDIAQQGIATADDIDQAVRLGLGYPQGPL
FT                   AWGDALGASRILKILSRMLELTGDPRYRPSPWLRRRAALGLSLRSAEPDID"
FT   gene            213137..214378
FT                   /locus_tag="BMI_II221"
FT   CDS_pept        213137..214378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II221"
FT                   /product="CAIB/BAIF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II221"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49357"
FT                   /db_xref="GOA:C7LH69"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH69"
FT                   /protein_id="ACU49357.1"
FT                   /translation="MGALTGYRVLDMSRVLAGPWCGQILADLGAEVIKIERPRTGDDTR
FT                   DWGPPWMKDEQGNPTREASYYQSANRGKFSVALNIASPEGQDLLRKMVAECDVLIENYK
FT                   AGSLAKYGLDYETLSAINPGLVYCSVTGFGQTGPRAPEPGYDFIIQGIGGLMSITGERD
FT                   DKPGGGPQKVGVAVADLMTGLYSAIAIEAALLSRAKTGKGQHIDMALLDVQVAALCNQS
FT                   QNYLASGRPPGRYGNAHANIVPYQVFRASDRDFIIACGNDAQFVSLCDAIGLPDLPKDP
FT                   RFTRNSDRVIHRDEIIGILAAHFLTGTADEWIGRIHPRGVPVGAINDIARALDEPQVKA
FT                   RNMLVQIPHPLNKDFVTVGSPIKLSGTPVEYKRAAPMLGEHTDTLLQQLAKLDDDRLND
FT                   LKSRGIIEQFNSGE"
FT   gene            complement(214362..215636)
FT                   /locus_tag="BMI_II222"
FT   CDS_pept        complement(214362..215636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II222"
FT                   /product="FMN-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II222"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49358"
FT                   /db_xref="GOA:C7LH70"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH70"
FT                   /protein_id="ACU49358.1"
FT                   /translation="MSLFSPLVLNNGATIPNRIAKAAMEENMADADHAPSAGLLRLYKA
FT                   WAEGETGLIITGNVMVDARAMTGPGGVVLEDDRHLDRFQAWAEAGRTRGAHIWMQINHP
FT                   GRQMPAALGQETLAPSAIALDLGAQSKRFPIPREMSEADIADVERRFINTAQLAERADF
FT                   TGVEIHAAHGYLLSQFLSPLSNRRQDRWGGSLENRARLLVNIVRGIRAAVSPGFCVAVK
FT                   LNSADFQRGGFSPEDARAVVMMLAPLGVDLVELSGGSYEAPAMMGSARDERTLAREAYF
FT                   LDFARDIAEIATMPLMVTGGIRRREVAEQVIESGIAMAGIATALAIEPNLPRNWRLGRA
FT                   DAPKLKPIAWKNKPLAASAHMAAVKYQLTRLSCQRRTAPGISPVWALAVSQIDAFFRAR
FT                   RYRQWMVDRRATPGRYRPDQFIRQS"
FT   gene            215722..216186
FT                   /locus_tag="BMI_II223"
FT   CDS_pept        215722..216186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II223"
FT                   /product="transcriptionnal regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II223"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49359"
FT                   /db_xref="GOA:C7LH71"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH71"
FT                   /protein_id="ACU49359.1"
FT                   /translation="MKIGELAKRSGLAASRIRFYESIGLLKTVDRRSNGYRTYPEEAVL
FT                   VLHLIATAQKAGFSLDEIRTLLPPDLDNWEHDALIEVLRRKVADIEALEARLARSKLQL
FT                   LGLISDIEAKPDDMACADNARRVLSRLMAEEMEAPASLQDEGRPHRRTTI"
FT   gene            complement(216232..216939)
FT                   /locus_tag="BMI_II224"
FT   CDS_pept        complement(216232..216939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II224"
FT                   /product="ThiJ/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II224"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49360"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH72"
FT                   /protein_id="ACU49360.1"
FT                   /translation="MGKRVLHVVTNVAHYADPSQPTGLWLSELSHAHDVFAAKGYDQHI
FT                   VSPKGGVSPLEPRALKWPLLDTSAKAWLADPARMALLTTTARPDQIDPADYDAIYFTGG
FT                   HAVMWDFPDSQGLQNITRAIWEQGGIVSSVCHGYCGLLNTRLSDGSLLAAGKRLTGFSW
FT                   MEEILAGVSSRMPYNAEQEMKRRGAHYQKAFLPFISYVVADGRLVTGQNPASAKATAEK
FT                   VVALMEMRSNPLF"
FT   gene            complement(217170..218510)
FT                   /locus_tag="BMI_II225"
FT   CDS_pept        complement(217170..218510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II225"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II225"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49361"
FT                   /db_xref="GOA:C7LH73"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH73"
FT                   /protein_id="ACU49361.1"
FT                   /translation="MRPRSLQWRISLWLGLGISMLWAIAALVTASQLSREMNVVFDSAL
FT                   EETAQRILPLAVLDITERESDDEMNQRMATLRKHDEYFTYVVRNTAGEVLLQSHSADLS
FT                   IFPPFTTMGFQTTPTHRIYFDAALQGAVNIAVAEPLGARRGVAMQVLWRLALPLGLVIP
FT                   LSLIGVWAIVRVSMAPLWAFRSDIEARGSGDLSPVTVNDLPSEVSPIAQAVNRLMDKLK
FT                   RALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSRLSE
FT                   KLMQLAKAEGGRLHAAEPIDMGVILRMVVRELSQPHGNENRIRLSIPDMAVKIDIDADA
FT                   FAILARNLIENALKHGPHDEPVEVLLTASGKLVVSNGGPAVPPDILERLSHRFERGATK
FT                   AEGTGLGLAIAKAIAAGTGGTIDLFSPREGRKDGFEVRFTPGGRVLH"
FT   gene            complement(218510..219187)
FT                   /locus_tag="BMI_II226"
FT   CDS_pept        complement(218510..219187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II226"
FT                   /product="two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II226"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49362"
FT                   /db_xref="GOA:C7LH74"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH74"
FT                   /protein_id="ACU49362.1"
FT                   /translation="MRIILIEDDPILGAAVRDHIAAEGHCVDWVSRLDTAHDYMESARY
FT                   DLVLLDLMLPDGQGLSFLRDLRTKGCSTPVIILTALDQISDRIQGLNAGADDYLTKPFD
FT                   LSELSARLNAVARRYSGNPNPLIEIGGLQIDLAAKSVMRDGRALCLTAREWALLEAFLQ
FT                   HPGQTLSKAQLEEHLYSFDTEVESNTMEVHVSRLRKKLGHAIIETVRGIGYRLGNSKSK
FT                   AAR"
FT   gene            219451..219723
FT                   /locus_tag="BMI_II227"
FT   CDS_pept        219451..219723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II227"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49363"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH75"
FT                   /protein_id="ACU49363.1"
FT                   /translation="MAASLGWNVKRIKIDDGCYEIKGLNEAGKPFKAKINPQSLAIMKL
FT                   KVKGMDDDRDHRRNRQQHGDAPGPLDGVPANKLIQKGSTPKVQVQ"
FT   gene            219891..220361
FT                   /locus_tag="BMI_II228"
FT   CDS_pept        219891..220361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II228"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49364"
FT                   /db_xref="InterPro:IPR014469"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH76"
FT                   /protein_id="ACU49364.1"
FT                   /translation="MKSLLSALAITTALTFPGLALAQPVTLSTTLNNYGGDGAYIALYV
FT                   TDAQGAYAGSLWMAGGKSKYYQHLSGWYRATGGDTAEIDGITGASVGAGRKLEITLDLA
FT                   DALFDAGYTLHVDAAVEDMQDSPDEIALPLTSKGSGVPVRGRRYIANFTYTK"
FT   gene            220372..222576
FT                   /locus_tag="BMI_II229"
FT   CDS_pept        220372..222576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II229"
FT                   /product="oxidoreductase, FAD-binding, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II229"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49365"
FT                   /db_xref="GOA:C7LH77"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH77"
FT                   /protein_id="ACU49365.1"
FT                   /translation="MIRWLHRWSGIIAAVLLMVLALSGAALSVFPAMERLSAPQAETGL
FT                   SVADLMARIQANYPAVEQVRRTPSGKITAYWFDDGAPQAAVIDPATGKSFAPANPNRLE
FT                   QWLKGLHRSLFLGDSGRIVMAIGALIMLGLSISGAFLIARRTGGWKNWFKPLRGAASGR
FT                   LHTEVARIAVLGLLLSSTTAVWMSASTFDLLPKSPVVAEPTGVSGETGMKPALIAKLEE
FT                   TPVSSFKELSFPYPGDATDMFVLKTDRGTGYLDQGTGAVLDWHDYTVWQRISQTVKMLH
FT                   TGKGAALLGIILGLASLTVPFLGITGIVLWFAGLRGRPRIRDNAAAGKAETIVLVGSEG
FT                   GSTWGFAATLHAALREAGQSVHVGPMSSFNPARYGKAQRILIFAATYGNGDAPASAKGF
FT                   LDRLAALPKSPAAPLAVLGFGDRSFPDYCAFAKAIADGARAKGWKELIPFETVDRQSTQ
FT                   DFARWGRDLGAAIGIKLELVHQPVIPAVAALTLVSRRDYGADVQAPTAILRFALPKPTF
FT                   WQQLSGAGFSRFEAGDLLGIVPEGSAVPRFYSLASGSRDGFVEIVVKKHPAGLCSGQLF
FT                   ELQPGDTMRAFLRRNANFHAGKGRTPLILVGAGTGIGPLAGIVRANRQHRPVHLFFGMR
FT                   HPESDFFYHEDLQEWQGEGRLQNLTTACSRVHNPSYVQDALRKDAAEIARLVNKGARVM
FT                   VCGGRDMAAGVSEALADILAPAGLTPAVLKAEGRYVEDVY"
FT   gene            222557..223534
FT                   /locus_tag="BMI_II230"
FT   CDS_pept        222557..223534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II230"
FT                   /product="ApbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49366"
FT                   /db_xref="GOA:C7LH78"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH78"
FT                   /protein_id="ACU49366.1"
FT                   /translation="MSKMFTDLKRHGLNGPTMRTRWSAIFYAAADFDIAPLRRALQQAV
FT                   DEVDMQMSTWKPDSDLMRLNRAPVGVWVEVPARLMEVLRLAIEIGRATGGAFDAAMGDA
FT                   VKAWGFGPMEADQRLISEALAGPRVAAHDALELDISAMRVRKRAAVTLDLNGIAKGYGV
FT                   DRLADTLESFGIHSGLVGIDGEMRALELRPDGTPWAIAVEMPDYNRRAPHSVLALHNGA
FT                   VATSGDYRHWVVAGGHRLSHTMDPHRGAPLSTPPASVTVVAKTCAQADAFATALMVLGP
FT                   IAGSKLAQSLGLDVLFLLRDGETIRPQPVGALFSGHPYPLQKLG"
FT   gene            complement(223577..224752)
FT                   /locus_tag="BMI_II231"
FT   CDS_pept        complement(223577..224752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II231"
FT                   /product="GAF/GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II231"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49367"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH79"
FT                   /protein_id="ACU49367.1"
FT                   /translation="MTSSQCFLCLILLLLFIGFAAFAIPRILVNRKVHKAIVDLKDYVS
FT                   HASNQNVRMTGEVDILRAIVKRHPLEQTLTMLCRFVEKQIPGTRCSVLILDPSGKKVGK
FT                   SIAPSLPTHYNKALIGLEIGPNIGSCGAAMFLRRPVIISDIATHPNWLSFRDLALPCGL
FT                   RACWSMPAINGAGKVLGAFAIYSDTPRTSAQNELMVGQIAVELSMIAVDTAQTQERLAS
FT                   QAMHDDLTQLPNRRYIGKLLTQKKSARDGLSRDGFLLLIDLDDFKPVNDTYGHLTGDEV
FT                   LKEVAQRLLRIVCEEDTVARMGGDEFMIVLNGGTSKEQTDIIASRIIREVSKPIEVSQH
FT                   KPVKVGCSIGIVSTREWRSNKYIFDCADKAMYSAKSKGKNRFEYFEEKQAA"
FT   gene            complement(225035..225928)
FT                   /locus_tag="BMI_II232"
FT   CDS_pept        complement(225035..225928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II232"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49368"
FT                   /db_xref="GOA:C7LH80"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH80"
FT                   /protein_id="ACU49368.1"
FT                   /translation="MPIYELAALGAATCWALTGLISAWPAGQLGALTFNRIRQVFVTGL
FT                   LAVYVLATGAWHQMSAENIWPLLLSGFIGIFVGDTLLFATLNRVGPRRSGILFAMNAPM
FT                   TAILGWFVLGETLSLAAVAGIAITVFGVSLAIFFGKRRTQQHPWESVKGSLWVGIGLGL
FT                   LAALGQAVGSIIARPVMETGLDPFVGSLLRVGIAACCLTALAQLPLPAVKPRNPLTFKV
FT                   AAMTALTGFLSLALGMTMLLFALSGGKAGIVSTISATTPVILLPLLWLRTGECPAAGAW
FT                   IGAFFVVIGMALIFLR"
FT   gene            225904..226044
FT                   /locus_tag="BMI_II233"
FT   CDS_pept        225904..226044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II233"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49369"
FT                   /db_xref="GOA:C7LH81"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH81"
FT                   /protein_id="ACU49369.1"
FT                   /translation="MLPAHKSAWCPYNILSARQRCRLRILPAGLPLLSVCKIAVYFFLV
FT                   K"
FT   gene            226168..226845
FT                   /locus_tag="BMI_II234"
FT   CDS_pept        226168..226845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II234"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II234"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49370"
FT                   /db_xref="GOA:C7LH82"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH82"
FT                   /protein_id="ACU49370.1"
FT                   /translation="MERKRGSGVRMVYDLLRDEILDLKLAPGSPIDEVQLAERFGMSRT
FT                   PIREALVRLSSEGLVETLPNRSTMVSNIDFLNMHTFFDALVLMYRVTTRLAAQYHRPED
FT                   LRIIHELQAQFTAAVDAQNALGMIATNAAFHAAIADAGRNAYFTGLFNRLLDEGRRIMR
FT                   LYYQSYDDRLPRRFVEEHEEIIAAIEARDVAQADRLGKIHAEQIVEQVRKLFERKAVLD
FT                   IEL"
FT   gene            226946..227908
FT                   /locus_tag="BMI_II235"
FT   CDS_pept        226946..227908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II235"
FT                   /product="dihydrodipicolinate synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II235"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49371"
FT                   /db_xref="GOA:C7LH83"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH83"
FT                   /protein_id="ACU49371.1"
FT                   /translation="MKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVVY
FT                   CGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLMVI
FT                   PRVLSRGSVIAAQKAHFKAILSAAPDLPAVIYNSPYYGFATRADLFFALRAEHPNLVGF
FT                   KEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIH
FT                   LCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFN
FT                   ETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA"
FT   gene            complement(227971..229008)
FT                   /locus_tag="BMI_II236"
FT   CDS_pept        complement(227971..229008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II236"
FT                   /product="malate/L-lactate dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II236"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49372"
FT                   /db_xref="GOA:C7LH84"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH84"
FT                   /protein_id="ACU49372.1"
FT                   /translation="MTDGTNLTIEKLHARVEEIFRKARLNAIQAGAVARVIVAGERDHC
FT                   KSHGIYRIEGALRTVKAGKVKPDAVPELVAQEASAIVRVDAKGGFANPAFELGVPVLAE
FT                   RARSHGLAALVINDCTHFSALWPEVEALTEKGLAGLVMCPSYATVAPTGGSKPLLGTNP
FT                   FAFGWPRRDNPPYVFDFATSVAARGEIELHRRAGKQLPEGWAIDKDGKPTTDPETALEG
FT                   AMLPFGGHKGSAISTMIELLAGIMIGDRTSPEVLDFLGTTTLSPVHGELIIAFSPEAFA
FT                   AGRPGDPFARAEAFFEAIVGQGARLPSQRRFTARAASQSEGITLNKAEIDYLDQLAEKG
FT                   LDAVS"
FT   gene            complement(229127..229225)
FT                   /locus_tag="BMI_II237"
FT   CDS_pept        complement(229127..229225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II237"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49373"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH85"
FT                   /protein_id="ACU49373.1"
FT                   /translation="MAYPERYFTAMDEKLSENAEWHFAKPVFSANG"
FT   gene            229245..230513
FT                   /locus_tag="BMI_II238"
FT   CDS_pept        229245..230513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II238"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49374"
FT                   /db_xref="GOA:C7LH86"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH86"
FT                   /protein_id="ACU49374.1"
FT                   /translation="MLAKALRKFSGDRVALLRDYLSLFSGSAGRLVVSLVYFIALANTL
FT                   PTSDFGIFATASGTGVMLSRLVSLGFNSPLYRIATVKPRLLGVYTAGYLAALVVSLPLL
FT                   FLASWLVYLAFFDRDVAFLPFALVVIVAEALFWRSMEIIIIVNNGLNRFLIGAGLVIFG
FT                   TMTRAVAAVLFMWMTTTHDIAHWAWWYAGANAAGLIVALWFYPRIRLRFKPGLYMRRIS
FT                   DSIAVMGAELLFYLQSELDKLLVLGIGGPATAGLYAIIMRLVDLTALPIRSFNMMLVQK
FT                   LMRTPDMLSSLRIRTGLEVAVFAISVAGLGALAIFLWIFPNALGSNVAPIVGLLPLVLL
FT                   VPGFRNLIEYQTEILYARGQSGLRTLNLALMTGAKALLVWQLLSHFGESRDWLLGLNVV
FT                   FAGLYILSLVFTYTSIRRPAKRI"
FT   gene            complement(230521..230994)
FT                   /locus_tag="BMI_II239"
FT   CDS_pept        complement(230521..230994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II239"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49375"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH87"
FT                   /protein_id="ACU49375.1"
FT                   /translation="MENLSELHAADINRLEAHHQTLLDLCLQLEEAAEDVQTPGSPQDY
FT                   IKLADAIPRLLDETHELEETVLFPDFHRQSGSYFAGVVIERLKAEHRCDRLSAEELSRT
FT                   LRAVANGQCKLAPDTVAYMVRGFLESLRRHILSEKLMLEALLAAKSEQREVFG"
FT   gene            231310..231879
FT                   /locus_tag="BMI_II240"
FT   CDS_pept        231310..231879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II240"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49376"
FT                   /db_xref="GOA:C7LH88"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH88"
FT                   /protein_id="ACU49376.1"
FT                   /translation="MLRSEDNAIAALAAGEGQEEEDSLLLWVLVWSELITFAILLVAFM
FT                   VMSVVDPQGVGLLRAHLSPGLAATNTVILLMSGWQAALAVRRRNNPKAVRRPLLFAALF
FT                   GFCFVAVKLLEYSHEARFAGDEAAGSFFELYFLITGFHLLHVLFGSVILMLVAWRPSRS
FT                   NVLLIATLWHAIDLVWLVMFPILYLA"
FT   gene            231887..232165
FT                   /gene="norF"
FT                   /locus_tag="BMI_II241"
FT   CDS_pept        231887..232165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norF"
FT                   /locus_tag="BMI_II241"
FT                   /product="nitric-oxide reductase NorF protein"
FT                   /EC_number="1.7.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II241"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49377"
FT                   /db_xref="GOA:C7LH89"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH89"
FT                   /protein_id="ACU49377.1"
FT                   /translation="MTDTTVHGSLNRTLAILLVLAVSGALIASFLGTYLAGIVVVLILA
FT                   YAKACFVILDFMEMRGTRGALRPALLTWPAILLTLALARSVAVSLLG"
FT   gene            232325..232777
FT                   /gene="norC"
FT                   /locus_tag="BMI_II242"
FT   CDS_pept        232325..232777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norC"
FT                   /locus_tag="BMI_II242"
FT                   /product="nitric-oxide reductase, small subunit"
FT                   /EC_number="1.7.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II242"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49378"
FT                   /db_xref="GOA:C7LH90"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH90"
FT                   /protein_id="ACU49378.1"
FT                   /translation="MAERLTKTGARNVFYGGSIFFFAIFVGLTAHSHYYMKTTSTDEST
FT                   LTSGVARGKHVWEKNSCINCHTLLGEGAYFAPELGNVWKRWGGDTDPESARETLKAWMA
FT                   AQPSGIEGRRQMPQFSLSDQELDDLADFLEWTSRIKTQNWPPNDAG"
FT   gene            232803..234152
FT                   /gene="norB"
FT                   /locus_tag="BMI_II243"
FT   CDS_pept        232803..234152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="BMI_II243"
FT                   /product="nitric-oxide reductase, large subunit"
FT                   /EC_number="1.7.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II243"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49379"
FT                   /db_xref="GOA:C7LH91"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH91"
FT                   /protein_id="ACU49379.1"
FT                   /translation="MKYQSQKVAMLYFYGALALFVAQVLFGVVAGTIYVLPNTLSVLLP
FT                   FNIVRMIHTNALIVWLLMGFMGSTYYLLPEETETELYSTKLAVIQFWLFFVAAGVAVAG
FT                   YLFHIHEGREFLEQPFFIKVGIVVVCLIFLFNITLTALKGRKTTVTNILLFGLWGLALF
FT                   FLFAFYNPINLALDKLYWWYVIHLWVEGVWELIMASILAFLMIKLNGIDREVVEKWLYV
FT                   IVGLALFSGILGTGHHYYWIGAPGYWQWIGSLFSTLEVAPFFTMVMFTFVMTWRAGRKH
FT                   PNRAALLWSIGCSVMAFFGAGVWGFLHTLSSVNYYTHGTQLTAAHGHLAFFGAYVMLNL
FT                   AVMAYAIPEIRGRAPYNQWLSMVSFWMMCTAMSVMTFALTFAGVVQVHLQRVLGENFME
FT                   VQDQLALFYWIRLGSGVVVVISALMFVWAVLVPGRQRSQKLSGFAQQPAE"
FT   gene            234243..235055
FT                   /locus_tag="BMI_II244"
FT   CDS_pept        234243..235055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II244"
FT                   /product="nitric oxide reductase NorQ protein"
FT                   /EC_number="1.7.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II244"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49380"
FT                   /db_xref="GOA:C7LH92"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH92"
FT                   /protein_id="ACU49380.1"
FT                   /translation="MTSLLKNVETASPAIPAYSPSGNECALFEMAWQRKLPLLLKGPTG
FT                   CGKTRFVSHMAARMGLPLSTVSCHDDLAAADLTGRYLLKGGDTIWMDGPLTRAVRDGGI
FT                   CYLDEIVEARKDVAVVLHPLTDDRRILPLERTGELLDAPDSFMLVVSYNPGYQNLLKSL
FT                   KPSTRQRFVAIEFDFLPKEQEIAVVSEESGLAESRVAPLVDLAHRLRALKGHDLEEGVS
FT                   TRLLVYCAALIEAGMSQREAARAAMIEPLTDEPDVKAALLEIADAMLK"
FT   gene            235067..236968
FT                   /gene="norD"
FT                   /locus_tag="BMI_II245"
FT   CDS_pept        235067..236968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norD"
FT                   /locus_tag="BMI_II245"
FT                   /product="nitric-oxide reductase NorD protein"
FT                   /EC_number="1.7.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II245"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49381"
FT                   /db_xref="GOA:C7LH93"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH93"
FT                   /protein_id="ACU49381.1"
FT                   /translation="MLDFLELEETVGRAWHRLIGKTGSWPQYPDHAVQLVDIRQRLAIC
FT                   FRGFGGDIAVQIAPARARTSTHRLGLRQQMALGEEKLAQPLRDEATLMLPPEIALFPDR
FT                   QLNYDLYVWLVGYMAVMPMDADALPEDALRRDLAALQIAEQTVERACRAFPGLKPRYKR
FT                   LCAAILAERPKRPLHRLEQQVEARILSLLKQGADLPDDALPTIFPHRGPAGYLPALPVP
FT                   LWPGLMKREEVAPRTGEDEPVRNSQSEGAETGRQIAQRERQDPRHADRSPFILNRFEKI
FT                   LAMAEMVSVDRPSDDSDEQNAKSADELDDLTLGERKGRPAARFRFDLDLPPEAVDRSLL
FT                   TAELTYPEWDYRKGAYLPDHCAVLAAPVQEKEKPLELDAAAQSLVRRVRRRFEILRPGR
FT                   EVLRAQLDGTDLDLDAVVRSRCDLAAGGQGSDRVHLMSRPQANDLAVTLLVDVSLSTDA
FT                   WVDNRRVLDVEKEALLVLANGIAACGDRCSILTFTSRRRSWVRVETVKDFDESFGPTVE
FT                   HRIAALKPGFYTRMGAAMRHATAKLAEQPNRKKLLLLLTDGKPNDVDHYEGRFALEDSR
FT                   RAAGEARAKGVNVFAVTVDREASAYLPALFGRGGYALVANLAKLPVALPAIYRMLAG"
FT   gene            237148..237432
FT                   /locus_tag="BMI_II246"
FT   CDS_pept        237148..237432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II246"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49382"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH94"
FT                   /protein_id="ACU49382.1"
FT                   /translation="MSSQPVSTIPVIDVRTIPPITRHATIFSMIDTLEPGEVLEIVNDH
FT                   DPVPLRNQLEHRNPGAFSWVYKETGPLWRVEIGRRKVHASDHECTCGNH"
FT   gene            237468..238835
FT                   /locus_tag="BMI_II247"
FT   CDS_pept        237468..238835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II247"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49383"
FT                   /db_xref="GOA:C7LH95"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH95"
FT                   /protein_id="ACU49383.1"
FT                   /translation="MFGATLSRWTLSYFASSLAFLIAGVGLMVEGFGYPFHGIRAPETL
FT                   ILVHIIAIGWLALLMGGALLQFVPVLVARPLWGSGGGLPALLLLLAGLVGLLCGFAGMA
FT                   GFGEPPAWLLPFSGLLLIAGFSILVLMLAMTIWQARPIALPARFVAVGLACLLAVAFLG
FT                   GIFTLAFSGMSENDMLLNIAGLSAPIHAALGLGGWMTFTAMGVSYRLLTMFLLSPDDER
FT                   RTTRLVWWAGAAALTVLGAGVAAFAFGQDRADVVLLAALLPGVASVVLYAFDMRAVYRQ
FT                   RKRKAIELNSAASIPAFAAMVLAILLALALPWTGPSDPMIGALVYLFVFGWLTGLSLAQ
FT                   LYKIVPFLTWLECYGPVMGRVPTPRVQDIVSEKPARRWFCIYYTGVALATLALGAGYPV
FT                   AFQLASALNLIAILALTVHFFRARRLMDVPEAVRLPNGVAIPHLIYAGGPVPRRSK"
FT   gene            238832..239359
FT                   /locus_tag="BMI_II248"
FT   CDS_pept        238832..239359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II248"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49384"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH96"
FT                   /protein_id="ACU49384.1"
FT                   /translation="MTVQELAPYELDVRPLLKSGVEPFQAIMGAVDSLAPGQGLLLIAP
FT                   FKPVPLFAVLERKGFEAKPEPIGEGDWQVLFSPVVEPLAEVQLSKNVGSPDIWPDPLQY
FT                   LDCTDMDPPEPLVRILAEVENMSAGEVLFALLHREPLFLFPELENRGHQWVGNFDETGK
FT                   TYRIMIRVGGGG"
FT   gene            239366..239692
FT                   /locus_tag="BMI_II249"
FT   CDS_pept        239366..239692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II249"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49385"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH97"
FT                   /protein_id="ACU49385.1"
FT                   /translation="MEPKQLERIEACVREALRAVQDPELAVNLVDLGMIYAVEISDDGM
FT                   VHVKMTTTTRGCPAAGFLTQAVQACIEEIEGVTGARVELTYEPEWKPEMAIPEVQAIFA
FT                   APSF"
FT   gene            239816..240991
FT                   /locus_tag="BMI_II250"
FT   CDS_pept        239816..240991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49386"
FT                   /db_xref="GOA:C7LH98"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH98"
FT                   /protein_id="ACU49386.1"
FT                   /translation="MQHPVRRRAIFFIGGYDPKTPEAFFNRLLREIARFGALWDVKTQV
FT                   SPVSENASSEIGSVTIETRSAEGWSTQTDFNFLVLDKIVLADFARPLPVRLWKYLVAFA
FT                   DFVLSGTAFRFFARAWRFALYFLYPFLALVLFALAGWLAARLTAPWLGLAGWIVGLFVF
FT                   FLALATLGNRWSTNHLMDLWSFSRNFMRGQRPDAEALMQRFAEEIDRRVAAGHYDEVIV
FT                   IGHSTGGMLMLDVAARCLAADRAFATRAPKVVLLTLGSTALKAGYHPAAGKFRQDVQRL
FT                   VDEPALEWCEVQCLTDVINFYKTDPVAEMKLKRPADRAFPLVRQVRIKDMLQPDIYRRI
FT                   KRNFFRVHYQYVFGNTKAYWYDFFQICCGPASLSERMRDMLVGTAKESAQQ"
FT   gene            240988..241572
FT                   /locus_tag="BMI_II251"
FT   CDS_pept        240988..241572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II251"
FT                   /product="isoprenylcysteine carboxyl methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II251"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49387"
FT                   /db_xref="GOA:C7LH99"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:C7LH99"
FT                   /protein_id="ACU49387.1"
FT                   /translation="MMPLIALIVWSIGLVAWVVIRIPHQRRARKIKVARTARTLADRLA
FT                   LGAATVGLSVVPLVYVATGFPKFADYTFQPWMGWIGTLIELLFLWLFYASHKQLGKNWS
FT                   VSLDIRREHKLVTDGLYRYVRHPMYLSFWLWAIAQFFLLPNWIAGLAGLLGVAILYFYR
FT                   IEHEEAMMREAFGSAYDEYSSRIGRIIPKPW"
FT   gene            241523..242221
FT                   /locus_tag="BMI_II252"
FT   CDS_pept        241523..242221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II252"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49388"
FT                   /db_xref="GOA:C7LHA0"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012367"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHA0"
FT                   /protein_id="ACU49388.1"
FT                   /translation="MTNIPAASAVSFPNPGKSAAAETDRMNRRSLLLGLLAGAALVLPS
FT                   LPAEAKTQQAAMPPNATSPHQADVYLLRGFADIFSTGIDEIGAELQAAGVNAHVQGHAA
FT                   WRLVLNRIVADQQKNGHLPVVLIGHSLGANAAIYIAEELERRGIAVDYMATFAATGPDP
FT                   LPGNVRRVVNFYFKQHGWGLPLVPGPRFHGHLENRDFSNAKDVGHFNIEKQRPLQAEVV
FT                   RDVLAVVNAD"
FT   gene            242297..242446
FT                   /locus_tag="BMI_II253"
FT   CDS_pept        242297..242446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II253"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49389"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHA1"
FT                   /protein_id="ACU49389.1"
FT                   /translation="MKNHNFYWAIPLIEERICAARRLKNSGAALVLCLNANNREDHAEY
FT                   NLTI"
FT   gene            242577..243707
FT                   /gene="nirK"
FT                   /locus_tag="BMI_II254"
FT   CDS_pept        242577..243707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirK"
FT                   /locus_tag="BMI_II254"
FT                   /product="copper-containing nitrite reductase"
FT                   /EC_number="1.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II254"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49390"
FT                   /db_xref="GOA:C7LHA2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHA2"
FT                   /protein_id="ACU49390.1"
FT                   /translation="MADQIQVNRRTILAGAALAGALGPVLSATSAWGQGTMRKASAEEI
FT                   AALPRQKVELVDPPFVHAHTQVAEGGPKVVQFTMVIEEKKIVIDDAGTEVHAMTFNGTV
FT                   PGPLMVVHQDDYLELTLINPETNTLLHNIDFHAATGALGGGGLTEINPGEKTVLRFKAT
FT                   KPGVFVYHCAPPGMVPWHVVSGMNGAVMVLPREGLHDGKGNKLTYDKVYYVGEQDFYVP
FT                   RDENGNYKTYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKALTAKVGEKVLIIH
FT                   SQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAAAAFYTFRQPGIYAYV
FT                   NHNLIEAFELGAAAHFKVTGEWNDDLMTSILAPSGM"
FT   gene            243841..244761
FT                   /gene="nirV"
FT                   /locus_tag="BMI_II255"
FT   CDS_pept        243841..244761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirV"
FT                   /locus_tag="BMI_II255"
FT                   /product="nitrate reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II255"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49391"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHA3"
FT                   /protein_id="ACU49391.1"
FT                   /translation="MAKVAGKQRLRDWAVAVPAVLLAVASGLFVVDATGGTERSKTEMK
FT                   VALPQTVTIKPRTMTYRADGDFQKNNYPVDAPLTTRKLRRSFEIMKYQVTGAEYRRCVD
FT                   DGACQPPEDLPHNRNWASADKPVVGVSYTDAEDYAAWLSKKTGSVWHLPTDEQWAFAAG
FT                   TRFADDAVGIEGDESKNPALRWLRDYEQQSARKQDRNQTVRPLGAFGENEYGLADIGGN
FT                   VWEWTQTCHRRVNIDAYGKVASETTVCGVYVVNGKHRAAMSSFIRNPKTGGCSVGVPPD
FT                   NLGFRLVRDGRWYAPVLMRLKDFTS"
FT   gene            244862..245557
FT                   /locus_tag="BMI_II256"
FT   CDS_pept        244862..245557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II256"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II256"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49392"
FT                   /db_xref="GOA:C7LHA4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHA4"
FT                   /protein_id="ACU49392.1"
FT                   /translation="MAMIDRGLVRKLSLFAKMRDDELDRLVSYATSRRVPQGESIFEQG
FT                   DEASCFYLLLHGRLKVNQVTPDGQQIIVRMVHPGDLFGFARALQRNDYPGTATAVMESI
FT                   VLAWPTELWDYFVEQNPGLAMNAIQTIGKRLEEAHTRIREMSTEEVERRVAHAVLRLSR
FT                   QAGKKEETGIRIDFPISRQDIAEMTGTTLHTVSRILSNWETKGLVQGGRQKLLVLDSAG
FT                   LRRLAEGED"
FT   gene            245640..246695
FT                   /locus_tag="BMI_II257"
FT   CDS_pept        245640..246695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II257"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II257"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49393"
FT                   /db_xref="GOA:C7LHA5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHA5"
FT                   /protein_id="ACU49393.1"
FT                   /translation="MHISRKKATIYDLSVLSGSSPSTVSAVLNGTWRKRRISQATAEAI
FT                   LQLADQHAYTANRQAQGLRHSRSGLVGLLLPLHDNRFFSAMAQIFEAHVRARSLCPVVV
FT                   SASRDPEEERETAETLISYAIDELFICGATDPDGLHELCEKAALPHVNIDLPGSRAPSV
FT                   TTDNFAGGKMLTAAIIEYFGEEAPLQPEDLCLFGGRNDESTRQRICGFHQVKQTVLGAD
FT                   PEGCVFKTGYSPANTLVALNDYRARHGRLPRGLFVNSSINLEGLLRFMAEHPGEPLNDI
FT                   VIGCYDYDPFASFLPFPVISILQDVEGMIAKAFDLMERRVTEPELHLIMPKLIAPRSAI
FT                   TGPLDSLKDIK"
FT   gene            complement(246876..247097)
FT                   /locus_tag="BMI_II258"
FT   CDS_pept        complement(246876..247097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II258"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49394"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHA6"
FT                   /protein_id="ACU49394.1"
FT                   /translation="MTLLLMIVYSCAGMRFKKFVNEPAPQVLKRATAKEAVIPSTPLRI
FT                   LRFIVPPLPLTAFAILRHSIQWAGGDHN"
FT   gene            247096..248148
FT                   /locus_tag="BMI_II259"
FT   CDS_pept        247096..248148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II259"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II259"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49395"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHA7"
FT                   /protein_id="ACU49395.1"
FT                   /translation="MKGLKMTGALAGVLMMAATTAHAEVKDAVVGFLMPDQASTRYEER
FT                   DYPGFAAQMKTLCESCKVLYLNADGDATKQQQQFNSVISQGAKVIVLDAVDTAAAASLV
FT                   KLAQSQGIKVIAYDRPIPDAKSDFYVSFDNEAIGKSIAESLVKHLKDKGVPTDKGGVLQ
FT                   INGSPTDAAAGLIKNGIHAGLKDSGYKTLAEYDTPEWAPSKAQQWASGQITRFGDQIVG
FT                   VVAANDGTAGGAIAAMKAAGVDPLPPVTGNDATIAALQLIISGDQYNTINKPSEIVASE
FT                   AARVAVQLLGDKAPKAETTLYNTPSKLFVPVVVTAENLKAEIIDKKVVPAATLCVDRYA
FT                   EGCKKLGITN"
FT   gene            248453..249319
FT                   /gene="mglA"
FT                   /locus_tag="BMI_II260"
FT   CDS_pept        248453..249319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglA"
FT                   /locus_tag="BMI_II260"
FT                   /product="galactoside transport ATB-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49396"
FT                   /db_xref="GOA:C7LHA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHA8"
FT                   /protein_id="ACU49396.1"
FT                   /translation="MRHILLYARESEIMSQDHKAAATSSQPVLRLSGISKNFGAVSALT
FT                   DIDLEVFPGEVVALVGDNGAGKSTLVKTLAGVHQPTSGTIEFNGEKVVLSSPGVALDLG
FT                   IATVFQDLALCENLDVVANIFLGREISPYRLDEVSMEIKAWKLLNELSARIPSVREPVA
FT                   SLSGGQRQTVAISRSLLLDPKLIMLDEPTAALGVAQTAEVLDLIERVRDRGLGVIMISH
FT                   NMEDVRAVADRIVVLRLGCNNGIFYPDSSNEELVAAITGATSNSVSRRAERRLAQHDNA
FT                   HGRGEVR"
FT   gene            249316..250554
FT                   /locus_tag="BMI_II261"
FT   CDS_pept        249316..250554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II261"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II261"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49397"
FT                   /db_xref="GOA:C7LHA9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHA9"
FT                   /protein_id="ACU49397.1"
FT                   /translation="MNDINTLLDRQDVRVRHDKGVSGAIRTFIDRVKSGDLGSLPVIVG
FT                   LLIIWTVFQTLNPVFLSSNNLVNLLFDCSTIGVISLGIVCVLMLGEIDLSVGSISGLSS
FT                   AIIGVLWVNNGWPVGVAIIAALCAGALAGFLYALLYNRFSMPSFVSTLAGLLAALGLQL
FT                   YLLGNTGSINLPYGSWLVSFGQLLVMPRPLSYALALVAGLAIFFTGFRAAQRRRTAGLS
FT                   APSAAGIALKALVITLIIGCGVFYLNQSRGVPWMFALFVALVIAMNYALTRTRWGRCVQ
FT                   AVGGNREAARRAGINVNFIYVSAFMACSTLAAAGGIMAAARLASSSQQAGTGDVNLNAI
FT                   AAAVIGGTSLFGGRGSAWSALLGIIVIQSIASGLTLLDLSSSLRYMITGAVLAIAVIVD
FT                   SLARRSRQSHGRA"
FT   gene            250842..251570
FT                   /gene="rbtD"
FT                   /locus_tag="BMI_II262"
FT   CDS_pept        250842..251570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbtD"
FT                   /locus_tag="BMI_II262"
FT                   /product="ribitol dehydrogenase"
FT                   /EC_number="1.1.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II262"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49398"
FT                   /db_xref="GOA:C7LHB0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHB0"
FT                   /protein_id="ACU49398.1"
FT                   /translation="MAQDLNGRVAAVTGAASGIGFECAKHMIGAGITVFLVDRDENALA
FT                   EKCVELGDKAKPLVVDLLDPASVATMMPQILEQAGQLDIFHANAGSYIGGPLWEGDPDA
FT                   WDRMLNLNINAAFRTVHAVLPHMMERKTGDIIMTSSVAGVVPVTWEPIYTASKHAVQAF
FT                   VHTVRRQVAPHDIRVGGVLPGPVVTALISDWPQAKLDEALAAGSLMEPKEVAESVMFML
FT                   TRPRNITIRDLVILPQSLDL"
FT   gene            251583..253187
FT                   /locus_tag="BMI_II263"
FT   CDS_pept        251583..253187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II263"
FT                   /product="ribitol kinase"
FT                   /EC_number="2.7.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II263"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49399"
FT                   /db_xref="GOA:C7LHB1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHB1"
FT                   /protein_id="ACU49399.1"
FT                   /translation="MTNYYLGVDVGTGSARAGLFDAGGTMLASARRDIAIWREAGGIVE
FT                   QSSDDIWQAVCESVREVVRVAGVDPAAVAGIGYDATCSLVVLGEGGKPLAVGPSNDRAR
FT                   NIIVWMDHRAGEQAERINTTKADVLGYVGGAISPEMETPKLLWLKEHKPETFAAAWQFF
FT                   DLTDFLTWKSCGSLARSACTVTCKWTYLSHEKRWDETYFRAVGLGELADESFVRIGTDV
FT                   RAGGENLGGLSKQAAAELGLRPGTAIAAGLIDAHAGGIGTVGARGSEGRILSRMAYVFG
FT                   TSACTMTTTEQPVFVDGVWGPYFSAMVPGLWLNEGGQSAAGAAIDHLIHMHPFAAEAEK
FT                   AAADQGKGLADSLAAEVEARGGPEKTAMIVGDIHVVPEFLGNRAPFADPDARAVIAGLD
FT                   LDTGMDSLAALYLAGLCGLGYGVRQIIEAQRAKGIVTDTIVVSGGAARSNLVRQVLADA
FT                   TGLVVTASTSPEPVLLGSAMLGAVASGAYPDLVTAMQVMSELGARNRPDARRAKWHDHR
FT                   FEAFMLLQATARKIRYL"
FT   gene            complement(253319..253984)
FT                   /locus_tag="BMI_II264"
FT   CDS_pept        complement(253319..253984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II264"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49400"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHB2"
FT                   /protein_id="ACU49400.1"
FT                   /translation="MRRAPAPQPSYRLIPSCFPPIGLFDTVATAADLEAVMELAGWTND
FT                   RLVEERLYRLARTEWVFGRTNSSIVMASFLHVAPGGMRFNGSELGAWYSAAKLTTAIIE
FT                   VAHHMRREAVATGIARLARTFRTYTARLEGSFVDISGEKETMADIYDHTSYAASQRFGE
FT                   EMRATGETGILFDSLRHEGGINAVAFRPSRILEVTQADHYEITVEASSRRIEARKLPA"
FT   gene            complement(253981..254457)
FT                   /locus_tag="BMI_II265"
FT   CDS_pept        complement(253981..254457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II265"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49401"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHB3"
FT                   /protein_id="ACU49401.1"
FT                   /translation="MLDARRFTPASRKRLSAPGLRTFLAIADLWKLDEQQRLLVLGLPS
FT                   RSTYYNWVKAVREHRDITLDVDVLMRLSAVLGIHQALGVLYPGEAAGRKWLHTPNGASL
FT                   FGGQPPLQLVASGTQDGLMAVRRFLDAARGGLYMEPNALDRAFHPYHDEDVVFS"
FT   gene            complement(254605..256479)
FT                   /locus_tag="BMI_II266"
FT   CDS_pept        complement(254605..256479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II266"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II266"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49402"
FT                   /db_xref="GOA:C7LHB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHB4"
FT                   /protein_id="ACU49402.1"
FT                   /translation="MQARERSAVSRMTSFWGLLRAYWVSDRWKEAWALTAAIFLITAFI
FT                   SKTTVWVAEASGHLMNSIVNVNTAPVQSPLAAVVTNAGVLIILILAKDVLLVGFRHLLS
FT                   TTLHRKWRKWLNDSFSDALLDRNHTHFHLQQGNGAHLPDNVDQRVQESIKGMTGGAIGL
FT                   VMGIVGVVLSAFFVGQKLLEISTEVHGLEFLGSYGGALLALAVILLYVPLGTLIAIKIG
FT                   KRLERLNLGMQKAEGSYRGEWTTLLRRSFQISASEGENVQRTVNNRLYREVDGTWDKLN
FT                   RFDAAYLAFSQAYGFLSLRIVAYIPGFLPYMSGAVNFRNYVTGAELVAAMINDCSWFIQ
FT                   VMPAIANLRANAGRVIGLAQSIESVQEPAEFYARSGVNRFAFTHQHPRFGLSVRNLTLM
FT                   QGPASETPFLRSGVINMRAGDWIYMRGESGSGKTSFIKALNGLWPYGTGNIIYPQGANS
FT                   LYVLQEAKFPSVSLKQLVALPRDEGDFNDLAVAAVLHEAGLGEFIERMKDADAGNSPWD
FT                   MVLSGGQKQKVMLARILLHKPSIIFLDEATGALDPASKLRFHTALKTRCPDAIVVSIMH
FT                   EEKLPTLESGESIFSHVLDIANGYVSLIPAHFAAAPDAEPAVSLIAAE"
FT   gene            complement(256666..256824)
FT                   /locus_tag="BMI_II267"
FT   CDS_pept        complement(256666..256824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II267"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49403"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHB5"
FT                   /protein_id="ACU49403.1"
FT                   /translation="MAEASRTMRAWPGSFETFRDQIFHFHRNQPENPQGCLLFWSETGR
FT                   FMKNLRG"
FT   gene            256802..256993
FT                   /locus_tag="BMI_II268"
FT   CDS_pept        256802..256993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II268"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49404"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHB6"
FT                   /protein_id="ACU49404.1"
FT                   /translation="MVLDASAKLCCWPVEFRFSFQGALECRFLPAGESRLSLRHINMAP
FT                   IYEGSFRLKDTSAASGGM"
FT   gene            257006..259369
FT                   /gene="nosR"
FT                   /locus_tag="BMI_II269"
FT   CDS_pept        257006..259369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosR"
FT                   /locus_tag="BMI_II269"
FT                   /product="nitrous oxide reductase regulatory protein NosR"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II269"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49405"
FT                   /db_xref="GOA:C7LHB7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR011399"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHB7"
FT                   /protein_id="ACU49405.1"
FT                   /translation="MIRAFFGKGRAPSIEGNFSRYPHVNQRFFRPFLFIMGQLGLLLFL
FT                   AMLAVAPARAADIGKYLPSLDPQVLFQGADSIGEPQGEPPIAPVKKGNELLGYAYLNSD
FT                   FTNATGYSGKPIRIVVGIDTKGVIRGFKLVDHKEPIVLIGIPEPKVVAALNSLVNSDMT
FT                   AVAAGQIKPPQVEIVSGATVTVLVMGDSVVRSAVGLIRSGRLGNAPVQAVVADAPRAVN
FT                   MDLVEEKDWQTLIGDGSVRSLKLTVGEVTQAFRDAKHDEAAANPETADPEDEFIELYVA
FT                   PASVPSIGISLLGKEGYERLRKQLKPGQQAILVAGDGAYSFKGSGYVRGGIFDRIELMQ
FT                   DGQGVRFRDKNHTRIGDLMADGAPSLREIALFRVPEGFAFDVTRPWDMQLLVQRGFGAR
FT                   DKANVSYDVGYNLPEQYMLKQPEPAPAKPVATADAPRQPQPVGEATAADILGENSPLWV
FT                   KMWEMNRVNVVIAGISILILVAIFFFQDSLVRHPRFFTWLRRGYLLFILVWLGFYNNAQ
FT                   LSVVNVLTFTNSLITGFNWEFFLTSPLIFILWGATAAGLLFWGRGPFCGWLCPFGALQE
FT                   LTNNLAQWLKVPQVKLPWGLHERLWPLKYIIFLGLFALSLYSMALAELFAEVEPFKTSI
FT                   ILKFARDWPFVIYALTLLAVGLFVERFYCRYLCPLGAALAIPGRIRMFEWLKRWQECGS
FT                   PCQRCAKECPVEAIHPEGQINVNECIYCMHCQELYHDDQRCPHMIQVRVKREKFAARNA
FT                   PLAAAAERGGGPARPIISVKGKPVETPVNPGPAA"
FT   gene            259390..261309
FT                   /gene="nosZ"
FT                   /locus_tag="BMI_II270"
FT   CDS_pept        259390..261309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosZ"
FT                   /locus_tag="BMI_II270"
FT                   /product="nitrous-oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49406"
FT                   /db_xref="GOA:C7LHB8"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023644"
FT                   /db_xref="InterPro:IPR034205"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="InterPro:IPR041142"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHB8"
FT                   /protein_id="ACU49406.1"
FT                   /translation="MTEETRKSQLSRRQLLGTSAFVAAAGASGLGGALLAGSSETALAA
FT                   GAAKGGMSPEVKPGELDEYCVFFSSGQCGEVRIVGLPSMRELMRIPVFNRDSATGWGLT
FT                   NESRKVLTEGLLPQDREFLKDRGDIFLNGDLHHPHPSFTDGTYDGRYLYANDKANTRVC
FT                   RIRLDVMKCDKIIQLPNQHTVHGLRVQKYPKTGYVFCNGEDRVPIPNDGSHLNDVKQYH
FT                   AIFTAVDGETMKVAWQVMVDGNLDNVDCDYQGKYAFSTCYNSEEGTTLAEMMSSEQDWI
FT                   VVFNLKRIEEAVANGDFKEMNGVPVIDGRHGSKYTRYIPVPNSPHGINTAPDGIHVVAN
FT                   GKLSPTVTVFDVRKFDDLFDDKIKPRDAVVAEPELGLGPLHTAYDDKGNAYTTLFIDSQ
FT                   ICKWNIEDAKRAFKGEKVDPIRQKLDVHYQPGHNHSSMGQTKEVDGKWLISLNKFSKDR
FT                   YLNVGPLKPENDQLIDISGDKMVIVHDGPSFAEPHDATIVHRSKINPVSFWSREDPFFA
FT                   DAVAQAKADGLDLMEANEVVRDGNKVRVYMTSSAPAFGLTEFTVQQDDEVTVYVTNIDE
FT                   IEDLTHGFAIVNYGVNMEVAPQATASVTFKASKPGVWWYYCSWFCHAMHMEMQGRMLVE
FT                   PKKA"
FT   gene            261315..262709
FT                   /gene="nosD"
FT                   /locus_tag="BMI_II271"
FT   CDS_pept        261315..262709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosD"
FT                   /locus_tag="BMI_II271"
FT                   /product="copper ABC transporter, periplasmic
FT                   copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II271"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49407"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHB9"
FT                   /protein_id="ACU49407.1"
FT                   /translation="MVLPRLFRTAGIMSLLAAALCAGAQARQIDVAVGESVQAAIEKAE
FT                   PGDVVRLRAGRHEGAVVIDRAIELTGEPGAVLDGLGTGNAITVNAPNAIVRGLEVHGSG
FT                   DNLPDLHSGIFVSRTATGARVENNRLIGNTYGIYLHGAADSIAIGNEVLGRRGVRMAET
FT                   GSGVSVWNAPGAQVVGNTIRYGRDGIYTNASRKNIFRDNVMEDVRFAVHYMYTDDSAVI
FT                   GNVSRNNSVGFAIMYTNRLKILNNVSEGDRDHGLLLNYANSSIITGNRVVGRMQPIERW
FT                   LEAGLQKGEHGVPGEEKVEASAGETARLGPEKCVFIYNANKNKFSENSFENCSIGIHFT
FT                   AGSEGNAMSGNSFINNRNQVKYVGTRNLDWSVDGRGNYWSDNPAFDLDGDGIADSPYRP
FT                   NDLIDRVLWTVPQAKILINSPAVDTIRWAQTQFPALLPGGVVDSHPLMKPLLKPTAQLK
FT                   ESKHND"
FT   gene            262747..263697
FT                   /gene="nosF"
FT                   /locus_tag="BMI_II272"
FT   CDS_pept        262747..263697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosF"
FT                   /locus_tag="BMI_II272"
FT                   /product="copper ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II272"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49408"
FT                   /db_xref="GOA:C7LHC0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHC0"
FT                   /protein_id="ACU49408.1"
FT                   /translation="MATFGTGSETVVLDKVTKSYGGFNAISDASFRLMAGENIALVGHN
FT                   GAGKTTMIKLMLGLIRPTKGAVRVLGEDPAAGAFAARLRLGYLPEHVSFNMALTGAETL
FT                   GFYARLKQVPFGQADALLERVGLAHAAHRRVGTYSKGMRQRLGLAQALLGQPAVLLLDE
FT                   PTTGLDPALRQSFYEILESLRQEGTTILMSSHALTELETKVGRVIIANKGKVIADGSID
FT                   ALRRISRLPMRIRVEVNDVSCLPVETGNLLLRWHRLGPDLYETEAPAEGKMELVRRIVA
FT                   MNDKLNELDIIPPTLDELYAHFLNMGDMAVQEAAE"
FT   gene            263694..264524
FT                   /gene="nosY"
FT                   /locus_tag="BMI_II273"
FT   CDS_pept        263694..264524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosY"
FT                   /locus_tag="BMI_II273"
FT                   /product="nitrous-oxide reductase, nosY component"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II273"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49409"
FT                   /db_xref="GOA:C7LHC1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHC1"
FT                   /protein_id="ACU49409.1"
FT                   /translation="MNNIAIIATKEIQEGLRNRWVLATTLLLAALALSMTFLGSAPTGS
FT                   SVAASKLDVVIVSLSSLTIFLIPLIALLISHDAIVGEMERGTMLLLLSYPLSRIQVVLG
FT                   KFIGQLAILAFATLFGYGVAALALAATGTGVDAASWISFLKLIGSSILLGAVFIAIGFL
FT                   ASTLVRERSTAAGIAIGVWLFFVLIYDAALLALLVFDQGQTIGSAALNALLLLNPADSY
FT                   RLLNFGTGQAGALTGMGGMAGNATLSAPALALALGLWAVLPLSLSMLVFSRKEL"
FT   gene            264521..265060
FT                   /gene="nosL"
FT                   /locus_tag="BMI_II274"
FT   CDS_pept        264521..265060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosL"
FT                   /locus_tag="BMI_II274"
FT                   /product="nitrous oxide reductase accessory protein NosL"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II274"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49410"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHC2"
FT                   /protein_id="ACU49410.1"
FT                   /translation="MKRALFLAPFFFALLAGCSPAEKQEPATPFALTENAMGRYCGMNV
FT                   LEYPGPKGQIILRPTNEPIWFSSARDTLAFTMLPEEPKNIAAIYVSDMAKAPNWDEPGA
FT                   NNWIDAHKAFFVIESGAVGGMGAKEAVPFSDRAAAERFTADNGGRIVSFDEMPRDYVLG
FT                   EQTAQHVEPDGESHMH"
FT   gene            265072..266064
FT                   /gene="nosX"
FT                   /locus_tag="BMI_II275"
FT   CDS_pept        265072..266064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosX"
FT                   /locus_tag="BMI_II275"
FT                   /product="thiamine biosynthesis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II275"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49411"
FT                   /db_xref="GOA:C7LHC3"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHC3"
FT                   /protein_id="ACU49411.1"
FT                   /translation="MSITRRRVLVGGAVAATFSMLPRFAFAQGEQQPVIWQGQALGAPA
FT                   KIIFYHPDRKVAERLVGESAREAERLENIFSLYRPDSEIVRLNHTGALASPAPEMVELL
FT                   GICRTCWQLSDGLFDPTVQPLWQCLRKHFSQANPAPEGPSRAEWDAALAKIGFDHVLFN
FT                   AERIAFTKPGMALTLNGIAQGYVTDRVVGLLRDAGVSEALVDMGEYRAIGGQPDGKPWR
FT                   IGIADLEAGAAPEEFIDIMDQALATSSFAGFQFEESGRFNHLLNPKTGYSAALYRRVTV
FT                   VAPDTAMADALATAFSLMEPAQIKETLKKLPGIFAYTVSRDGEKRRFGA"
FT   gene            266179..266877
FT                   /gene="nnrR"
FT                   /locus_tag="BMI_II276"
FT   CDS_pept        266179..266877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nnrR"
FT                   /locus_tag="BMI_II276"
FT                   /product="transcriptional regulator NnrR"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II276"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49412"
FT                   /db_xref="GOA:C7LHC4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHC4"
FT                   /protein_id="ACU49412.1"
FT                   /translation="MAAIIDWALVRSLPVFSGMDDAAFEQLMGLAMPRAVPKGSAVFKQ
FT                   GEEARLFYLLVQGRLKVMQVTADGQQLIVRVVNPGEFFGFAMALGREDYPGTPLAVVDC
FT                   SVIAWPMEMMTAFMASNPALAVNTMQMIGRRLDAAHSRIREISTQEVEQRVAHAVLRLV
FT                   REAGIQEDTGLRIDFPVSRQDIAELTGTTLHTVSRIVSQWQSKGWVEGGRQSLLVRDLR
FT                   RLRQIAEGEI"
FT   gene            266949..267455
FT                   /locus_tag="BMI_II277"
FT   CDS_pept        266949..267455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II277"
FT                   /product="pseudoazurin (Cupredoxin) (Blue copper protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II277"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49413"
FT                   /db_xref="GOA:C7LHC5"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR001235"
FT                   /db_xref="InterPro:IPR002386"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR012745"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHC5"
FT                   /protein_id="ACU49413.1"
FT                   /translation="MFARLIRHDFDALGLSMEIKIKMRNTAIKFAAAGLFALLAAPALA
FT                   ENIEVHMLNKGAEGAMVFEPSYIKANAGDTITFIPMDKGHNVETVKDMIPDGAEKFKSK
FT                   INEHYTVTVNQPGAYLIKCTPHYAMGMVALIAVGDKPENLEKIVSAKKPKVVQERLDKI
FT                   LAEVK"
FT   gene            267506..268747
FT                   /gene="nnrS"
FT                   /locus_tag="BMI_II278"
FT   CDS_pept        267506..268747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nnrS"
FT                   /locus_tag="BMI_II278"
FT                   /product="NnrS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II278"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49414"
FT                   /db_xref="GOA:C7LHC6"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHC6"
FT                   /protein_id="ACU49414.1"
FT                   /translation="MTTQQGLQASPATMPSERKGGIPRGLKMTGPVILSYGFRPFFLGG
FT                   AIWAVMAMLLWILSLTIGLPLGGSYGALNWHAHEMVFGFSSAVLAGFLLTAVPNWTGRL
FT                   PVSGGPLAVLCGVWLAGRLAFLAPDLVHIDVAVAIESLFLPFLLFIAAREIIAGHQWRN
FT                   LKVLGGIAGVMIANFAFHYLVLTDGDVTFANRIGVSAYVLLVTLIGGRIIPSFTRNWLN
FT                   RMGKTRFPVPFNRYDALTLIVGVVACLSWIFLPESSLTAVLALIAAAFHLVRLYRWRGW
FT                   TVAREKLLVILHVAYLFVPGGFVAIALSALDRLNPFSALHVMTVGAIGAMMLAVMTRAT
FT                   RGHTGRELVASPMTQIAYVCIIAAAVIRPFAEIMPNFFHTLLAASALLWMLAFGLFVVE
FT                   YGPMLLRKRRSRMG"
FT   gene            complement(268821..269861)
FT                   /locus_tag="BMI_II279"
FT   CDS_pept        complement(268821..269861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II279"
FT                   /product="ABC transporter, periplasmic binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II279"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49415"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHC7"
FT                   /protein_id="ACU49415.1"
FT                   /translation="MTTTRRDILLGAAAFGLASIATRLPAYAQDASAAPEKPELMFGVG
FT                   GKPLFYYLPLTIAERKGFFEEEGIKATINDFGGGAKSLQALIGGSVDVVTGAYEHTIRM
FT                   QNRGQDIKAVCELGRFPGICIGVRKDLAGDIKTIADLKGQNVGVTAPGSSTSLLLQYAL
FT                   IKNGLSPDAASIIGVGGGASAVAAIKKGEIAALVHLDPVITRLEVDGDITLLLDTRTEE
FT                   GTRQLFDGTNPAATVYVQQSFIDANPVTTQRVVNAFVKSLKWIHNASADEVADTVPEEY
FT                   LLGDRALYKTGFEKSRAMYSQKGLIAEDGFKSLFEMLKTLDPELAGANITFAQTFDPRF
FT                   VEAARA"
FT   gene            complement(269887..270678)
FT                   /locus_tag="BMI_II280"
FT   CDS_pept        complement(269887..270678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II280"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49416"
FT                   /db_xref="GOA:C7LHC8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHC8"
FT                   /protein_id="ACU49416.1"
FT                   /translation="MKKPMLFLAQLGIAVAVILVWHLFTATHLFGNPAKAQFFFATPGD
FT                   VALRTYKWFVDGTIWYHLGITLLEAMLAFAIGAVGGVLIGFWFARKPLLAAIFDPYVKA
FT                   ANSLPRVVLAPIFALWLGLGIWSKVALGVSLVFFIVFFNVYQGVKEVNQTVLSNARMLG
FT                   MNERQLLRNVYLPSALSWMFSSLHTAVGFAVVGAVVGEYLGSSAGLGYLIHQAEGVFDV
FT                   TGVFAGMLVLTAFVLLIDWGVSIIEQRLLVWRPKAAGQNGA"
FT   gene            complement(270675..271520)
FT                   /locus_tag="BMI_II281"
FT   CDS_pept        complement(270675..271520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II281"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II281"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49417"
FT                   /db_xref="GOA:C7LHC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHC9"
FT                   /protein_id="ACU49417.1"
FT                   /translation="MSAYPKLVQSNEPHPTAIELKDVQISFRLADGGRFDAVAESNLAV
FT                   AENEFVAIVGPTGCGKSTLLNAVAGLLTPASGTVEISGQRLQGLNRKAGYLFQQDALMP
FT                   WKTVLENVAIGLEIAGTPKAKAREQAREWLNKVGLGTFGDRYPHMLSGGQRKRVGLAQV
FT                   LIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLWSQDKKAVMFVTHDLEEAIALADRVVI
FT                   MSAGPRARIMAEYRIPLARPREISEIRLDNQFHEIHREIWSALKEEVLKGYQQTSGERS
FT                   "
FT   gene            271547..271849
FT                   /locus_tag="BMI_II282"
FT   CDS_pept        271547..271849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II282"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49418"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHD0"
FT                   /protein_id="ACU49418.1"
FT                   /translation="MRFAAIIHLYSLLRRHAFAEQGRGWLPALPGCEEDAPGWKPSLYL
FT                   SGKKMQCKAEIALQTNHINVLMRNIIATPYPQRPPPFPVARQYDRDCEGASRCED"
FT   gene            complement(271947..272879)
FT                   /locus_tag="BMI_II283"
FT   CDS_pept        complement(271947..272879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II283"
FT                   /product="protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II283"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49419"
FT                   /db_xref="GOA:C7LHD1"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHD1"
FT                   /protein_id="ACU49419.1"
FT                   /translation="MATNATPSLSMGPVLFLWDGPKWRDFYFRIADEAPVSHVTVGEIV
FT                   CSKRFHFVDPYMEAVIERLQQAGKTVSLGSLALVMLEREAKQVRQTIEKATLPVEANDL
FT                   SALGLLSGKPHTVGPLVNVYNAATAKVLAERGATSICLPPELPLASIREIVKGAPDITF
FT                   EVFSFGRVPLAISARCAHARSKGHIKDNCQFVCGEEPDGLPVKTLDSQPFLALNGVQTL
FT                   SHTCQAFLEDMPELKAAGVSRFRLSPQVCDMVAVAQIHEDVLLEKIDPDEGVARLKEVY
FT                   PAVPLSNGFLHGGIGAAWVSRQRSMAAGH"
FT   gene            complement(272882..273859)
FT                   /locus_tag="BMI_II284"
FT   CDS_pept        complement(272882..273859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II284"
FT                   /product="peptidase, U32 family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II284"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49420"
FT                   /db_xref="GOA:C7LHD2"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHD2"
FT                   /protein_id="ACU49420.1"
FT                   /translation="MELICPAGTPSALREAVQAGADAVYCGFRDETNARNFPGLNFSRD
FT                   ELRDAIGFAHARNCQVFVAINTFMRAGDEHIWYKAVDDAAALGADAVILADFGLMAYTA
FT                   ERHPNQRLHVSVQASASNADAISFLIDAFKAKRVVLPRVLTIADIAKLGRKIPCEMEVF
FT                   VFGGLCVMAEGRCSLSSYATGKSPNMNGVCSPASHVRYRHDGSELVSELGDYTINRFPA
FT                   GEAAGYPTLCKGRFNIGDEEGYAFEDPVSLDVMDHIDELRAAGVSALKIEGRQRGKAYV
FT                   AEVVSTLRQTLAAGPEKRAALLSRLRALSEGQQTTSGAYEKRWR"
FT   gene            complement(273850..274374)
FT                   /locus_tag="BMI_II285"
FT   CDS_pept        complement(273850..274374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II285"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49421"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHD3"
FT                   /protein_id="ACU49421.1"
FT                   /translation="MMKIPQAVAAPARLVPPFLLNPLVSRVFHQVIRAHPGLFERLGEH
FT                   VNKRFGFRPSDLPFAFLVEPGKPRISVFRQDAAFEADAAIEGPLVMLLALLEGKLDGDA
FT                   LFFSRDITVTGDMEAMLALRNALDDCNVDLPADLGNGAGPFGPVVRSIAGYIREKALGA
FT                   DAHDREAHSWN"
FT   gene            274488..276002
FT                   /gene="ubiD"
FT                   /locus_tag="BMI_II286"
FT   CDS_pept        274488..276002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="BMI_II286"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II286"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49422"
FT                   /db_xref="GOA:C7LHD4"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHD4"
FT                   /protein_id="ACU49422.1"
FT                   /translation="MKSSSSLPTHYDCLQSFLTELEKRGDLVRIARPVSLVHEVTEIHR
FT                   RVLEADGPALLFENPVDAEGRTQTIPLLANLFGSERRIAWGLGRLPEELPLLAEMLAEL
FT                   RAPKPPRSAGEIWEKLPMAKAALNMRPRQVSRAPVHGLVMEGASVNLDTLPIQWCWPGE
FT                   PAPLITWPLVITRAPDDPSDVNVGIYRMQKLGENRLIMRWLAHRGGARHHRMWQKRGED
FT                   MPVAIAIGVDPATILAAVMPLPEGMSELAFSGLLGGRRPCVTQGRTVPLMVPANAEIVL
FT                   EGRVSATQTAPEGPYGDHTGYYNSVEAFPVMQVTAITMRKKPVYLSTYTGRPPDEPSRL
FT                   GEVMNQLFVPVVRKQFPEIADLWLPPAACSYRAMVVSIDKRYPGQARRVMMGLWSMLPQ
FT                   FSYTKLIIAVDPDIDVHNWDDVMWALATRFDASRDVVTLSDTPVDYLDFASPRSGLGGK
FT                   LGLDATNKIGPETDREWGKVLAMNEETIARVDAIWDELGLDRDKRI"
FT   gene            275999..276589
FT                   /locus_tag="BMI_II287"
FT   CDS_pept        275999..276589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II287"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II287"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49423"
FT                   /db_xref="GOA:C7LHD5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHD5"
FT                   /protein_id="ACU49423.1"
FT                   /translation="MKRIVIGVSGASGSLIPLKLLERLAVMEEVETHLVISDAAQQTLR
FT                   YELGANGYSLLYRLAARTYAVEDVGAAIASGSVPTAGMIIAPCSMRTLSAIANGYSDSL
FT                   LTRAADVHLKERRKLVLIARETPLHLVHLRNMCTVTEMGAIVMPPVPAFYLQPQTVEDV
FT                   ASQVAARAIDLIGVGTPQAQSWNPEEKPRRKAG"
FT   gene            complement(276599..277135)
FT                   /locus_tag="BMI_II288"
FT   CDS_pept        complement(276599..277135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II288"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49424"
FT                   /db_xref="InterPro:IPR018912"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHD6"
FT                   /protein_id="ACU49424.1"
FT                   /translation="MKAAPILAAIHAAKDVPVDPLLAEIAARGKQDGLRVAGFFQHRGK
FT                   DTEECCRDIEIEHIATGITQIISQPLGTGSRGCRLDPAALADVAGALLGELEAGAQLLI
FT                   LNRFGKGETEGHGFRSVIEAAYARQIPVLTVVRETYIDGWRDFAGPCGTLLAPNSESVT
FT                   DWFNAVMAPPLRAAI"
FT   gene            complement(277132..278067)
FT                   /locus_tag="BMI_II289"
FT   CDS_pept        complement(277132..278067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II289"
FT                   /product="peptidyl-prolyl cis-trans isomerase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II289"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49425"
FT                   /db_xref="GOA:C7LHD7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHD7"
FT                   /protein_id="ACU49425.1"
FT                   /translation="MVTLFDRKNAGGQPAGDNPAGHHGHQHQSGYTTYQEPDTRVPPKP
FT                   RPVFDAVSVNGVTIDEADILTEAQNHPAENPGAALLSAARALAVRELLLQRAREIGIEP
FT                   EHEKDAEGRAETDEDALVRMVIEREVDVPSASRDEAQRYYENNRHRFTSAPILEASHIL
FT                   IAADPADQETRDAARQTATRLAAAVIAEPATFASVALEYSSCPSGAQGGNLGQLTRGST
FT                   VPEFERALERMTPGETTANPIESRFGYHIVRLDRRVEGEELPFDYVADKIAGWLEASTW
FT                   SKAVSQYIAILAAEAEITGIDLLSGEDGGE"
FT   gene            complement(278073..278798)
FT                   /gene="narI"
FT                   /locus_tag="BMI_II290"
FT   CDS_pept        complement(278073..278798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narI"
FT                   /locus_tag="BMI_II290"
FT                   /product="respiratory nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49426"
FT                   /db_xref="GOA:C7LHD8"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHD8"
FT                   /protein_id="ACU49426.1"
FT                   /translation="MASYFNTFLFGIYPYIALSVLALGSIVRYDREPYTWRSGSSQLLR
FT                   RRQLMWGSVLFHLGVLVIFAGHFVGLLTPIWIFDTLGISHEAKQILAIVAGGIAGLMAI
FT                   IGASMLVHRRLFDPRVRASSRPSDTLIIILLWVQLLLGLSSIPVSLQHIDGGEMVKFMN
FT                   WAQGIFTFNPAASSYVADASIVFKMHIFLGLTIFILFPFTRLVHMLSAPVRYIWRPGYQ
FT                   VVRERNHTAAPSHLRAPAE"
FT   gene            complement(278809..279516)
FT                   /gene="narJ"
FT                   /locus_tag="BMI_II291"
FT   CDS_pept        complement(278809..279516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narJ"
FT                   /locus_tag="BMI_II291"
FT                   /product="respiratory nitrate reductase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II291"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49427"
FT                   /db_xref="GOA:C7LHD9"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="InterPro:IPR042290"
FT                   /db_xref="InterPro:IPR042291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHD9"
FT                   /protein_id="ACU49427.1"
FT                   /translation="MNRTLKIISLLLSYPSPELQAGRAELKAALEGEKNLSPGVRRLLD
FT                   KLVDYICTADLYEAQERYVHLFDRTRSLSLHLFEHVHGESRDRGQAMVDLGQMYEDNGF
FT                   DIDAKELPDYLPLFLEFLSTRSTEEIHDLLTQTGHITAAIGERLRKRQSPYAGAFAALL
FT                   HLANAKPDEKLVGELLRQEEDDPDDLAALDRIWEEEAVTFGANAGENACGPDRLRMQMR
FT                   AAHRKPASPSTQI"
FT   gene            complement(279516..281054)
FT                   /gene="narH"
FT                   /locus_tag="BMI_II292"
FT   CDS_pept        complement(279516..281054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narH"
FT                   /locus_tag="BMI_II292"
FT                   /product="respiratory nitrate reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II292"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49428"
FT                   /db_xref="GOA:C7LHE0"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHE0"
FT                   /protein_id="ACU49428.1"
FT                   /translation="MKIRAQIGMVLNLDKCIGCHTCSITCKNVWTNREGVEYAWFNNVE
FT                   TKPGVGFPKEWENQKKWNGGWVRKKNGKIEPKMGAKWRILAKIFANPDLPEIDDYYEPF
FT                   DFDYGHLQTAGESRTMPTARPRSLISGERMEKIEWGPNWEEILGGEFAKRSKDYNFEGV
FT                   EKEIYGQFENTFMMYLPRLCEHCLNPTCVAACPSGAIYKREDDGIVLIDQEKCRGWRMC
FT                   VSGCPYKKIYYNWSSGKSEKCIFCYPRIESGQPTVCSETCVGRIRYLGVMLYDADRISE
FT                   AASTANEQDLYQEQLNIFLDPNDPAVIEQARKDGVPDAWLEAAKHSPVYKMAMDWKIAF
FT                   PLHPEYRTLPMVWYVPPLSPLQSAAQAGKLGMDGPLPDVRSMRIPVRYLANLLTAGKEE
FT                   PVISALERMLAMRAYMRAKTIDGVIDEAIADRVGMSGAMIEEMYNIMAIANYEDRFVIP
FT                   TSHREITEDAYDVRGSCGFTFGNGCSGGTSTEDLFGAKRQKVVQTPTDIFREQV"
FT   gene            complement(281051..284815)
FT                   /gene="narG"
FT                   /locus_tag="BMI_II293"
FT   CDS_pept        complement(281051..284815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narG"
FT                   /locus_tag="BMI_II293"
FT                   /product="respiratory nitrate reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II293"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49429"
FT                   /db_xref="GOA:C7LHE1"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHE1"
FT                   /protein_id="ACU49429.1"
FT                   /translation="MSLLLDRLNFLARRNVGTFSEGHGVTTNESRDWEDAYRKRWQHDK
FT                   IVRSTHGVNCTGSCSWKIYVKGGIITWETQQTDYPRTRADLPNHEPRGCPRGASYSWYI
FT                   YSANRVKYPLIRSRLLKLWRKERAVKTPVAAWAAIQQDPAKRSDYMKVRGLGGFVRATW
FT                   DEVNEIIAAANAYTTKTYGPDRVVGFSPIPAMSMVSYAAGSRYLSLLGGVCMSFYDWYC
FT                   DLPPASPMTWGEQTDVPESADWYNAGFLMLWGSNVPQTRTPDAHFYTEARYKGAKSVVV
FT                   CPDYSEAAKFSDLWLHPKQGTDAALAMAFGHVMLREYHLDRQVPYFEDYCRKYSDFPML
FT                   VMLTKKDGHYVPGRFVRASDFADNLGEGNNPDWKTVGFDTKSGAYVAPQGSIGFRWGDD
FT                   GKWNLEEKDGKGKDVELAKSFIDKDAHDAVADVAFPYFGNLDHEHFEGTDHDSILVRKV
FT                   PARTLKLKEGDVMVATVFDLFAANYGLDRGLGDENCAKSYDDGLPYTPAWAEKITGVPR
FT                   AQIIAVAREFATNAEKTNGRSMVIVGAGLNHWYHMDMNYRGIINMLVMCGCVGQSGGGW
FT                   SHYVGQEKLRPQTGWTALAFALDWTRPPRHMNSTSFFYAHTDQWRYETVKVQDILSPTA
FT                   PEGNWDGTMMDYNIRAERMGWLPSAPQLQVNPLEVAKQAAESGKDAKDFVAGALKNGSI
FT                   TMSCEDPDHEANWPRNMFVWRSNLLGSSGKGHEYFLKHLLGTSNGLLGKDLGQEGAQES
FT                   REAVWHEHAPEGKLDLLVTLDFRMSTTCVYSDIVLPTATWYEKNDLNTSDMHPFIHPLS
FT                   SAADPAWEARSDWEIFKGIAKKFSDVAPEVLGVEKDVVLVPTLHDTAGELAQPKDVLDW
FT                   KRGEVEPIPGKTMPSVVVVERDYPNLYKRYTSVGPLLDKLGNGGKGISWNTQHEVDLLA
FT                   KLNGKVGEPGTSEGRPRIDTDIDATEVILSLAPETNGEVAVKAWAALSKFTGRDHTHLA
FT                   IPKEDEKIRYRDIVAQPRKIISSPTWSGLESESVCYNAGYTNVHELIPWRTLTGRQQLY
FT                   QDHLWMRAFGEGFCVYRPPIDTRTVSSAIRAKTDGQPHLVLNFITPHQKWGIHSTYSDN
FT                   LLMLTLNRGGPVVWIAEPDAARAGIADNDWVEIYNSNGAIVARAVVSQRMREGTTFMYH
FT                   AQEKIVNTPGSPLTGQRGGIHNSVTRVITKPTHMIGGYAHQAYGFNYYGTVGSNRDEFV
FT                   VVRKLDKVDWMEGPLEEGNKSSQVKEAAE"
FT   gene            complement(284839..287526)
FT                   /gene="narK"
FT                   /locus_tag="BMI_II294"
FT   CDS_pept        complement(284839..287526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK"
FT                   /locus_tag="BMI_II294"
FT                   /product="nitrite extrusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II294"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49430"
FT                   /db_xref="GOA:C7LHE2"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHE2"
FT                   /protein_id="ACU49430.1"
FT                   /translation="MSTTAFTVCFAVWTIFAIIGIEIRSELGLTETQFGLLVGTPILTG
FT                   SLIRVILGIWADRYGGRAIFTLTMLVSAVATYLLTYATTYPQMLLAALGVGVAGGSFSV
FT                   GVAYVSRWYPPEKQGVALGIFGAGNVGAAVTKFFAPMVMVAFGWHTVAEVWAAAMVVMA
FT                   LVFYFTTNDDPVLVERRRKGEKPTSTLMELEPLKNIQVWRFSLYYFFVFGAFVALSLWL
FT                   PQYLIHVYGVDIRFAGIIAAFFSIPASLFRAYGGHLSDVYGARRVMYWTFAVSLVATFI
FT                   LSYPPTDYVIQSDNGPLAFHAEMGVIGFTVTVFILGFFMALGKAAVFKHIPVYYPGNVG
FT                   AVGGLVGMIGGLGGFILPILFGVLLDQTGLWTSCFMLLFVIVVVSFVWMHVSIRQMEHA
FT                   AEGKATEELPAFAELQGLKKAEVKPATGESVLTDWRPDDPAFWEQKGRRIAKRNLWLSI
FT                   PALLLSFAIWQVWSVVVAKLPLVGYQFTTDQLFWLAALPGISGATLRIFYSFMVPIFGG
FT                   RLWTTLTTWSLVIPAIGIGYAVQNPDTPYFIFLLLALFCGFGGGNFASSMSNISFFFPK
FT                   TEKGNAAALNAGLGNLGVSVVQFVVPLVITAGIFGKLGGNPAMVATAAGEAPLWLQNAG
FT                   FIFVPFIIVTAFANWFGMNDIASAKASFADQAVIFRRRHNWIMCWLYTGTFGSFIGYSA
FT                   GFPLLTNILFPEVNALQFAFLGPLVGALSRSGSGWLADKYGGGRVTIWAFILMMVGVAG
FT                   VLYFVGIKDEPNAFWGFFAAFILLFFATGIGNASTFQMIPAIMAKDMERLMPMASAEER
FT                   RRQADKESAAITGFTSAIAAFGAFFIPKGYGTSISLTGGPEMALWAFLIFYVTCLIITW
FT                   GVYTRKGGLLYDVERRLKPAAAAA"
FT   gene            287816..288526
FT                   /gene="ftrB"
FT                   /locus_tag="BMI_II295"
FT   CDS_pept        287816..288526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftrB"
FT                   /locus_tag="BMI_II295"
FT                   /product="transcriptional activator FtrB"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II295"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49431"
FT                   /db_xref="GOA:C7LHE3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHE3"
FT                   /protein_id="ACU49431.1"
FT                   /translation="MRRDDKIALKNQPLFADMADATFERIMRPSFVQSFPPRTMLLTEN
FT                   EPADFLFAVLDGLVLMSASSQDGDTALEILRPGDVFILAAVLNNDVCLQSAQTLTATRV
FT                   LMVPAELVREQMSEDPAFMHAVVFELARAYRRLVKELKAQKLRSCAQRLANWIVKESLA
FT                   NDGADVVTIPYEKRILAAYLGMTPENLSRSFANLASHGVHVQASAIRITDKAGLLQFAA
FT                   PSSLIDQEEPTRPA"
FT   gene            complement(288581..289597)
FT                   /locus_tag="BMI_II296"
FT   CDS_pept        complement(288581..289597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II296"
FT                   /product="sugar-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II296"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49432"
FT                   /db_xref="GOA:C7LHE4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHE4"
FT                   /protein_id="ACU49432.1"
FT                   /translation="MKLREFAKHMGLSATTVSRALSGYPEVAESTRKRVMEEAIRLGYR
FT                   PNVNAVRLVTGRAGAIGVVMGRNSEFHFAEFMRGMAERLGQDEVDILVSPTSPTGNDDE
FT                   VQLCHRLATSGRVDAVIVTSPRPNDERIRMLHKLGMPFLVHGRSQIDIPHAWLDIDNES
FT                   AVYHSTAHLLDLGHKRIAMINGRHGFTFSLHRDAGYRKALESRGIDFDPDLVEHGDFTD
FT                   EIGYCLARKLLERNPRPTAFVAGSMMTALGIYRAARSFGLTIGKDISVIAHDDVISFLS
FT                   AGNMVPSLTATRSSMRAAGKRCADLLMDILDGRAPTEIHELWPVELILRESATRVPE"
FT   gene            complement(289605..289721)
FT                   /locus_tag="BMI_II297"
FT   CDS_pept        complement(289605..289721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II297"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49433"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHE5"
FT                   /protein_id="ACU49433.1"
FT                   /translation="MKAVWIYCTMNDHKLQTPSAPIVKYMEAAIIRRPACPV"
FT   gene            289948..291213
FT                   /locus_tag="BMI_II298"
FT   CDS_pept        289948..291213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II298"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II298"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49434"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHE6"
FT                   /protein_id="ACU49434.1"
FT                   /translation="MRVLTGALVACAAFGFATGWAQAVEISIAANSTGDNIKFLQEQVA
FT                   KFEKDTGNKVNIISMPSSSSEQFSQYRLWLAAGNSDVDVYQTDIVWAPQLSDQFIDLTE
FT                   ATKDVTDAHFPSIIASQTVNGKLVALPFYTDAPALFYRKDLLEKYNKPVPKTWDEMAAT
FT                   AKDIMEKERADGKADLWGFVFQGNAYEGLTCNALEWIKSSGGGQIVEPDGEISVNNEKA
FT                   AAAIDRARGWIGTISPQGVLGYQEEESRGVWQTGNAVFMRNWPYVYALSNSADSAVKGK
FT                   FDVAPLPAMAEGEPPASALGGWNLAVSKYSTKQDAAIALVKFLASPEVQKAEAVELSRL
FT                   PTIEALYDDKDVIAAQPFMANWKPIFQNAVPRPSAATKVKYNEVSSKFWTAVHKTLAGS
FT                   GTAAENLELLEVELTELKGSGW"
FT   gene            291290..292267
FT                   /locus_tag="BMI_II299"
FT   CDS_pept        291290..292267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II299"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II299"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49435"
FT                   /db_xref="GOA:C7LHE7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHE7"
FT                   /protein_id="ACU49435.1"
FT                   /translation="MTETSLDASRSLRVRAHSDLGAQRIRSAWIFLAPTLIVLAIVAGW
FT                   PLLRTVYFSLTNASLTNLAGAEFVGFKNYFSWVTLKSGRTVYSGLLTDMAWWRAVWNTI
FT                   RFTLLSVSLETIFGLVVALVLNANFRGRGLVRAAILIPWAIPTIVSAKMWGWMLNDQFG
FT                   ILNHILLNLGIISHKIAWTANPDTAMIAILIVDVWKTTPFMALLILAGLQMVPSDIYEA
FT                   ARIDGVHPLKVFWRVTLPLIRPALMVAIIFRMLDALRIFDLIYVLTPNNAQTKTMSVYA
FT                   RENLFDFDKFAYGAAASTMLFLIIAGITVLYMFFGRVNIGGRGE"
FT   gene            292270..293097
FT                   /locus_tag="BMI_II300"
FT   CDS_pept        292270..293097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II300"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49436"
FT                   /db_xref="GOA:C7LHE8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHE8"
FT                   /protein_id="ACU49436.1"
FT                   /translation="MMRFVKRSAFYLLVALIILVAVFPFYYAIITSFKSGTALFQVDYW
FT                   PKSLSLDNYTGVLTQGSFVRSLGNSLLVATVVVAISLLLAVTAAYALARVRFRGRGLLL
FT                   LTILSVSMFPQIAVLAGLFELIRFLGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPV
FT                   EIEEAAIVDGASPWVIITRVFMPLMWPALVTTGLLAFISAWNEFLFALTFTSSGSQRTV
FT                   PVAIALLSGSSQFEIPWGNIMAASVIVTVPLVILVLIFQRRIVSGLTAGGVKG"
FT   gene            293104..294105
FT                   /locus_tag="BMI_II301"
FT   CDS_pept        293104..294105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II301"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II301"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49437"
FT                   /db_xref="GOA:C7LHE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHE9"
FT                   /protein_id="ACU49437.1"
FT                   /translation="MAELQLRDVRKSFGSFEVIKGVDMDIRPGEFMVFVGPSGCGKSTL
FT                   LRLIAGLEEITSGTLSIDGTVVNSFNPSRRGIAMVFQSYALYPHMTVYENMAFGMQLAG
FT                   KSRQECKARIHAAAEMLQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSN
FT                   LDAALRVATRLEIARLHQSMEDTTMIYVTHDQVEAMTLADRICVLRDGRVEQIGTPLEL
FT                   YEKPNSLFVAGFIGSPKMNFLTGPHAEPFGAHTVGLRSEHLAIVPERGHWSGQVVHTEI
FT                   LGSDTYVYIDLGLEEPLVVRESGVSARKPGETLSISPTGDHVHRFDEKGRAV"
FT   gene            294144..294953
FT                   /gene="thuA"
FT                   /locus_tag="BMI_II302"
FT   CDS_pept        294144..294953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thuA"
FT                   /locus_tag="BMI_II302"
FT                   /product="sugar uptake related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II302"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49438"
FT                   /db_xref="InterPro:IPR009381"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHF0"
FT                   /protein_id="ACU49438.1"
FT                   /translation="MPSTRRIFMPIRTIVWGENIHEQINETVRSIYPEGMHNTIAGALN
FT                   EDGAIEATTATLQEPEHGLLTERLAQTDVLVWWGHKDHGGVSDDVVERVARRVFEGMGL
FT                   IVLHSGHFSKIFKRLMGTPCALKWREAGERERVWVVNRGHPIAQGLEETFVLENEEMYG
FT                   EQFSVPEPLETVFISWFAGGEVFRSGMTWRRGAGNVFYFRPGHETYPTYHDANVRTVLR
FT                   NAVKWAYNPQPAWTGIHTAPNVPVEKALEPIVERGPKLHKAGEAGYR"
FT   gene            294962..296008
FT                   /locus_tag="BMI_II303"
FT   CDS_pept        294962..296008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II303"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II303"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49439"
FT                   /db_xref="GOA:C7LHF1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHF1"
FT                   /protein_id="ACU49439.1"
FT                   /translation="MRLLILGTGGMAENHAEAFKAIEGVEVVAACDVSAVRVDAFSENH
FT                   DIHNRFTRLEDALAWNRFDAVANVTPDAVHHPTTLALVGAGKHVFCEKPLAESYEKAAE
FT                   MADAAQQAGVVNMVNLTYRNVAPLQKAREMVMAGEIGQVRHFEASYLQSWLVSKAWGDW
FT                   KTESKWLWRLSTRHGSNGVLGDVGIHILDFATYAIGSDVERASAHLKTFEKAENNHIGE
FT                   YVLDANDSFVMMAEYANGALGVIHASRWATGHLNELRLRIHGDKGALEILHTPTGSSLR
FT                   GSIGEDIETPVWRDIDAGTVETNYQRFARAVADGTELEPSFRHAANLQRVLDHAMHVDK
FT                   PLPEVATG"
FT   gene            296245..296742
FT                   /locus_tag="BMI_II304"
FT   CDS_pept        296245..296742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II304"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49440"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHF2"
FT                   /protein_id="ACU49440.1"
FT                   /translation="MTRIFSENRFTLFGMRSKYSPLLFLRDQTGRFNGLFCCSLVCANG
FT                   LANQANWYSLKARESWSMRMKYTKPDIILQSVTRLEEQNAWEIKMRVIFRNIGSHILTL
FT                   PIPMEKILDGGVRHTLTMSEAADEAQRIVITDLLATAALNADWLDENVRAAIYNAFPNA
FT                   RP"
FT   gene            297056..298684
FT                   /locus_tag="BMI_II305"
FT   CDS_pept        297056..298684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II305"
FT                   /product="major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II305"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49441"
FT                   /db_xref="GOA:C7LHF3"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHF3"
FT                   /protein_id="ACU49441.1"
FT                   /translation="MPQRVSPLAPFQNKTFRALWSATLVSNLGGLVQTVGAGWMMATIA
FT                   RSDDMVALVQASTTLPVMIFSVAAGALADNFDRRRIMLVAQILLLGISVILAACAYFNV
FT                   LTPWMLLSFTFLIGCGGALHNPSWQASMGDIVPRHDLPAAVALNSMSFNLMRSIGPAIG
FT                   GLIVAAAGAAFAFIFNAFSYCALILALWQWKPQTAKSTLPREKFGGAMVAGLRYVSMSP
FT                   NLLKVMFRGFLFGLSAIVILALLPLVARDLVKGTALTYGIMLGFFGLGAIGGAILSARL
FT                   RELMGNEWLVRGSFVAFAASCVLLSLSRQMWLSCLFLLPAGVAWVLALSLFNVTVQLST
FT                   PRWVVGRALALYQTATFGGMAAGSWLWGALADTFGVPNALLVSAAVLLFGALIGLLLPQ
FT                   PEFESLNLDPLNRFSEPQLRLDLRSRSGPIMIMVDYKIAQDDVPAFLAAMTLRRRIRIR
FT                   DGARQWALLRDLENPELWTESYHVPTWVEYVRHNQRRTQADAEVSERLLALHCGTTPPV
FT                   VHRMIERQTVPVHDDMPLKTHLDLT"
FT   gene            298671..298787
FT                   /locus_tag="BMI_II306"
FT   CDS_pept        298671..298787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II306"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49442"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHF4"
FT                   /protein_id="ACU49442.1"
FT                   /translation="MILPDKASFLCSLSLQFTGSGKALPEFSLFPIYLLTGN"
FT   gene            complement(298841..299167)
FT                   /locus_tag="BMI_II307"
FT   CDS_pept        complement(298841..299167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II307"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49443"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHF5"
FT                   /protein_id="ACU49443.1"
FT                   /translation="MKLNLERRTGTGGTKLTGHILHPEAFEREFGAAKPADKKCQTGKL
FT                   LADRTPRPWTFTLKAGLLAHGSTLPPAFPAFASGMGRKARRLQLRGQLRHCPPTMGKRT
FT                   GFPS"
FT   gene            299361..299582
FT                   /gene="nrdH"
FT                   /locus_tag="BMI_II308"
FT   CDS_pept        299361..299582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdH"
FT                   /locus_tag="BMI_II308"
FT                   /product="glutaredoxin-like protein nrdH"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II308"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49444"
FT                   /db_xref="GOA:C7LHF6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHF6"
FT                   /protein_id="ACU49444.1"
FT                   /translation="MNVTVYSKPACVQCTATTRALDRQGIDYKVIDISADANAFDLVQG
FT                   MGYRQVPVVVAGENHWAGFRPDMISSLA"
FT   gene            299596..300003
FT                   /gene="nrdI"
FT                   /locus_tag="BMI_II309"
FT   CDS_pept        299596..300003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="BMI_II309"
FT                   /product="ribonucleotide reductase stimulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II309"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49445"
FT                   /db_xref="GOA:C7LHF7"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHF7"
FT                   /protein_id="ACU49445.1"
FT                   /translation="MSLIVYFSSRSGNTHRFVERLGVRSSRIPLEASGALQVREPFVLV
FT                   TPTYGGGSTKGAVPNPVIRFLNDADNRALIRGVIAAGNSNFGEAFCIAGNIISAKCGVP
FT                   YLYRFELLGTAEDVGNVRNGMEQFWTRQTQA"
FT   gene            300054..302195
FT                   /gene="nrdE"
FT                   /locus_tag="BMI_II310"
FT   CDS_pept        300054..302195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE"
FT                   /locus_tag="BMI_II310"
FT                   /product="ribonucleotide-diphosphate reductase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49446"
FT                   /db_xref="GOA:C7LHF8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHF8"
FT                   /protein_id="ACU49446.1"
FT                   /translation="MTAGKPAKSSDGLDYHALNAMLNLYDEDGKIQLDCDRQAARQYFL
FT                   QHVNQNTVFFHNLREKLDYLVAEGYYEQTVLDQYSFNFVRDLFDEAYARKFRFPTFLGA
FT                   FKYYTSYTLKTFDGKRYLERYEDRVCMVALTLARGDEQLARDLVEEIISGRYQPATPTF
FT                   LNAGKKQRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALCLTNLREAGAPIKQ
FT                   IENQSSGIIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIMRFLDTKRENADEKIR
FT                   IKTLSLGVVIPDITFELARNNEDMYLFSPYDVQRVYGVPLTEISVTEKYREMVNDAQIA
FT                   KKKINAREFFQVLAEIQFESGYPYIMFEDTVNRANPIDGRITMSNLCSEILQVSEASLF
FT                   HEDLSYEYLGKDISCNLGSLNIAAAMDAPDFGKTIETSIRALTAVSDMSHIGCVPSVAR
FT                   GNAESHAIGLGQMNLHGYLARERIFYGSEEGVDFTNIYFYTVAYHAVRASNRIAVETGK
FT                   SFKGFEKSKYASGEYFDKYTDQAWAPATEKVRRIFEDAGIAIPTQDDWCALKKAVMEGG
FT                   LYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAAFMTNDNLEYYQ
FT                   DAYEIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINRAQIYAWKKGIKTIYYIR
FT                   LRQMALEGTQVQGCVSCAL"
FT   gene            302210..303199
FT                   /gene="nrdF"
FT                   /locus_tag="BMI_II311"
FT   CDS_pept        302210..303199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="BMI_II311"
FT                   /product="ribonucleotide-diphosphate reductase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II311"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49447"
FT                   /db_xref="GOA:C7LHF9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHF9"
FT                   /protein_id="ACU49447.1"
FT                   /translation="MNMQYKTATKGRPASVRAINWNRIEDDKDLEVWNRLTGNFWLPEK
FT                   VPLSNDIQSWETLKPQEKQLTIRVFTGLTLLDTIQNAVGAVKLMDDALTPHEEAVLSNI
FT                   SFMEAVHARSYSSIFSTLCLTPDVDDAYRWSEENEFLQRKSTLILDQYHADDPLKKKIA
FT                   SVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGHKFQRALEVLSE
FT                   EKRQEIKDFAFELLLELYDNEVRYTEALYDGVGLTEDVKKFLHYNANKALMNLGYEALF
FT                   PAEACKVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWAF"
FT   gene            complement(303369..303593)
FT                   /locus_tag="BMI_II312"
FT   CDS_pept        complement(303369..303593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II312"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49448"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHG0"
FT                   /protein_id="ACU49448.1"
FT                   /translation="MHVAILPPSLSLGALRGIRRLSAFDRRWGGRVSMPETYSSKNNFS
FT                   RIRILFPLFFNRLKLKDLLFSHHFTAQIT"
FT   gene            303727..303819
FT                   /locus_tag="BMI_II313"
FT   CDS_pept        303727..303819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II313"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49449"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHG1"
FT                   /protein_id="ACU49449.1"
FT                   /translation="MLKKAFLEHDPGGMNEYWQDYNFIRMCLYC"
FT   gene            303804..303935
FT                   /locus_tag="BMI_II314"
FT   CDS_pept        303804..303935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II314"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49450"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHG2"
FT                   /protein_id="ACU49450.1"
FT                   /translation="MLILLIPFIWIEARSNRQYCLWTSWNLRGVSSFIAQSAPFYRE"
FT   gene            304065..304826
FT                   /gene="minC"
FT                   /locus_tag="BMI_II315"
FT   CDS_pept        304065..304826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="BMI_II315"
FT                   /product="septum formation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II315"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49451"
FT                   /db_xref="GOA:C7LHG3"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHG3"
FT                   /protein_id="ACU49451.1"
FT                   /translation="MPLTKMNQVLTETRPIRLKGRSFLAMVLSPELPLDGWLERLDDLA
FT                   RRSSGFFLGRPVVLDMENLAIERAQLVYLLQALNDRGVWIMGVEGARPSLLGPGMPPAM
FT                   RGGQPAADFEAPAGEPQANPGAPEPQISQAVRAPGHAVHAMPSMVITEPVRSGQSVYFP
FT                   EGDVTIVGSVASGAEVVAGGSIHIYGTLRGRALAGTAGNTSARIFCRKLEAELVAIDGL
FT                   YKTAEDLEPRFRGQAVQLWLDGDYMMIDTLS"
FT   gene            304854..305669
FT                   /gene="minD"
FT                   /locus_tag="BMI_II316"
FT   CDS_pept        304854..305669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="BMI_II316"
FT                   /product="septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II316"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49452"
FT                   /db_xref="GOA:C7LHG4"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHG4"
FT                   /protein_id="ACU49452.1"
FT                   /translation="MGKVIVVTSGKGGVGKTTSTAALGAALAQRNEKVVVVDFDVGLRN
FT                   LDLVMGAERRVVYDFVNVIQGDAKLTQALIRDKRLETLYLLPASQTRDKDTLTEEGVDL
FT                   VIDQLKKSFDWVICDSPAGIERGATLAMRHADVAVVVTNPEVSSVRDSDRIIGLLDSKT
FT                   LKAERGEKMDKHLLLTRYDPSRAERGDMLKVEDVLEILSIPLLGIIPESQDVLRASNVG
FT                   SPVTLADQRSAPAMAYLDAARRLAGEDVPMNVPSEKRGLLGKLFGRRAA"
FT   gene            305666..305938
FT                   /gene="minE"
FT                   /locus_tag="BMI_II317"
FT   CDS_pept        305666..305938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="BMI_II317"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II317"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49453"
FT                   /db_xref="GOA:C7LHG5"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHG5"
FT                   /protein_id="ACU49453.1"
FT                   /translation="MSIFRFFTRQQASAPQARERLQVLLAHERASYGGQSDLVAVLREE
FT                   ILAVIAKHIKVDREKVSVKMDRGDQVSTLEVDIELPLTAKKGRAA"
FT   gene            305982..306149
FT                   /locus_tag="BMI_II318"
FT   CDS_pept        305982..306149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II318"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49454"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHG6"
FT                   /protein_id="ACU49454.1"
FT                   /translation="MNRGTLLARLRELQALPKFQKRDICSISSFLSLDALAEHVRVCEE
FT                   AAGVASAAQS"
FT   gene            complement(306266..306342)
FT                   /locus_tag="BMI_II319"
FT   tRNA            complement(306266..306342)
FT                   /locus_tag="BMI_II319"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            complement(306478..306870)
FT                   /locus_tag="BMI_II320"
FT   CDS_pept        complement(306478..306870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49455"
FT                   /db_xref="InterPro:IPR022016"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHG7"
FT                   /protein_id="ACU49455.1"
FT                   /translation="MGIFDKIKNAIWGEAQAATPTAETPAATPSTPAAPVPAAGSAAPA
FT                   SGSVDVGAILDAAVKKSGQALNWKTSIVDLMKALGLDSSLQHRKELAQELGYTGDINDS
FT                   ATMNVWLHKQVIQKLKDSGGKLPAGL"
FT   gene            307246..308292
FT                   /locus_tag="BMI_II321"
FT   CDS_pept        307246..308292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II321"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   periplasmic spermidine/putrescine-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II321"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49456"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHG8"
FT                   /protein_id="ACU49456.1"
FT                   /translation="MKFARLALMGGIFATVAFTVGPAFARDLTVASWGGNYQDAQREIY
FT                   FKPFAEKTGKPLLDESWDGGYGVIQSKVKAGSPNWDVVQVEAEELALGCADGLYEKIDW
FT                   DKVGGKDKFLDSAVNDCGVGAIVWSTAIAYNGDKLKDGPKSWADFWDVKKFPGKRSLRK
FT                   SAKYTLEFALMADGVDKDDVYDVLSTPEGVDRAFKKLDELKPHIVWWEAGAQPLQLLAS
FT                   DEVVMASAYNGRITGINRSEGKNFKVVWPGSIYAVDSWVILKGAENKDAGLDFIAFASE
FT                   PEHQVKLPKYVAYGLPNKEAAAKVPEEYAADLPTAKANMKDALALDVDFWIDHSEELTK
FT                   RFNAWLAQ"
FT   gene            308366..309433
FT                   /locus_tag="BMI_II322"
FT   CDS_pept        308366..309433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II322"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II322"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49457"
FT                   /db_xref="GOA:C7LHG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHG9"
FT                   /protein_id="ACU49457.1"
FT                   /translation="MTDYRIRFENISKSYGDFKVIDGLNLDIERGEFVSLLGPSGSGKT
FT                   TLLMMLAGFENPSSGTIHVDGKSINSVPSYKRNMGVVFQNYALFPHMTVAENIAFPLQM
FT                   RGVGKAQAAEKVARVLDMVQLSAMSERKPSQLSGGQQQRVALARALVFEPHVVLMDEPL
FT                   GALDKQLREQMQLDIRALHNRLGLTIVFVTHDQSEALTMSDRIAVFNKGKIEQIGSPRA
FT                   IYDEPQTRFVAEFIGETNLAEGTVESVEGSRILIRLKDGTAIAASSASRPISGQNVLLS
FT                   IRPERIELGEADGAENRLAARVMDSVYQGDHLRIQLEAKAHNFVVRLDRKAREWQPGAD
FT                   VAASFKAADCWTILV"
FT   gene            309366..310594
FT                   /pseudo
FT                   /locus_tag="BMI_II323"
FT                   /note="spermidine/putrescine ABC transporter, permease
FT                   component pseudogene"
FT   gene            310597..311373
FT                   /locus_tag="BMI_II324"
FT   CDS_pept        310597..311373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II324"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II324"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49458"
FT                   /db_xref="GOA:C7LHH0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHH0"
FT                   /protein_id="ACU49458.1"
FT                   /translation="MGRVAKILFGVAAVVFLVAPLFAILPLAFTSSVFLTYPVPGWSVR
FT                   WFEELTTAEVWRRAIVNSLIIGFGTMALATVLGTMAALGLRTRGLFLSGPIRTLFLLPM
FT                   VVPAVVLGVGMQLFFVRLDIANSYFGVIVAHTVVSIPFVLVSVSGALAGIDRRLELAAE
FT                   SLGAAPLTVFRKITLPLAMPGIASGGVLAFATSLDEVVLTLFVAGPNQRTLARQMFSTI
FT                   RENISPAIAAAAFLFISGTVLIGLAAVLFKGRASPQ"
FT   gene            311685..311864
FT                   /locus_tag="BMI_II325"
FT   CDS_pept        311685..311864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II325"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49459"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHH1"
FT                   /protein_id="ACU49459.1"
FT                   /translation="MQAGSLRERFRCGLSIMIELQVFHFGTAILYSQAPSKFWGIEIYI
FT                   SKIAHINFIKLTFL"
FT   gene            311861..312085
FT                   /locus_tag="BMI_II326"
FT   CDS_pept        311861..312085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II326"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49460"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHH2"
FT                   /protein_id="ACU49460.1"
FT                   /translation="MSAMFNKFLNKTELSFETYWKLALIDAPALHLLSGGVRYRILRAS
FT                   LKRCFSFRFVQAAVLVKKFMFCNEIARVR"
FT   gene            312322..312849
FT                   /locus_tag="BMI_II327"
FT   CDS_pept        312322..312849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II327"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49461"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHH3"
FT                   /protein_id="ACU49461.1"
FT                   /translation="MSDPFYMNNLCNLDTPKGRAHSYINTYNVERAFRDNYTRYEYSFI
FT                   EFYAEHLCDLSRAFKGDMQMVLLLATVAQVALRADMIVENSGGRVQELPPSRRGITTYR
FT                   LADVTGIPRETTRRKLTAMEKMGWLTRENNFWCLAYEGDDAKIHQDLADVIDRSFRRAA
FT                   RFYVAVTPLVNS"
FT   gene            complement(312991..313491)
FT                   /locus_tag="BMI_II328"
FT   CDS_pept        complement(312991..313491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II328"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49462"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHH4"
FT                   /protein_id="ACU49462.1"
FT                   /translation="MKTLITALFLAGIALSAASAPAAAAGFECAYKKAPGDMKHVPDIK
FT                   YLEGGLTPAMFHQRLAEMVQKLVADKVPPALIVDHFVWAYCPSVAADKSLNDKQKTEHV
FT                   RRFAADVAALAYTAPSADELDVLVTLPLTQNLLDQIDSAAKDKKISRDDWMLNALQHAI
FT                   PTP"
FT   gene            complement(313560..316712)
FT                   /locus_tag="BMI_II329"
FT   CDS_pept        complement(313560..316712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II329"
FT                   /product="hydrophobe/amphiphile efflux-1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II329"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49463"
FT                   /db_xref="GOA:C7LHH5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHH5"
FT                   /protein_id="ACU49463.1"
FT                   /translation="MLSSVFINRPRLAIVIAIVITLAGLIAVTRIPVAQFPDIVPPQVS
FT                   VTATYPGASAETVEAAIAQPIEAQVNGVDDMIYMSSTSGNNGTYTLTVTFKVGSDPNLN
FT                   TVNVQNRVRLAEANLPQEVTRLGVTVKKQSSSFLQIITLFSPDSRYDELFLNNYGVINV
FT                   VDRLARVPGVGQAQSFGTFNYSMRIWFNTDALTSLNLTPNDIVNAISSQNVQAAVGRLG
FT                   APPMTDQQQIQLTLTTQGRLTDAKQFENIIIRANPDGSSVRLKDVARVELAAQSYDTIG
FT                   RLNGKPASVIAVYQAPGSNAVAAAEGVRNVMEQLKQSFPAGLDYKITYDTTVFVSSTIH
FT                   EVIKTLLEAFVLVVVVVFIFLGNFRATLIPTLAVPVSLIGTFAVLLVLGFSANTISLFA
FT                   MILAIGIVVDDAIVVVENVERVMAETGLPPKEAAKQAMQEITAPIIAITLVLLSVFVPV
FT                   AFIPGITGALYAQFALTVSVAMLISAINALTLSPALCGVFLKPHQGRKKSLYGRTMDKL
FT                   SSGIEKISDGYAHIVRRLVRMAFLSIVLVAGLGAGAYFLNTIVPTGFLPEEDQGLFFVQ
FT                   VNLPPAASQSRTAAVVSEIEADITKMAGVADVTSVTGFSFIDGLAVSNAGLMIVTLKPF
FT                   EERLKDNITVFDVIAEVNRRTAAIPSAVAITMNLPPILGLGSSGGFQYQLEDQEGQSPQ
FT                   QLASVAQGLVMAANQNPKLSRVFTTFATDTPQLNLNIDRQKALSLGVSPNNIFQALQST
FT                   LGGYFVNNFNTLGRTWQVIIQGEQQDRKTVEDIYRINVRSSHGDMVPLRSLVSVEERLG
FT                   PLYITRYNNYRSASIQGNAAPGVSSGEALAAMAQVSKTTLPPGYGYEWTGTALQELQAA
FT                   GQTSMILALAVLFAYLFLVALYESWTIPVGVLLSVTAGLAGAMLALWITGLSNDIYAQI
FT                   GIVVLIALASKNGILIVEFAKERREEGVPLEQAAIIGARQRFRPVMMTSFAFILGLVPL
FT                   VIAVGAAAASRRAVGTSVFGGMIAASAVGIFLIPMLYVVLERVREWGHARILRKPLYEE
FT                   EK"
FT   gene            complement(316716..317951)
FT                   /locus_tag="BMI_II330"
FT   CDS_pept        complement(316716..317951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II330"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49464"
FT                   /db_xref="GOA:C7LHH6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHH6"
FT                   /protein_id="ACU49464.1"
FT                   /translation="MVAFWTCRNAWFQHLPFAKRGDENAPSGPRRLRPWFLVLALGLAA
FT                   CSEDKSAPQQAAPLPPIPVGVIKITERPTHPQLSFVGRVEATDSVDLIARVDGFLDKRT
FT                   FTEGQAVKTGDLLFVLQKDALQAALDAAQANLAKAQADADNLKLQTERARSLYKQKTVS
FT                   QAMLDDRVAAEKQALAVVQQAQASLEQAQINLGYTDIRAPFSGRIGMANFSVGALVGPS
FT                   SGPLATIVSQDPIYVTFPVSDKTILDLTEGGRTATDRSNVAVSLTLSNGMTYPQTGAID
FT                   FTGIKINPNTDTLMVRAQFPNPNNVLIDGQYVQVTAASKHPVEALLVPQKAIMTDQSGN
FT                   YVLAVGEDNKVIQRQITQGSTFGSNVVVKSGLAVGDQVVVDGLQRIRPGQKVDPQIVDA
FT                   TTPAQKAMSVGN"
FT   gene            complement(318137..318670)
FT                   /locus_tag="BMI_II331"
FT   CDS_pept        complement(318137..318670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II331"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49465"
FT                   /db_xref="GOA:C7LHH7"
FT                   /db_xref="InterPro:IPR009200"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHH7"
FT                   /protein_id="ACU49465.1"
FT                   /translation="MSDLVFIAFPDEQKAEEVCQRVLELQREYLIELGDAVVVVKDSDG
FT                   RVKLNQLVNSTAAGAVSGALWGTLIGFIFFMPLVGTALGAATGAIGGKLTDVGIDDNFM
FT                   KDAASVLQPGSAGLFLLIRKMTTDKVLADLKGIGGTVVRTSLDEKAENALRKAIAEHVV
FT                   SSATQTAPTGTSGA"
FT   gene            complement(318745..318918)
FT                   /locus_tag="BMI_II332"
FT   CDS_pept        complement(318745..318918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II332"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49466"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHH8"
FT                   /protein_id="ACU49466.1"
FT                   /translation="MFVPDLCWSLNQKAAGRGENGVFRGMSDAKLWSTHIHTALRRFSP
FT                   YKISPTNSFAIS"
FT   gene            319034..319246
FT                   /locus_tag="BMI_II333"
FT   CDS_pept        319034..319246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II333"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49467"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHH9"
FT                   /protein_id="ACU49467.1"
FT                   /translation="MPGEFFCIYRVWILRFPEEWPERENNSCEKKTQFGQSTAFIVGTK
FT                   LRLSHFSSRESNGTRPELGSSAVAI"
FT   gene            319344..320762
FT                   /gene="gadB"
FT                   /locus_tag="BMI_II334"
FT   CDS_pept        319344..320762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gadB"
FT                   /locus_tag="BMI_II334"
FT                   /product="glutamate decarboxylase beta"
FT                   /EC_number="4.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II334"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49468"
FT                   /db_xref="GOA:C7LHI0"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHI0"
FT                   /protein_id="ACU49468.1"
FT                   /translation="MKITLEVIMTGSNYPARDLIASVFGTEALQEIAASRGFPEKEMQA
FT                   NAVYQIIHDELFLDGNARQNLATFCQTWDDDYVHKLMDLSINKNWIDKEEYPQSAAIDL
FT                   RCVNMVADLWNAPKFADNATGTNTIGSSEACMLGGMAMKWRWRKKMQEMGKPTDKPNFV
FT                   CGPVQVCWHKFARYWDVEIREIPMEPGRLFMGPEQMLEAVDENTIGVVPTFGVTYTGNY
FT                   EFPEPLQDALDKLQKTKGLDIDIHVDAASGGFLAPFCAPDIPWDFRLPRVKSISASGHK
FT                   YGLAPLGCGWVVWRDKEALPEELIFNVDYLGGQVGTFAINFSRPAGQVISQYYEFMRLG
FT                   REGYTKVQQAAYRVAQYIAREIEPLGPYEFICAGEEKGGIPAVCFRIREGEDPGYSLYD
FT                   LSERLRLTGWQVPAFALSGKASDITVMRVMCRRGFEMDLAALFIRDFKAGIEFFKSHPS
FT                   PKITPSMGTGFHHT"
FT   gene            320835..322367
FT                   /gene="gadC"
FT                   /locus_tag="BMI_II335"
FT   CDS_pept        320835..322367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gadC"
FT                   /locus_tag="BMI_II335"
FT                   /product="glutamate/gamma-aminobutyrate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II335"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49469"
FT                   /db_xref="GOA:C7LHI1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR022520"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHI1"
FT                   /protein_id="ACU49469.1"
FT                   /translation="MTTPTASPEAGKPAAVTPARMAKLSVLTLAIMNVTAVVSLRGLPS
FT                   EATYGLTSVFYYIFAAVFFLIPVSIVAAELATGWPQKGGVFRWVGEAFGPRWGFLAIFL
FT                   VWVESTIWFPTVLTFGAVAIAFAGPGQRWDEALAANKLYTIGIVLVVYWAATWVSLHGL
FT                   KSAARIAKWGGMIGTIIPAAILIVLGFTYYFSGNYIEVQLAWRDLIPDFTNFNNLVLAA
FT                   GIFLFYAGMEMNAIHVREIDNPARNYPLAILISSLVTVAIFVLGTLAIAFIIPASQINL
FT                   VQSLLITYDSFFKLFGIDWLSPVMAIALAFGVLGGVTVWVAGPSSALSVVGRAGYLPPF
FT                   FQKVNAKGAPSHILIVQGLIVTFLAIMFVVLPSVQAAYQILSQLTVTLYLIMYLLMFAA
FT                   AIHLRYSEPNTPRPYRVPFGAFGMWLFAGVGLVGSLIAFVLSFVPPSQIAVGSPSAYIW
FT                   MLIAGNVIFVAIPLITYAIRKPHWKTPEGSADFEPFNWEKEGRMPGSQQAAG"
FT   gene            322403..323356
FT                   /locus_tag="BMI_II336"
FT   CDS_pept        322403..323356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II336"
FT                   /product="glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II336"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49470"
FT                   /db_xref="GOA:C7LHI2"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHI2"
FT                   /protein_id="ACU49470.1"
FT                   /translation="MSSSSDAIKAALEKGRAAGLSATGGKNADYIPFLASVPSDLFGLA
FT                   VVTADGQTFKTGDADFAFAIESISKVFTLALVMEEIGPDSVREKVGADPTGLPFNSVIA
FT                   LELHNGKSLSPLVNAGAIATASLVPGDTADARWNNILECQCGFAGRRLKLSNEVNQSEQ
FT                   TTNFHNRAIAWLLYSAGTCYSDPMEAVDIYTRQCSTLVTATDLATMGATLAAGGVNPIS
FT                   GKRMVSAGNVAPILAEMTMEGLYTASGDWAYTVGLPGKSGVGGGIMAVVPGELAIAAFS
FT                   PPLDPAGNSVKAMAAVAAVADSLGHNLYTTRGKVSS"
FT   gene            323504..323848
FT                   /gene="hdeA"
FT                   /locus_tag="BMI_II337"
FT   CDS_pept        323504..323848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdeA"
FT                   /locus_tag="BMI_II337"
FT                   /product="hdeA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II337"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49471"
FT                   /db_xref="GOA:C7LHI3"
FT                   /db_xref="InterPro:IPR010486"
FT                   /db_xref="InterPro:IPR024972"
FT                   /db_xref="InterPro:IPR036831"
FT                   /db_xref="InterPro:IPR038303"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHI3"
FT                   /protein_id="ACU49471.1"
FT                   /translation="MIKALFNKNTALAAVAILALSGGAMAESAKTHKTDMAKKKVSELT
FT                   CEDFNGLEESFKPTVVGWVVGFNKKGKEEDAVIDVDGIETVTPAIIEACKQEPKASFWK
FT                   KAEAELKKVF"
FT   gene            324011..324109
FT                   /locus_tag="BMI_II338"
FT   CDS_pept        324011..324109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II338"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49472"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHI4"
FT                   /protein_id="ACU49472.1"
FT                   /translation="MQGVENAFGLSLVIRYIYYGLRCDKLVILKKS"
FT   gene            324361..324612
FT                   /locus_tag="BMI_II339"
FT   CDS_pept        324361..324612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II339"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49473"
FT                   /db_xref="GOA:C7LHI5"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHI5"
FT                   /protein_id="ACU49473.1"
FT                   /translation="MQHPWEASGANVIFARMKNYKAYWQEEQIMQFLNDYAAFIDVVAL
FT                   LCLIILAVAGAIRQKSIGLIILALAVTFWALVRFFKLI"
FT   gene            complement(324689..326281)
FT                   /locus_tag="BMI_II340"
FT   CDS_pept        complement(324689..326281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II340"
FT                   /product="EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49474"
FT                   /db_xref="GOA:C7LHI6"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHI6"
FT                   /protein_id="ACU49474.1"
FT                   /translation="MKRHHWLIATFACIVFAIIAPALAAVYTSSVVAAHREQIQLTLFA
FT                   TYVIERTDTTFSGVSQALMQTQMLTDKPCSKEHMDDLKRIAIETRPITEIGYFDDGLLK
FT                   CTSWGMAGMRVAAGTPAFTTRNGVKVVLNMTASIPTTANMLGLQRGAYCILIDPKWFVD
FT                   EIVPKGVQIAVASPDGTVVAALNHPDPAVIRQFLKPSDTKPPSRYLGAVVRGSDWTAIA
FT                   ITPRASIWTSMQEELLVFLPIAGVISTGMVILTIWLSRRRLSLRGELAIAIRRREFTVV
FT                   YQPLIELKTGICVGAEALVRWRRPDGAMVMPDLFIPIAENSKMISQITEQVVANTVRDL
FT                   GDVLAADEALHVAINMAADDLAQGRILTVVQRAIRGTGIRTEQIWLEATERGFMDPKST
FT                   RTIIEKARELGHSIAIDDFGTGYSSLHYLQELPVDTLKIDKSFISTLGTDSATSPIAAH
FT                   IIAMAKSLDLIIVAEGIERQEQADYLIAHGVQFGQGWLYSPPLPAQEFIEFYKAQKATK
FT                   GAGPAIIRKKKHA"
FT   gene            complement(326576..326842)
FT                   /locus_tag="BMI_II341"
FT   CDS_pept        complement(326576..326842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II341"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49475"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHI7"
FT                   /protein_id="ACU49475.1"
FT                   /translation="MSHRTIFLPKMAHPDTLDGPALLILSIAKTRMGAYPVYPPYRLGN
FT                   TVNGEVRVCHRAPLGASDQLIVRRIAGYDCNTPQHRWSIIRPG"
FT   gene            327071..327958
FT                   /locus_tag="BMI_II342"
FT   CDS_pept        327071..327958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II342"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II342"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49476"
FT                   /db_xref="GOA:C7LHI8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHI8"
FT                   /protein_id="ACU49476.1"
FT                   /translation="MRFNLRALQAFEAVSRHLSVLKAAEELGITSSAVSHQLRILTEDL
FT                   GYNLIEREGRNIVLTERGLQFARHLQDAFRHVQLAMVEGRSVQNDRVRIAACSSFCQGF
FT                   LIDLVADTIAQEGGYEIDMRMYANDPQLASVVADIFVTSDDIPHGYWATDLFTEQLVAV
FT                   CTPACRDEELKTRSVPFIKNEALELTGECRWLLYKQELPETELPVENRLILRTSHFILA
FT                   LEMANRGLGMALVPDFLARAGLQSGELVQLYPAVIPSGRKYKICCRPSLRTKPPYSQAI
FT                   RQIILATSPEARSA"
FT   gene            complement(328079..329494)
FT                   /locus_tag="BMI_II343"
FT   CDS_pept        complement(328079..329494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II343"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II343"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49477"
FT                   /db_xref="GOA:C7LHI9"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHI9"
FT                   /protein_id="ACU49477.1"
FT                   /translation="MSFIPVIISGGSGSRLWPLSRDAHPKPFIKLPDGETLIGKTYARA
FT                   SRLVNAEQILTVTNRDFLFLTLDAYAAAGAAQMENTFLLEPLGRDTAPAVALAALHAAE
FT                   AYGPDATLLVMPADHLIEDEQAFAEAVAKARALAEAGRIVTFGIVPDRPETGFGYIEVQ
FT                   GTDVQRFVEKPDEATAQTYVESGRYFWNSGMFCFKALSMIDAMQRYAPQVLAGARAALA
FT                   QARRGNNGETKTLEIARDEFAATPAISIDYAVMEKADNMACVPVSCGWSDIGSWAAMAD
FT                   LVTPDENGNRLRGETVLEDTTNSFVLSETRLVSLVGVHDLLVVDTPDALLVAHRDKAQE
FT                   VRSVFNKLRKQGHEAAKLHRTAHRPWGTYTVLEEGDGFKIKRIEVKPGRRLSLQAHHHR
FT                   SEHWIVVSGTAKVTNGDREILLTTNQSTYIPCGFRHRLENPGILPLVLIEVQSGEYLGE
FT                   DDIVRYDDVYGRV"
FT   gene            complement(329491..330924)
FT                   /locus_tag="BMI_II344"
FT   CDS_pept        complement(329491..330924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II344"
FT                   /product="phosphoglucomutase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II344"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49478"
FT                   /db_xref="GOA:C7LHJ0"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHJ0"
FT                   /protein_id="ACU49478.1"
FT                   /translation="MSSNSLKFGTSGLRGLAVELNGLPAYAYTMAFVQMLAAKGQLQKG
FT                   DKVFVGRDLRPSSPDIAALAMGAIEDAGFTPVICGVLPTPALSYYAMGAKAPSIMVTGS
FT                   HIPDDRNGLKFYRRDGEIDKDDEAAISAAYRKLPAILAARKHVGSTETDAALQAYADRY
FT                   AGFLGKGSLNGLRVGVYQHSSVARDLLMYLLTTLGVEPVALGRSDIFVPVDTEALRPED
FT                   IALLAQWGKSDRLDAIVSTDGDADRPLIADEHGQFVRGDLAGAITATWVGADTLVTPVT
FT                   SNTALESRFPKVLRTRVGSPYVIASMAQASTGNSGPVIGFEANGGVLLGSTVERNGRSL
FT                   TALPTRDALLPILACLATVHEKKTPLSTIARSYGFRVALSDRLQNIPQEASTTFLALLE
FT                   DADKRASLFPAGDAIVRVETIDGVKLFFQSGNAVHYRASGNAPELRCYVESSDDTQAAK
FT                   LQALGLEIARKALKDATRP"
FT   gene            complement(331044..332150)
FT                   /locus_tag="BMI_II345"
FT   CDS_pept        complement(331044..332150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II345"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49479"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHJ1"
FT                   /protein_id="ACU49479.1"
FT                   /translation="MDRRTFAKSLAGLGAMPFAVNTASAGAAKEGKTMLELMGGSITDV
FT                   PGIKLGHHTLTRRPTGCSVLLCEEGATAGVDVRGSAPGTRETDLLDPINFVQKVQAILL
FT                   SGGSAYGLAAATGVMRYLEENNLGFEIGKGVVPIVPAAILMDLGVGDFSVRPDEEAGYL
FT                   ACKAATAAPSGEGNIGAGAGATVGKMFGMDYAMKGGLGTASYKVPGTEIVVGAIVAVNA
FT                   VGDVRAPNSHRILAGARTEDGKGFRNTMAAIMQGHGVVKSGGANTTIGAIATNAPFGKA
FT                   ELKKIAGMAHDGFARTINPVHTMWDGDTIFALSTGKAKDGQADVTAIGAIAASVMADAV
FT                   ARAVVQAESLPHLNLPAHRDYMIAESTR"
FT   gene            complement(332174..333529)
FT                   /locus_tag="BMI_II346"
FT   CDS_pept        complement(332174..333529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II346"
FT                   /product="voltage gated chloride channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II346"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49480"
FT                   /db_xref="GOA:C7LHJ2"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHJ2"
FT                   /protein_id="ACU49480.1"
FT                   /translation="MRKSYKRVPVIRRSHAMWMSPRVWKPRLVFWCGALAIGIISVGFA
FT                   EAADIAQDWFHSLTSGSPLRAWLPLLITPLGFMFCSWVALVWFPNSGGSGIPQAIAARH
FT                   LNDHEDRSLLLSIRVATGKIVLTIIGLFCGASIGREGPTVQIGASIMLQAARFGGMEKA
FT                   RGLILAGSAAGIAAAFNTPLAGIVFAIEEMGRAYAARTNGLVLSAVILAGLASLGLVGN
FT                   YNYFGFTTVTASTGKDWILTIACGIFGGAFGAAFSALALNMGRRVRRRVQKAPLRNMVI
FT                   FAGICGLLVALIGIASGGMTFGAGYDQARSAVEGATLPPFYFVEKFTVGLLSMISGIPG
FT                   GIFAPSLSVGAGLGSTIGLLLGTSASLAAVLGMAGYFAGAVQAPMTAFVIILEMTGNHS
FT                   NVIPLMCASMLGYGTARLISHEPLYHALSRIFVADILRQRRAREKTIQPELT"
FT   gene            333724..335217
FT                   /gene="guaB"
FT                   /locus_tag="BMI_II347"
FT   CDS_pept        333724..335217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BMI_II347"
FT                   /product="inositol-5-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II347"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49481"
FT                   /db_xref="GOA:C7LHJ3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHJ3"
FT                   /protein_id="ACU49481.1"
FT                   /translation="MAKIVESPTGALALTFDDVLLQPGHSEVMPGQVDLRTRIAKDIEL
FT                   NLPLLSAAMDTVTESRLAIAMAQAGGIGVIHRNLSPERQAEEVRQVKKFESGMVVNPVT
FT                   IGPDATLADAQALMKAHGISGIPVVENATKGPGRLVGILTNRDVRFASDPKQKIYELMT
FT                   RENLITVHENVNQDEAKRLLHSHRIEKLLVVDDKGRCVGLVTVKDIEKSQLNPNAAKDA
FT                   QGRLRAAAATSVGADGFERAERLIDAGVDLLVVDTAHGHSQRVLDAVARIKKAYPNVAV
FT                   LAGNVATTAGTQALIDVGADAVKVGIGPGSICTTRIVAGVGVPQLSAIMSAVEAAQKQN
FT                   IPVIADGGIKFSGDFAKALAAGAVAAMAGSLLAGTEESPGEVYLHQGRSFKAYRGMGSV
FT                   GAMARGSADRYFQAEVRDELKLVPEGIEGQVAYKGPISAVLHQLAGGLRASMGYVGAKT
FT                   LEEFREKATFVRISNAGLRESHSHGVAITRESPNYPGGM"
FT   gene            complement(335377..336495)
FT                   /locus_tag="BMI_II348"
FT   CDS_pept        complement(335377..336495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II348"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II348"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49482"
FT                   /db_xref="GOA:C7LHJ4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHJ4"
FT                   /protein_id="ACU49482.1"
FT                   /translation="MRWSDVGIYGVVFCLSLGYFAATSDSSRSKPASARPHASNVAENS
FT                   TKAAPQNAAAAAAVADKEKEKAPAAKAVEPEQAAWDIADPDTLPDNAWGKIVRQGRDLI
FT                   TETYAHIGPEVADEAKRFAGNNLSCQNCHLEAGTKQYGLPLVGVYGDFPQYRSREGQIG
FT                   TIEDRINGCMTRSLNGEPLPLDSAEMKAMVAYIKYVSAGTVVGEETKGRGSGKMPELKR
FT                   AADPVHGEKLYAEICAACHGADGQGKRTGVVGDAKGYEFPPLWGPDSFNDGAGMNRLIS
FT                   AANFIHANMPNGVSLEEPQLEPEDAWDIAAFFQSKPRPAKANLQNDFPNRLEKPVDASY
FT                   GPYADSFPAQVHKVGPFEEIRAEIKKLKTATN"
FT   gene            complement(336563..337516)
FT                   /gene="oxyR"
FT                   /locus_tag="BMI_II349"
FT   CDS_pept        complement(336563..337516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="BMI_II349"
FT                   /product="transcriptional regulator OxyR"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II349"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49483"
FT                   /db_xref="GOA:C7LHJ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHJ5"
FT                   /protein_id="ACU49483.1"
FT                   /translation="MFTVRQIRYFDALASTLHFRKAAELAHVSQPALSAQIAEMEAIAG
FT                   APLFERSQRQVIMTELGKHLYPGIKAILRELQKLEEIAAQSRGVLQTGIKLGIIPTVAP
FT                   YLVPVLIPLLHEQHPSFRLQLRESVTAKLLEELHAGDLDAIVAALPIDDEKLSHQKLFD
FT                   DRFLIATSTNDHTVLASPMTQNHAALERLLLLEEGHCMRDQALAVCTLPSQRQLVKYGA
FT                   TSMSTLLQMVSHGMGLTLIPEIAVRAEARSNHMRIVPFEGEQPKREIALFWRRQSMRGK
FT                   DFRALAECIAESANKLKIDPSKIDTLLDNPSTPSYS"
FT   gene            337686..339185
FT                   /gene="katA"
FT                   /locus_tag="BMI_II350"
FT   CDS_pept        337686..339185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katA"
FT                   /locus_tag="BMI_II350"
FT                   /product="catalase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49484"
FT                   /db_xref="GOA:C7LHJ6"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHJ6"
FT                   /protein_id="ACU49484.1"
FT                   /translation="MTDRPIMTTSAGAPIPDNQNSLTAGERGPILMQDYQLIEKLSHQN
FT                   RERIPERAVHAKGWGAYGTLTITGDISRYTKAKVLQPGAQTPMLARFSTVAGELGAADA
FT                   ERDVRGFALKFYTQEGNWDLVGNNTPVFFVRDPLKFPDFIHTQKRHPRTHLRSATAMWD
FT                   FWSLSPESLHQVTILMSDRGLPTDVRHINGYGSHTYSFWNDAGERYWVKFHFKTMQGHK
FT                   HWTNAEAEQVIGRTRESTQEDLFSAIENGEFPKWKVQVQIMPELDADKTPYNPFDLTKV
FT                   WPHADYPPIDIGVMELNRNPENYFTEVENAAFSPSNIVPGIGFSPDKMLQARIFSYADA
FT                   HRHRLGTHYESIPVNQPKCPVHHYHRDGQMNVYGGIKTGNPDAYYEPNSFNGPVEQPSA
FT                   KEPPLCISGNADRYNHRIGNDDYSQPRALFNLFDAAQKQRLFSNIAAAMKGVPGFIVER
FT                   QLGHFKLIHPEYEAGVRKALKDAHGYDANTIALNEKITAAE"
FT   gene            339280..339489
FT                   /locus_tag="BMI_II351"
FT   CDS_pept        339280..339489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II351"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49485"
FT                   /db_xref="GOA:C7LHJ7"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHJ7"
FT                   /protein_id="ACU49485.1"
FT                   /translation="MYSASESAGGSDMMLAIFIFMTIAMWFCWFGRLSIALVCMFLCLA
FT                   LATKEFLWEIHSADYGYSMPWVQL"
FT   gene            339518..340144
FT                   /locus_tag="BMI_II352"
FT   CDS_pept        339518..340144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II352"
FT                   /product="disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II352"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49486"
FT                   /db_xref="GOA:C7LHJ8"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHJ8"
FT                   /protein_id="ACU49486.1"
FT                   /translation="MNAVNMHEPGLSASRQSGNLFAPLQFLYLIAMLFVLAGILTAAMV
FT                   LQYGAGEVPCPLCLLQRMAMFGVCFGVMLQLRYGPSFRFSGIGLLFAIVLLIISVRQTL
FT                   LDIYPRPGHEYIGSTVFGLHMPVWSILIALALIAAFAVQMMVWGGRHGQTIAQIKNHPV
FT                   INGLGTILALYVLAVATINMASVFVQCGVGQCHTMGYALLGYPGK"
FT   gene            340321..341610
FT                   /locus_tag="BMI_II353"
FT   CDS_pept        340321..341610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II353"
FT                   /product="sun protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II353"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49487"
FT                   /db_xref="GOA:C7LHJ9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHJ9"
FT                   /protein_id="ACU49487.1"
FT                   /translation="MRLGGRLQAAIEVLGEIEAGKRPASDVLKEWGAAHRFAGAGDRAV
FT                   IGNIVYDALRRKLSILWRMDADDARALAFGGLLADDGMDIEMVDAALHGDRFAPEGLDA
FT                   ARRAAWQSRDLATAPAHIQADVPEWCIPSLEELFGERWVSEGKALATRPPVDLRVNSLK
FT                   ATPEKTLAALEKAGAAPAPFLAQALRIPPIEALGRHPNVQGEQAFLDGWFEVQDLGSQL
FT                   AALFAGVKPGEQVLDYCAGAGGKTLALAAAMGNSGQIHAYDAERARLSPMHERLQRAGV
FT                   RNTQVYGGLDELGPLAGKMDLVLTDAPCTGSGTWRRRPDAKWRLNEQQLERRVQDQQDV
FT                   LDSARRFVKPGGRLAYVTCSLFAEENTRQVARFLGENPDFKEIAPQTLWGTVVQDDSAG
FT                   KPVFPSHGSVFSPLSTGTDGFYVSILQRQN"
FT   gene            341901..342356
FT                   /locus_tag="BMI_II354"
FT   CDS_pept        341901..342356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II354"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49488"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHK0"
FT                   /protein_id="ACU49488.1"
FT                   /translation="MSAQRIAEPDFKERVEESFGRQAAMKLIGAELTRCEPGIVEVEMP
FT                   FREELTQQHGILHAGMISAALDSACGYAALTLMPADAAVLTIEFKVNLLAPGKGERFLF
FT                   RGEVTKPGRTIMVSDGQAFAVTDTEVRLIATMTGTMMVVQDRKGLQG"
FT   gene            342353..342985
FT                   /locus_tag="BMI_II355"
FT   CDS_pept        342353..342985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II355"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II355"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49489"
FT                   /db_xref="GOA:C7LHK1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010050"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHK1"
FT                   /protein_id="ACU49489.1"
FT                   /translation="MMKTVAGKRLLYVMAADAEYGRHLAKLFTPLMIGVGPVEAAVNLA
FT                   SALAHLKLAGDMPDLVISLGSAGSAKLPQAEVYQVSSVSYRDMDASPIGFEKGVTPFLD
FT                   LPETVELPFRVAGIDTASLSTGGNIVSGKAYERIEADMVDMETYACLRACQAVGVPLLG
FT                   LRGISDGASELKHVGDWTQYLHVIDEKLAGAVARVERAVADGLLSPS"
FT   gene            343094..344656
FT                   /gene="guaA"
FT                   /locus_tag="BMI_II356"
FT   CDS_pept        343094..344656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BMI_II356"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II356"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49490"
FT                   /db_xref="GOA:C7LHK2"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHK2"
FT                   /protein_id="ACU49490.1"
FT                   /translation="MSTTAYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEA
FT                   FKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDAGIPVLGICYGEQTMCAQLGGNVESGH
FT                   DREFGRAFLDVQEDSPLFAGIWAKGTRHQVWMSHGDRVTSLPDGFTIIGTSPNAPYAVI
FT                   ADEKRKYYGVQFHPEVVHTPDGAKLLQNFVHRIVGVKPGWTMGAYREQAVEAIRKQVGS
FT                   GKVICALSGGVDSSVAALLAHEAVGDQLTCILVDHGLMRKDEAQQVVEMFREHYNLPLI
FT                   LVDASDRFIGALEGESDPEKKRKTIGRLFIEVFEEEARKLGGADFLVQGTLYPDVIESV
FT                   SFTGGPSVTIKSHHNVGGLPERMKMQLVEPLRELFKDEVRLLGKELGLPDSFIGRHPFP
FT                   GPGLAIRCPGGVTREKLEILREADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDG
FT                   RTYEFVCALRAVTSVDGMTADFYHYDMNFLGNAATRIINEVRGINRVVYDVTSKPPGTI
FT                   EWE"
FT   gene            344965..346173
FT                   /locus_tag="BMI_II357"
FT   CDS_pept        344965..346173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II357"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II357"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49491"
FT                   /db_xref="GOA:C7LHK3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHK3"
FT                   /protein_id="ACU49491.1"
FT                   /translation="MLTDTKLRNLKPKDKLYKVNDRDGLYVAITPAGSISFRYNYSIHG
FT                   RQETITFGRYGVGGITLAEARERLGEAKKMIAAGKSPAKEKARDKARVKDAETFGAWAE
FT                   KWLRGYQMSETTRNMRRGTYERDLKPKFGNRKLIEITHEDLRALTDAIVEQGRPSTAVV
FT                   CREIMMLVFRWAIERGQKVENPADLVRPSTIAKFEPRDRALTPEEIGLMYQYMERIGTT
FT                   PSIRAAAKLLLLTMVRKSELTNATWSEINFIDALWTIPKERMKRRNPHLVFLSRQVLEI
FT                   FTALKTFAGGSEYVLPSRYDSDLPMSSATLNQVLTLTYRLAQKEGQSLGKFGPHDLRRT
FT                   ASTLLHEAGYNTDWIEKCLAHEQKGVRAVYNKAEYRDQRRAMLQDWADMIDEWTIRKIR
FT                   PKD"
FT   gene            346458..346688
FT                   /locus_tag="BMI_II358"
FT   CDS_pept        346458..346688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II358"
FT                   /product="DNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II358"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49492"
FT                   /db_xref="GOA:C7LHK4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHK4"
FT                   /protein_id="ACU49492.1"
FT                   /translation="MEKELRRASKVLISKKQLLEMIPLCERTIYNFEKQGKFPQRIALS
FT                   SRKVVWDLAEVEAWIDACKHSSPAPRPGMGA"
FT   gene            346769..347827
FT                   /locus_tag="BMI_II359"
FT   CDS_pept        346769..347827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II359"
FT                   /product="repA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II359"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49493"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHK5"
FT                   /protein_id="ACU49493.1"
FT                   /translation="MSSRNSGLKPIGAVIGDSGGLLERLENIRKRNSDRTPAAERGRPS
FT                   NVSTVHEQMERAKERDKALSLVRKPPQGDAQPDFFAPSLYDVGGRDNRSVMDVAVFRLS
FT                   KKDKRAGELIRYDLPDGYVEVSAGAHGMASVWDYDIVLMMVSHLTEAMNRYREGKGGKP
FT                   GRVFRLHVSDILRFARRGNGSSQVKGVEAALDRLRGTTIKTVRESGRFRATEAEGLIAR
FT                   YRVLSRTDTKKISSVEIEAPEWIYREVTEGKRPEVLTVHRDYFLIEPGIGRFIYRLARR
FT                   AAGRDSAKWAFKTLYERSGSGGSFKKFCFFLRGIIKADDLPEYALCEEAGKDGPLLVMR
FT                   HRNSSSEPLGGS"
FT   gene            complement(348940..349266)
FT                   /locus_tag="BMI_II360"
FT   CDS_pept        complement(348940..349266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49494"
FT                   /db_xref="GOA:C7LHK6"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHK6"
FT                   /protein_id="ACU49494.1"
FT                   /translation="MMNDIFFGLMMLGGFFVLGIGMWALGQWLRRKGFGPQLDALDKQY
FT                   TALQHRVNRLALPAAAHFYGGMGMLNRMPLFGSKNQVVLVERVRMAILQMEEEERQRGR
FT                   GINR"
FT   gene            complement(349269..350912)
FT                   /gene="trbL"
FT                   /locus_tag="BMI_II361"
FT   CDS_pept        complement(349269..350912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /locus_tag="BMI_II361"
FT                   /product="P-type conjugative transfer protein TrbL"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II361"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49495"
FT                   /db_xref="GOA:C7LHK7"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHK7"
FT                   /protein_id="ACU49495.1"
FT                   /translation="MRRTTVFALVGAVLLLSATSAMAAGVDLAQSNTSMNSLLRLIQNA
FT                   SNQWAPRLHDYALWLLGCLAVIQLVWTFAPLVMRGAELGDLLHELVKYILVIGFFYAML
FT                   DHATEWGGAIVNSFRQAGAHAAGLGSAELMPGDMFSTAVDFSRQVLTAGVSMFSPITSV
FT                   VVAVSALIVLMCFTFIAALVFVTLVEAYVIINAAVLFMGFGGSQWTREYALAPIRYAVA
FT                   VGAKLFVLTLIVGLIMQVSAEWSAAYTNDEASLMTLVGLSLVCAYLTKTIPELIGGMIS
FT                   GTSMGGGSAIGGMAAAGAAGAAAAIATVATSGAAAPAAGALGAAGTGGGAASAAGGGLA
FT                   SALNASMAGGSTAGGIGGATGVGSAGIGASTGGGSGATAKAAGSRVGGGAASGSANPVS
FT                   AAASPASQESGSGLKQAAKQAGKAAKGGDDDMDQQAVAQQRQMTPKEGTGGNGKTVAQG
FT                   AEVATRALGVLGAISVPGMESSHGLSLGGTGSPPPVPGSDSPASDDGAESTAQAESNII
FT                   RPASDTTSTGDVGALNVPGMASSVNSQSET"
FT   gene            complement(350915..351097)
FT                   /gene="trbJ"
FT                   /locus_tag="BMI_II362"
FT   CDS_pept        complement(350915..351097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="BMI_II362"
FT                   /product="P-type conjugative transfer protein TrbJ"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II362"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49496"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHK8"
FT                   /protein_id="ACU49496.1"
FT                   /translation="MMISKALIAALCLVSALGGSALTAVVVTNAAAPECAAVGNGHQDD
FT                   QFRSRPNTRGPSEGF"
FT   gene            complement(351100..351891)
FT                   /locus_tag="BMI_II363"
FT   CDS_pept        complement(351100..351891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II363"
FT                   /product="trbJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II363"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49497"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHK9"
FT                   /protein_id="ACU49497.1"
FT                   /translation="MEMESQKTSAYAARKFGRDAALALAMASAGLGVSLYMAPAPAYAI
FT                   YCSNCSTFYQQMYEYAEAVNTQLNTAQQLQTQIQQYDNMIKQGMSLPSRMFNTITGDLQ
FT                   RVASVYNSAQSLGRNISNLDEQFRQQFKGYDSYLNSIGQGQNNMPQRYRDWAQSGFDNA
FT                   RTAMQAAGVNTSTFEDENALLDQLVSRSQSAIGRQQAIQAGNEIAAQNVQQLQKLRDLV
FT                   ATQITLQGNYMAQQNERQSVSDASEQQFRSRENTRGPSEGF"
FT   gene            351989..352141
FT                   /locus_tag="BMI_II364"
FT   CDS_pept        351989..352141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II364"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49498"
FT                   /db_xref="GOA:C7LHL0"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHL0"
FT                   /protein_id="ACU49498.1"
FT                   /translation="MIYVRKLSVNLQEIVSQHYVLIAFFMTSGTGLAVRFDTFCGQKKP
FT                   TEVSF"
FT   gene            complement(352159..352383)
FT                   /locus_tag="BMI_II365"
FT   CDS_pept        complement(352159..352383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II365"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49499"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHL1"
FT                   /protein_id="ACU49499.1"
FT                   /translation="MKTAHRISALANQLNELQACLGRASGRPSKSVMEAQRIAAELASL
FT                   LEEWHLETLHIPETERDLYRVQNPYYAAH"
FT   gene            complement(352386..352604)
FT                   /gene="traC"
FT                   /locus_tag="BMI_II366"
FT   CDS_pept        complement(352386..352604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /locus_tag="BMI_II366"
FT                   /product="TraC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II366"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49500"
FT                   /db_xref="GOA:C7LHL2"
FT                   /db_xref="InterPro:IPR012930"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHL2"
FT                   /protein_id="ACU49500.1"
FT                   /translation="MDKLARKTLSERRADALSELETAKARLAKLDNEAAERIGRIAIKS
FT                   GLVNLELTDDQVREEFDRIVERISKGN"
FT   gene            353274..353654
FT                   /gene="traJ"
FT                   /locus_tag="BMI_II367"
FT   CDS_pept        353274..353654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traJ"
FT                   /locus_tag="BMI_II367"
FT                   /product="TraJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II367"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49501"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHL3"
FT                   /protein_id="ACU49501.1"
FT                   /translation="MAGENAIEAIKPHSRGTRPRRERIEVWVSIDEKKELAERADQAGL
FT                   SNAAFLRAVGLNLPIGSRADLEAVRQLAKVNGDLGRVAGLLKLWLAEKRGQGARPIDVE
FT                   AMMMDFRAIQEDMRALMGKISK"
FT   gene            353651..355603
FT                   /gene="traI"
FT                   /locus_tag="BMI_II368"
FT   CDS_pept        353651..355603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /locus_tag="BMI_II368"
FT                   /product="TraI protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II368"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49502"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="InterPro:IPR040677"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHL4"
FT                   /protein_id="ACU49502.1"
FT                   /translation="MIAHRINRERKASSPARLIKYMVAAKGGIDPTSWERTADYILDSA
FT                   NGTTEGEKVGSYRVTNCGTDDPADAAILIQTTQAANTRSKAEKTYHFVYSFPPGEQPDL
FT                   ETLHAIEDELCAAIGLDEHQRVSAVHIDTDNLHVHVAINKVHPTGLQNIEPYYDQFRLM
FT                   EACERLEVKHGLQRTFHGLEAKQRYQNRDIELLPAKAPEQRDSLFRKHLRNAYDLSISE
FT                   PPEAKTLNGLRKLSDTRLQRQSVDKAEPVRIGAKVASVEAQSGIETLTGYAARELAPAM
FT                   RQATSWQELHDAAAEHGLEVRQRGAGLVIGEPDLGIWAKASNVGRDLSMKALTDRLGPF
FT                   QPSERQAEAKANRKRYEPRPRRPDNPTTAGLFNQYQRERQAAILARRQGLDQIKRESAA
FT                   FNAQVRQWSQTERMLLKVAGKGPTKRLMYGTIKQQADASRQKNRQSADARRQALFKQTT
FT                   MPTWADWLTQQAERGNAEALAVLRDRKERTRRWNGELLTADRADKAKAVVLDKLKPRAR
FT                   KDGTMAYSTIDGGMVIDRKTHVQAQKATTGAALVALELASKRFEGQALIVEGTDEFRLE
FT                   VAQLAGMHGLKVTFTDPAMEQMRRETAEQKEMEKAFQAEVYGQKGIQVREGSKSASVMP
FT                   QCGKKRPEGRSNDLT"
FT   gene            355614..355874
FT                   /locus_tag="BMI_II369"
FT   CDS_pept        355614..355874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II369"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49503"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHL5"
FT                   /protein_id="ACU49503.1"
FT                   /translation="MQSKMQTLKLSWLAACFIVTGKRRMAPMKDRSHDAAMAEHFRADP
FT                   SYAAELLAEVRRNGDPAELAILLRLMVTDSVNAVRSEDADT"
FT   gene            complement(356010..357434)
FT                   /locus_tag="BMI_II370"
FT   CDS_pept        complement(356010..357434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49504"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040826"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHL6"
FT                   /protein_id="ACU49504.1"
FT                   /translation="MGLRAAILVDGGALTRQQDAIEEGLALFRDLHSSFPTADVTYNLA
FT                   NGLVAATGFPPHNENWLNHQELTRARRAEARQCFWKVAQDQDADSTLRTQAWTNIANQF
FT                   SNSYRLGEAQDGWLAALEIDPENGVAASSAARNLLWLYERGGCSELTRIEALMLAKIAD
FT                   RHRDRIIQYAGAQAAEQIAAFACELGDPPPRSPHKNPFITWAERERLTLAPVVELIDPT
FT                   MGKLDWLMLPGIVERESGTDGMPPPVFAMFNMLKSDFILARDLLWRAVDESVWPATGRF
FT                   GDTLDYATYGPDASALILAHRTALDLLDKVAVAANHYFEFGLPPDKVYFGKLWRGGPDR
FT                   ATGIRPLNAKVEQAIRGGTSALYGLVELADDYDSSAGILRSQKDLRNAGTHRFVVLHDL
FT                   GDPAHSRQAPEIEHHRREPFTQEALRALRVARSAIQMLVLSISQHEQGLVERTEGLIGS
FT                   LLVPDHDWIRGRDDET"
FT   gene            complement(357588..358613)
FT                   /locus_tag="BMI_II371"
FT   CDS_pept        complement(357588..358613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II371"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49505"
FT                   /db_xref="InterPro:IPR032581"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHL7"
FT                   /protein_id="ACU49505.1"
FT                   /translation="MPFEIRPWEAIVENYGCTILLGNGASISVNPSFSYTSLLQHATEQ
FT                   NLLPDDAQQLFNFFKTNDFELVLRIVWQASNVNRSLRIPDERTHATYVALRDCLIQTVR
FT                   DIHPEHGAVSAHLPTIYQFLKRFQTVISLNYDLVVYWAITYGLDIDDRHAFKDCFVGGG
FT                   TFNDDWQRFRQPIRGERSTSLVFYPHGSLVLCRNLVEQERKIHNLQDGLLEAVLQCWQD
FT                   GQVVPLFVSEGTWSQKITSIQNSYYLSTVYREVLKSQRDTLVVYGWGFAEQDIHLLQRM
FT                   NGTGINRVAVSVFRGDQAYCNRVFQIIHDVLGAHVEVEFFNSESPGCWIHPPHQEPRPA
FT                   G"
FT   gene            complement(358647..359372)
FT                   /locus_tag="BMI_II372"
FT   CDS_pept        complement(358647..359372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II372"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49506"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHL8"
FT                   /protein_id="ACU49506.1"
FT                   /translation="MISIVLLGKYGVQDLSLPHGQLLYGLLNTLRDLDARTLMLALAEV
FT                   VATTGDLRARVNPKYRFDERLHDLTQCLLLDGYIIKSKMLVQTDPSITDAAPLEDDLID
FT                   ALQKSGAPRAQEIIAKINDSAGAFRSTPPDYNASLVNARVALETLAGDVAAHNASQQPT
FT                   PPTYNPSKWGEVLVFLRSSGEITVEEEKGLAGVFGFLSPGAHRPMGIPEDQMTRLGRSF
FT                   ALNMCWFLLKNHLLRIQQP"
FT   gene            complement(359551..361272)
FT                   /locus_tag="BMI_II373"
FT   CDS_pept        complement(359551..361272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II373"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49507"
FT                   /db_xref="InterPro:IPR018760"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHL9"
FT                   /protein_id="ACU49507.1"
FT                   /translation="MIHNIFSTLPSFKNLGDLKPGLNVLLAQKTEGASTKQTRNRAGKT
FT                   SFVELVHFLLGADAGPESIFRTPELAEHTFGMDFDLNSERTVVERSGGSKAKIFVTAPP
FT                   AAKVKFSATEWCTFLGEQMFGLSSLEAAGSKPPSFRSLFAYFVRRQASGAFMTPEKQAT
FT                   MQGTGDMQMALMFLLGLDWQIARDWQAVRDREKTLEELKKAAGNGVFGSIIGKVADLRT
FT                   ELTIQEARLKKLHAEVGTFQVLPEYRELEVESATLTRELNDLANANTIDFSAIRDLENA
FT                   LASEIPPDHEDLQAVYQEAGIVLPGLVKRRYEDVKSFHDSVVRNRKDYLSSELEAAKLR
FT                   IELRDSKKAQLDQRRGEILGILKSHGALEQFLKLQGELGRLESEVESLRQRFEAAEQLE
FT                   GTRNELDIERNRLTIRLRRDFAEQKDRLAEAIVAFEETSQRLYESAGSMTVDETSNGPI
FT                   FKFPMQGERSKGIKNMQIFCFDMMLMRLCAKRQMGPGFLIHDSHLFDGVDGRQVISALR
FT                   LGSEIAQELGFQYIVTMNEDDAFKETIDGFDLNDHVLPTRLTDATEDGGLFGIRFG"
FT   gene            complement(361269..361517)
FT                   /locus_tag="BMI_II374"
FT   CDS_pept        complement(361269..361517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II374"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49508"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHM0"
FT                   /protein_id="ACU49508.1"
FT                   /translation="MILPSKHLPHDRALLTVGARVLTFLARPKTVSALWEELNRHDTGL
FT                   TVTPRRITYDWFLLSLDLLYALGTIELESGLVARRTA"
FT   gene            complement(361514..362338)
FT                   /locus_tag="BMI_II375"
FT   CDS_pept        complement(361514..362338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II375"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49509"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHM1"
FT                   /protein_id="ACU49509.1"
FT                   /translation="MLKAHPNDFMACRPWGNVGDRKNDGYLPSARILFQSYAPNELSAT
FT                   EAIKKINEDFEGAKEHWEDYFDEWTFVHNAPDGRLGPHIIEALAKLAQDNPQLKIGHCG
FT                   YEEMLTKFRQLSLQDLESWFGPSLTMEANVNLGFGDLTAVLTHISITPVPTASEVKNVS
FT                   RGKIEANLLSQAVADFLKIGMQKSPLVAQFFNSWKNPTYGEQIAQAFKSEYVKLRDGVS
FT                   QLHPDEIFGRLEAWAGGTTNTTPAHKAAVLAVLAYLFDKCEIFEDAQAMGAA"
FT   gene            complement(362483..362677)
FT                   /locus_tag="BMI_II376"
FT   CDS_pept        complement(362483..362677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II376"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II376"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49510"
FT                   /db_xref="GOA:C7LHM2"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHM2"
FT                   /protein_id="ACU49510.1"
FT                   /translation="MASSNDVVRARIDGHIKEEATNVLSGMGLSVSDAIRILLTRIATD
FT                   KALPFDINRVQAQPSIKKP"
FT   gene            363083..363268
FT                   /locus_tag="BMI_II377"
FT   CDS_pept        363083..363268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II377"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49511"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHM3"
FT                   /protein_id="ACU49511.1"
FT                   /translation="MQMCRLGGVYEKAGRGRTCENVVLWFDSRPAGPGMLPVMDETPQY
FT                   TAGQKLFRIDLNYCFS"
FT   gene            363380..363928
FT                   /locus_tag="BMI_II378"
FT   CDS_pept        363380..363928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II378"
FT                   /product="membrane antigen, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II378"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49512"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHM4"
FT                   /protein_id="ACU49512.1"
FT                   /translation="MKNLFRTAALMVPLSLALAYGAQAKEIPIGKPQLLGGMEIAAVYL
FT                   QPIEMEPEGMMRPAKDSDVHLEADIKAAKDNTNGFAEGDWVPYLVVSYELTHLDNGKVQ
FT                   KGDFMPMVANDGPHYGDNVKLDGPGKYKLKLFVSPPSANQHAHFGRHVDKETGVGPWFK
FT                   PVTAEYEFVYAGTGKKGAY"
FT   gene            363932..364330
FT                   /locus_tag="BMI_II379"
FT   CDS_pept        363932..364330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II379"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49513"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHM5"
FT                   /protein_id="ACU49513.1"
FT                   /translation="MARPLTQTMLHRSCDGFAKFANAFRKAVWGGVVLLAVASSVAWAE
FT                   EPTFRLEFKDGVITPDRLEVPANTRFRIELVNTGSMPAEFESLELRKEKVIAAQSETVM
FT                   VIRTLDPGEYPFFDDFHPGGTPAILIAK"
FT   gene            364337..365173
FT                   /locus_tag="BMI_II380"
FT   CDS_pept        364337..365173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II380"
FT                   /product="iron permease, FTR1 family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49514"
FT                   /db_xref="GOA:C7LHM6"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHM6"
FT                   /protein_id="ACU49514.1"
FT                   /translation="MNVQDFNILFVIWRECIEALLVVGILNAWLSHRPAQEQRTGRIWL
FT                   WSGVAAGLAGALVLAFLLLTVGDMLSDDAQDYFQTAIVLLAAGLIVQMVFWMRKHGRTL
FT                   KKELHASLTDVADKANWLGVFALAALAVMREGSEAAVFLYGTMAGISASNYNALVAALI
FT                   GLAAALGTYWLLQLGSRVLSWNAFFRITEVMLLFLAGSLLLTGIDHLISLGVLPPLSAR
FT                   LWNTSAILSDNGMLGGLVSGLTGYRARPVLIEVLVFFAYWTIVLWFLSRPRALQTA"
FT   gene            365134..366567
FT                   /locus_tag="BMI_II381"
FT   CDS_pept        365134..366567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II381"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49515"
FT                   /db_xref="GOA:C7LHM7"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHM7"
FT                   /protein_id="ACU49515.1"
FT                   /translation="MVSVPASRPANRLIAGEEKRLQRALARTGLWLRDHQRAIRAIQWV
FT                   IIGAYAGLLIIPLMTPMPDRLSHIWSNAVLFAQFMFWGIWWPFVLVSMVLMGRTWCGVF
FT                   CPEGALAEAASRHGYGRATPRWIKWKGWPFVAFACTTIYGQMVSVYQYPKPVIIVLGGS
FT                   TLAAMAVGFLYGREKRVWCRYLCPVSGVFAVLAKLAPVYYRVDRETWNDWERKPGTPMP
FT                   HVNCAPLVPIKTMRGASACHMCGRCAGFKDAIQLSGRSPSYEVVEVAGDAPKPWESLLI
FT                   IFGMMGIAAGAFQWASSPIYVDVKQWLAEWLVEHGGIAMIQPQLPWWVLTNYPDLNDMM
FT                   TPLDGGLMIAYILAVACITSIAVGGLVAIANWALGGWKAARFHHLVQCLIPMAGCGVFL
FT                   GLSATTVTLLKAEDVPLAFVSDLRILLLLGAVVWSAWLLWSVARRYTSSMARRLVATAM
FT                   GALATGVAAFNWVLLFWIW"
FT   gene            complement(366825..369194)
FT                   /gene="xfp"
FT                   /locus_tag="BMI_II382"
FT   CDS_pept        complement(366825..369194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xfp"
FT                   /locus_tag="BMI_II382"
FT                   /product="putative phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II382"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49516"
FT                   /db_xref="GOA:C7LHM8"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHM8"
FT                   /protein_id="ACU49516.1"
FT                   /translation="MPAKGPLTPQQLSLINRYWRAANYLSVGQIYLMKNPLLREPLQPE
FT                   HIKPRLLGHWGTTPGLNFIYAHLNRIIQQRNANVIYICGPGHGGPGMVANTYLEGTYSE
FT                   IYPAISEDEAGMERLFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGAAFDNPD
FT                   LVVACVVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLNGYKIANPTVLARLSDDD
FT                   LDNLFRGYGYEPFFVEGSEPADMHQKMAATLDTIFQRIQDIKKNADVHSPERPRWPMII
FT                   LRSPKGWTGPKTVDGLVVENYWRAHQVPVANCRENDAHRKILEDWMKSYDPSDLFDEKG
FT                   ALKPELRALAPKGEARMGANPHANGGLLRKELHMPDFRQYAVNVTEPGAIEAQSTKILG
FT                   DFLRDVMKLNETEKNFRIFGPDETASNRLGSVLEATNRVWMAETLDMDDHLAADGRVME
FT                   VLSEHLCQGWLEGYLLSGRHGFFSCYEAFIHIIDSMFNQHAKWLQVARELEWRKPISSL
FT                   NYLLTSHVWRQDHNGFSHQDPGFVDLVANKSADIVRVYFPPDANTLLWVGDHCLKTWNR
FT                   VNVIVAGKQPEPQWLTMAEAEKHCEAGLGIWEWAGTEDGLEPDIVMACAGDVPTMETLA
FT                   AVDLLRQSLPHLRIRVVNVVDLMVLQSPHQHPHGISDEEFDRMFTTNRPVIFAYHGYPY
FT                   LIHRLVYKRTNHSNFHVRGFIEQGTTTTPFDMTVLNELDRFHLAMEAVERLPLGESVAK
FT                   PLIDNFTEKLALHKDYIRQHGEDMPEIRDWKWTWPR"
FT   gene            complement(369224..370429)
FT                   /gene="ackA"
FT                   /locus_tag="BMI_II383"
FT   CDS_pept        complement(369224..370429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="BMI_II383"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II383"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49517"
FT                   /db_xref="GOA:C7LHM9"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHM9"
FT                   /protein_id="ACU49517.1"
FT                   /translation="MKKQLVTFNAGSSTVKIGVFECDENAVRKVSKGDIDLTGSPLRFR
FT                   LRGENGNLDIVLSASGADEITTILGELFDKLAEHIDPSRILAVGHRVVFGGDDFAQAVL
FT                   IDDDNLEAIERLSIFAPLHQPKSLALIKAVRKIFPHLAQTASFDTAFHQTIPDTVRRFA
FT                   IPQELHDRGIKRFGFHGLSYKSVIGNFSQRAPELAEGKIIAAHLGSGASLCAMHKRKSL
FT                   DTSMSFSTLDGIPMATRCGALDPGVLLHLLQQEKMEADALADLLYHRSGLLGLSGLSGD
FT                   TRDLLESDAPQAHTALDIFALRIAGEICRLASTLNGLDAVIFTAGIGEHQPAIRAAICQ
FT                   RLAWQGVELDPAANDENAFCITSRTSRTAAFVLPTDEEQIIASETFEIIRQMPATARSA
FT                   FA"
FT   gene            370668..370829
FT                   /locus_tag="BMI_II384"
FT   CDS_pept        370668..370829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II384"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49518"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHN0"
FT                   /protein_id="ACU49518.1"
FT                   /translation="MVHVRIVLDQNHMAGPCIPGIQGTTFDIGFPNHRGEFPALFAPAQ
FT                   EACPPNFL"
FT   gene            370872..372035
FT                   /locus_tag="BMI_II385"
FT   CDS_pept        370872..372035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II385"
FT                   /product="heme-thiolate monooxygenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II385"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49519"
FT                   /db_xref="GOA:C7LHN1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHN1"
FT                   /protein_id="ACU49519.1"
FT                   /translation="MTSPTERPKQDWDPRSEAVLSDQIGAYDAMRHQCPVAHSDYLGWS
FT                   LFSYDDVVRVLDDHETFSSVVSAHLSVPSGMDPPQHTAFRQLVERYFEPERIKAFEPIC
FT                   REISKKLVCELPRDAEIDLVTQFAQLYAVRIQCAFLGWPDSLQGPLLDWVHKNHAATLA
FT                   RDTKAMAAIALEFDEYIRDLLDERRKLGADAPDDVTTRLLRDRIDGRNLTHEEIVSILR
FT                   NWTVGELGTITACVGILCHYLAKSQQTQALMRGGPDLLPAAIDEILRLHAPLISNRRVT
FT                   TRAVVVGGREIPAGEKITLMWASANRDEAVFDKPDELRLNRDPALNLLYGRGIHVCPGA
FT                   ELARAELRILMEELLGQTRKLDLVPGSVPALAVYPASGFSRLPARIS"
FT   gene            complement(372106..372783)
FT                   /locus_tag="BMI_II386"
FT   CDS_pept        complement(372106..372783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II386"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II386"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49520"
FT                   /db_xref="GOA:C7LHN2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHN2"
FT                   /protein_id="ACU49520.1"
FT                   /translation="MTEASGNEWIKPIQRQNLSELAYTTLREALMEGRLKPGEDLPLRP
FT                   ISRSFGISATPMREALLRLVAEHALEIDARGRISVPHLTRAELLEVRKLRGFLEGNAAR
FT                   EATLNATPEAVDALEQIHFELITAQDAGDFPTAIGFNTKFHLKMCEIAGLPVTHELVSN
FT                   LWVRCGPLISHLYDAGIPANWNPHPHVLIVKAIRARDPDMAYKELNRDIEGSGAGLLAH
FT                   VKD"
FT   gene            372841..373062
FT                   /locus_tag="BMI_II387"
FT   CDS_pept        372841..373062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II387"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49521"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHN3"
FT                   /protein_id="ACU49521.1"
FT                   /translation="MSYNGKCDGTLAVEEPCAGGGLVSPLYKCLPAPVAGQVVCVRFRG
FT                   VFFGKAVVDVTYPDHVVMFLFSESVQNA"
FT   gene            373055..374062
FT                   /locus_tag="BMI_II388"
FT   CDS_pept        373055..374062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II388"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II388"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49522"
FT                   /db_xref="GOA:C7LHN4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHN4"
FT                   /protein_id="ACU49522.1"
FT                   /translation="MPKAVLSVIATRPGGPEVLELVPRELPALKRGEMRVRVHAAGVNR
FT                   PDAMQRAGQYPPPPGVTDVLGLELSGVVLEIAEDVTRFGPGDRIMALVAGGAYSEEAIV
FT                   QADVCIPVPAGLSMVEAAGIPETYFTVWSNLFQRAGLQPGETVLLHGGTSGIGVTATLL
FT                   AKAIGARMITTCGSDDKCRASEALGAIASINYRTTDFVEAGRALTEGRGPEVVIDMVGG
FT                   SYMQRNLQLVAEDGRIAQIAFQQGSEAQMDMGPLLFKRLTLTGSTLRARPLVMKAALAR
FT                   SVEAEVLPLVLNKGARPVIDSVFDLADVQAAHAHLEASAHTGKIILKTAACDAA"
FT   gene            374146..375357
FT                   /locus_tag="BMI_II389"
FT   CDS_pept        374146..375357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II389"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II389"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49523"
FT                   /db_xref="GOA:C7LHN5"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHN5"
FT                   /protein_id="ACU49523.1"
FT                   /translation="MRLSRLLIGASLGVALSSTAFTAALADVKFGSLYPISGSLALLGE
FT                   ESARGLELAVDEVNAAGGIKGEKVVLERGDAVDNNQATGEARRLISLVGVKAIFGTYSS
FT                   ARVIAASQVSELAGIPYFEMGAVADEVTGRGLQYLFRTNPTAENMAKDSVDMLIKGIAP
FT                   GLGKDPKDMKIGIIYEDSSYGTSVAGHQEDNAKAAGLTVVLKSGYPSNTVDMSSLVLEL
FT                   REKGADVVMQTSYQNDSVLFLQQANEAGYKPLAIIGGGGGYSMQPTADAVGHDLIDGVF
FT                   DADYTQYAVNTSATPGLTEFVEAYKAKYGSQPRSGHSLTNYVGAKAIFQALNAGEGFEP
FT                   DQIVSAVKALDIPDGQTAAGYGVKFGKNNQNERATMMGMQWQDGKLVTVYPENAAIAKM
FT                   RFKK"
FT   gene            375406..376290
FT                   /locus_tag="BMI_II390"
FT   CDS_pept        375406..376290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II390"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49524"
FT                   /db_xref="GOA:C7LHN6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHN6"
FT                   /protein_id="ACU49524.1"
FT                   /translation="MTTFLQILLNGLMLGGLFAIVAVGLTLIFGIVKVVNFAHGEFLMA
FT                   GMFVTWLITTKLGLHPYAAVIIVLPAMFILGALTQRLLIQPLMASDDGHAQIFATVGLS
FT                   TAMINLALLIFGADIANTPNFGLRTPIEIGPLRVLTGQVFIFLGAIVLVVALQLFLKNS
FT                   QTGRAIRAVAQHRSAAELMGVNVSRIYILCFGLGAACVGLAAVLIAPLYPTSSNIGTYF
FT                   VLTAFVVVVLGGLGSIPGAFVGALIIGVIDTMSGYYIGSDLREAVVFGIFLLILILKPS
FT                   GLFGKQLNLSHLS"
FT   gene            376300..378129
FT                   /locus_tag="BMI_II391"
FT   CDS_pept        376300..378129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II391"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease/ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II391"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49525"
FT                   /db_xref="GOA:C7LHN7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHN7"
FT                   /protein_id="ACU49525.1"
FT                   /translation="MSISDTIDRAGMNKSRLGKGQIAFCVLLASLLLLPLAINNAFVSH
FT                   IFITICLFAALSTAWNIVGGFAGQMSLGHAVFYGIGGYTGVILFNMGISPWFSMFIGAF
FT                   IAALVGMVISYPCFRLKGPFYSLASIAFLEVFRVLALHFGWLTGGATGLMIQLKLGWVW
FT                   MVFRERWPSLLIVFGMLLVTLAITWAVRRSRLGFYLVATRERESAARAAGVRTVRVRLI
FT                   AVAISSALCAMLGTFHAMYLTFIEPAAMFSLAFSIQIAMFALIGGLGTVAGPLLGAVLL
FT                   VPITEWARASLGASALGLHGFVYGLVLILVVLFMPNGIMGAINRFVRKPQDSEETATAR
FT                   TEPIAAVPARAIKAPSPDRAGIGQDILRVQNLNKHFGGLHVTRNVSFTLREGEVLGLIG
FT                   PNGAGKTTLFNMISGFLAPDEGTVNLCGADGQFHAPKNPADFAALGLGRTFQIVQPFAA
FT                   MTVEENIMVGAFYRHHHEKDAREAARETAWRMGLGPLLGAEARGLTIGGLKRLEVARVM
FT                   AMEPRILLLDEVMAGINQTDVRRAIDLMLSIRDSGVSIIAIEHVMQAVMSLSDRVIVLA
FT                   SGEVIAQGRPQDVVRDPQVVEAYLGKEFAHAHA"
FT   gene            378116..378820
FT                   /locus_tag="BMI_II392"
FT   CDS_pept        378116..378820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II392"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II392"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49526"
FT                   /db_xref="GOA:C7LHN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHN8"
FT                   /protein_id="ACU49526.1"
FT                   /translation="MLTLEHVDAGYGRTTILQDVSLEVKEGEIVTIVGANGAGKTTTLR
FT                   TIVGQIQPRAGKITFLGEDITHLPAHEVVDRGIILIPEGRQLFPDMTVRENLQMGTYRR
FT                   AARAAQESRMEEVLELFPRVRERLDQTASSLSGGEQQMVAIARGMMANPRILMFDEPSL
FT                   GLAPIVVSQVFDVVRKIAATGTTVLIVEQNVFTTLKVANRGYVLENGRVVLADSSEALL
FT                   NNDHVRRAYLGI"
FT   gene            378823..379620
FT                   /locus_tag="BMI_II393"
FT   CDS_pept        378823..379620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II393"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II393"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49527"
FT                   /db_xref="GOA:C7LHN9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHN9"
FT                   /protein_id="ACU49527.1"
FT                   /translation="MELTEITPESLRLRPSHKERNVLITGAARGIGRAIAQAFVERSAK
FT                   VGICDLNLADVARTCEELNGLGLGRAVPIACDVSDYDALVAAIDDTGLVFDTVVNNAGI
FT                   SPKHNGVAHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEARRGWIVNTSSVAGKT
FT                   YSPIVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVAPEVNAEQV
FT                   KLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLYMA"
FT   gene            379625..380443
FT                   /locus_tag="BMI_II394"
FT   CDS_pept        379625..380443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II394"
FT                   /product="shikimate dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II394"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49528"
FT                   /db_xref="GOA:C7LHP0"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHP0"
FT                   /protein_id="ACU49528.1"
FT                   /translation="MITGHTKLYGIVANPIAHVKTPEEVNKHFAALGHDGVLVPFHVLP
FT                   ENLAQFVNSLRKLENLGGLVVTVPHKTAILSLCDRLEGDAAAIGAANVIRRESDGTLVG
FT                   VMLDGKGFVSGLVASDIDVTGMNACLLGAGGAASAIAFALAEAGVARLTIVNRSEDKAR
FT                   DLAARVSERYPAVQIDAGAPQTASRDLIINATSLGLRAGDPLPLDDLAFHAGQIVAEVI
FT                   MEPEVTPLLAAARDKGARIHFGRPMLRQQIRLMAEHMGAKANADVQKPTE"
FT   gene            380448..382082
FT                   /locus_tag="BMI_II395"
FT   CDS_pept        380448..382082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II395"
FT                   /product="oxidoreductase, GMC family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II395"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49529"
FT                   /db_xref="GOA:C7LHP1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHP1"
FT                   /protein_id="ACU49529.1"
FT                   /translation="MAYALPQDACFDFIIVGGGTAGCILAEALTRSGRNRVLLCEAGGE
FT                   ARSPWIRIPAGFYKLLVNRRYNWGFWSEEEAATNFRRIAIPRGKGLGGSTLINGMIYVR
FT                   GQPQDYEGWRERGATGWGWDDVLPYFKAIERWTLPDPDGLRGRSGPLPVNEVVEKTPIG
FT                   DAFIAAAVAQGQCFNPDYNGRRQDGVGWYQVNQAGGERYSADRAWLEQARKRPNLTVLT
FT                   GARVMRILLEGRKAAGVALRHKGSEQTVYGAEVILAAGAVQTPQLLELSGIGDPVRLQG
FT                   IGIEPIHALPGVGENYLDHFCTRMNWRVSQPITLNELTRGPRLVGEVLKYVLKRRGVLT
FT                   YGTGLNHAFLRSRPELDRPDVQFFFMHASYANAAERKLHRFPGMTLGVTQLRPRSCGSI
FT                   HAISPDLSVQPAIAPNFLDHEEDRRVMVDGMKLARDIIEQKPMDAFRVAELSPGSNCNS
FT                   DEDWLSFARANGQTIYHAAGTCRMGVDPLAVVDPSLCVHGIAGLRVIDASVMPEMVSGN
FT                   TQAAVMMLAAKAADIVLEDKGQAPAGR"
FT   gene            382086..383540
FT                   /locus_tag="BMI_II396"
FT   CDS_pept        382086..383540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II396"
FT                   /product="succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II396"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49530"
FT                   /db_xref="GOA:C7LHP2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHP2"
FT                   /protein_id="ACU49530.1"
FT                   /translation="MDMQEELMYPNLTLIVGGEERNKGSAGTLCLTDPADGRELTIAPR
FT                   AGRAEALQAAAAAEKGFAEWSALSALERSKIMRRAADIMRERADAAARIMSMEQGKPLA
FT                   EARGEWLGSADLLDWFAEEGRRVYGRIVPSRAPNIQIQVLKHPIGPVAAFTPWNFPAWN
FT                   TMQKVAPALGAGCSVVIKPASDTPGTAWLIGKCLLEAGLPPKAVSVIWGTTSELSDALI
FT                   KAPEIRKVSLTGSTRVGRIVAAQAGEYLKKVTMELGGHGPVIVAADADLDHLIPLAVQW
FT                   KFRNCGQVCVSPTRFIVEASIHDEFIRRFSEKARELKVGKGVEEGTQMGPLTSQNQLET
FT                   VLSMVEDALTKGAKIETGGNRIGDTGNFYEPTILSGMTAEMLAMNEEPFGPLALVMRVH
FT                   SLDEAIAESNRLPVGLGAYLFTSSMTTAHRVQNHLQAGMLGVNHFALALPETPFGGVRD
FT                   SGFGSEGGLEGIEAYLTTMTVTTMMV"
FT   gene            383632..384795
FT                   /locus_tag="BMI_II397"
FT   CDS_pept        383632..384795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II397"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II397"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49531"
FT                   /db_xref="GOA:C7LHP3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHP3"
FT                   /protein_id="ACU49531.1"
FT                   /translation="MLAGAAPASADIKMGSLYPFSGPLALLGDESARGLEIAVEEINAK
FT                   GGVQGEKIVLVRGDAVDNNQAIGEARRLISVENVAGIFGTFLSGRAVAASQVSELAGVP
FT                   YFELGAVADEITDRGLENVYRANPYARDFAQMIVEMLQKKIAPKLGKDSKDLKIAVIYE
FT                   DSSYGTSVAKHEETFLKEAGLNMVLSQSYPGNTVDMSSLVLDLKSAGADVVLQTSYQSD
FT                   SVLFLQQANEGGYKPSAIVGAGGGYSLQPTADAVGHDVIEAAYDVDFTQFAVNTSFTPG
FT                   LEEFVEAYKKKYGETPRSGHSLTNYVGAKVILEALNKVKGFDAAAVKQALSAVDIEAGK
FT                   TAMGYGFKFDQNNQNERASMMGMQWQDGKLVTVYPDAAAISEIRLPQ"
FT   gene            384858..385985
FT                   /locus_tag="BMI_II398"
FT   CDS_pept        384858..385985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II398"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II398"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49532"
FT                   /db_xref="GOA:C7LHP4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHP4"
FT                   /protein_id="ACU49532.1"
FT                   /translation="MKFKAAVLDRHGVERPYNQTKPLVIREVELREPKADEVLVKLAAS
FT                   GLCHSDLSVINGDRSRQIPMVLGHEAAGVVEKIGEGVTDLVPGDHVVCVFVPNCGHCQP
FT                   CAEGRPALCEPGAAANGKGEMLSGGLRLFCDDGDVYHHCGVSAYAEYAVMSRYSIIRIE
FT                   KDIPLHIAALMGCAVLTGTGSIFNTGLVKPGSRVAIAGLGGVGLAAVMGAVAAGATEII
FT                   ALDMFDDKLALAEQLGATKTFNVQSEGVVEAVKEYTKGGVDAAFEYAGSGAALAMCYAL
FT                   TKRGGEVVTAGLPNPKNMLSIPAVSLVAEEKSIRGSYLGSGVPTRDIPLFLDLYRKGKL
FT                   PVEKLLTHRIKLEEINEGFERLAAGKAIRQVVEFN"
FT   gene            386190..387185
FT                   /locus_tag="BMI_II399"
FT   CDS_pept        386190..387185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II399"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II399"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49533"
FT                   /db_xref="GOA:C7LHP5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHP5"
FT                   /protein_id="ACU49533.1"
FT                   /translation="MKLVFFGVGHWHSGMHAQAAEAAGAEIVAAWDNEPEKAAAFVAQF
FT                   GGMVSPTIEEALALKPDLAVVMGRPAEMAALARRLILEGVPMLIEKPVGVSGAMMKPLV
FT                   DLAEQRNAFVSVALPYCFSPLLAEADALRDTNRLGAISHSHFRLINGPPQRYVNDGVAW
FT                   VLDASISGGGALRNLGIHGINGFVNLCGGQEITVESVSFGRQLFDTSVEDYALVVLRAA
FT                   DGTIGVVEAGYTFASMTQGIFEWRVDARNASLTDHGPCLSVLTLDDGKMRERPAMPVVD
FT                   RYDDIMVNTISRLCNGGKPAVTLRDLWRAMDLIDRCYALSAKRSAPLCLA"
FT   gene            387172..388457
FT                   /pseudo
FT                   /locus_tag="BMI_II400"
FT                   /note="oxidoreductase, Gfo/Idh/MocA family pseudogene"
FT   gene            complement(388235..389188)
FT                   /locus_tag="BMI_II401"
FT   CDS_pept        complement(388235..389188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II401"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II401"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49534"
FT                   /db_xref="GOA:C7LHP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHP6"
FT                   /protein_id="ACU49534.1"
FT                   /translation="MTETPLLSVRGLAKHYQTRSATLKILDNVSFDIARGEVVGLVGES
FT                   GSGKTTIGRSVLRLIEPTAGQIMFDGADVATLSAREMRRQRRRMQYIFQDPFASLSPRM
FT                   TIGEILMEGLNIQGIGTKAERLERARKALEQVELPPDTINRYAHEFSGGQRQRIGIARA
FT                   LTLEPDFIVADEPVSALDVSIQAQVVNLLRDLQQRLGLTVLFISHDLAVVEYICDRVIV
FT                   LYLGRIMEIASSEDLYARPQHPYTRALLSAIPSPDPDARTERQILRGDIPSPANPPSGC
FT                   VFRTRCPMAIDACATTVPQLREVRPGHFKACIRDNI"
FT   gene            complement(389185..390201)
FT                   /locus_tag="BMI_II402"
FT   CDS_pept        complement(389185..390201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II402"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II402"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49535"
FT                   /db_xref="GOA:C7LHP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHP7"
FT                   /protein_id="ACU49535.1"
FT                   /translation="MSRQPILDIKGLRTVFRTRAREIVAVNDVDIVVNPGETVALVGES
FT                   GSGKSVTSLSIMRLLARKVGFIDAGSIILRGKSGQTVDLAAIDEEAMRRIRGNDIGMVF
FT                   QEPMTSLNPVYTIGDQIGEPLRVHRGTSRREALEAAVELLDRVGIPDARRRAGQYPHEL
FT                   SGGMRQRATIAMALICNPTLLIADEPTTALDVTIQAQILDLMQKLQSESGMGMLFVTHN
FT                   LGVVAEIAQRVVVMYAGRIVESSPVKEVFRNPRHPYTMGLLRSMPRLGDATEMKRRGEK
FT                   LNTIPGMVPGLANLPSGCAFAPRCSFAVEACHAAVPPLASVNEHHGSRCIRWQEIAA"
FT   gene            complement(390212..391129)
FT                   /locus_tag="BMI_II403"
FT   CDS_pept        complement(390212..391129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II403"
FT                   /product="dihydrodipicolinate synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II403"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49536"
FT                   /db_xref="GOA:C7LHP8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHP8"
FT                   /protein_id="ACU49536.1"
FT                   /translation="MSKFFGVVPPVVTPLNDDHSVDYDSYTRVLEHLIEGGCHGLFALG
FT                   STSEVVFYDEADRRRILEHTVKVANGRVPVIAGVIDPATDRVIAHAKAAKDVGADAVVV
FT                   TAPFYTITSQPEIIDHFRMVRDAVDIPLIAYDIPVCVHAKLTRQTVVTLANEGTIIGLK
FT                   DSSGDDGNFRYALLNLAKNKNMFLMTGSEIVVDNALLMGAHGVVPGLANVDPAGYVRLW
FT                   DAAQRGDWVAARKEQERLCRLFEIVWVGAGRVSGGAAGVGAFKTAMRSLGIISTNKMAR
FT                   PRQALNTAEAGRIDAILRSVGLLD"
FT   gene            complement(391149..392057)
FT                   /locus_tag="BMI_II404"
FT   CDS_pept        complement(391149..392057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II404"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II404"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49537"
FT                   /db_xref="GOA:C7LHP9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHP9"
FT                   /protein_id="ACU49537.1"
FT                   /translation="MRSSIHASRLRKMGQSIPASTGPMARSANRFLQNRAAIFGLVLLT
FT                   PLLFAVLTYPLWLPYKPNDIDLMAMNSAPSWKHWFGTDGVGRDVFARTMEGGRISLLVA
FT                   VSSVVLSTAIGFLIGAISALGGRWADAIAMRSVDLAMTLPPVIFLLVLASIIGSGIWST
FT                   VVVIALLSWPVLSRMIRARLLELREREFVMASRGMGAGLGHLLFRHGLPNSIDILVVYA
FT                   TLQVANAILLEAGLSFLGLGVPPPAASWGNMLNAARSTAVLEQFPWQWLFPGGALVLAV
FT                   LAINFIGDGLRDAFDPRAELN"
FT   gene            complement(392023..392982)
FT                   /locus_tag="BMI_II405"
FT   CDS_pept        complement(392023..392982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II405"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II405"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49538"
FT                   /db_xref="GOA:C7LHQ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHQ0"
FT                   /protein_id="ACU49538.1"
FT                   /translation="MLRYCLHRLLIGLGMLLALTILIFVLLQLTPGDPIDAYINPNVAM
FT                   TQAEMDALRAQLGLDRPLPVQYLAWLGQAVQGNLGHSLQRFNETVSGLIASRIGPTLLL
FT                   MAAGLAIAIVIGVTTGIISAVRRNSFPDYSFSVLALLGISSPAFLTALLGLYVFSVRLK
FT                   WAPSGGMLTPATDFSIPDLLRHLALPALVLSIGHAALIMRYMRSSMLETLNQDYVRTAR
FT                   AKGVREFWVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLINAVET
FT                   RDYPVIMGATLVIGACVIIVNILTDLAYAVIDPRIKVT"
FT   gene            complement(393082..394665)
FT                   /locus_tag="BMI_II406"
FT   CDS_pept        complement(393082..394665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II406"
FT                   /product="peptide ABC transporter, periplasmic
FT                   peptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II406"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49539"
FT                   /db_xref="GOA:C7LHQ1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHQ1"
FT                   /protein_id="ACU49539.1"
FT                   /translation="MRLRNFYSALALSAAVFAGPLYAAAPAMAAGTISGGFDVGPGGFQ
FT                   GNFNPLAATGGFTWLVTYFEPLVIYDDKLENIVGDLAKSFEISPDQLTYTFKLAHAKWH
FT                   DGEPFTSKDAKFTFDLARNGKTGSVFAARLASIASVETPDEKTVVIKLKEPSPSMLDTL
FT                   TKVMMLPEHALASIPPEQLAKNAWWSSTPIGTGPFKFNKYVADQYVELTANPDYRGGRP
FT                   QVDKLINRYFADPAAAIAALRSGEIQFTYVDSNDVSTFSSDSAFRVIEGDSFVVNYVGF
FT                   NQEVPLWKDLKVRQAFMHAINRDAIIQSLYGGAAKPANCVYVADRLVPKAIDAYAYDPQ
FT                   KARQLLDEAGWDKINGSKPITILTYYNSPLVANVLAAMQAMLAQVGINIVPRTVDTPTY
FT                   NSIVYKQGGNADEFPLIFAGLQNGPDPSSINIGLNEKQIPPAGSNIMRIRMPAVTKALD
FT                   AALAETNPAKRDARYQDVCKATNANLPWGTMWVANRYGVASSKLENFIWTPAPAGGPYQ
FT                   AHPEKWAILE"
FT   gene            complement(394662..395390)
FT                   /locus_tag="BMI_II407"
FT   CDS_pept        complement(394662..395390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II407"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II407"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49540"
FT                   /db_xref="GOA:C7LHQ2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHQ2"
FT                   /protein_id="ACU49540.1"
FT                   /translation="MKNPIKPLKRAPLLHVSVQESLRAYIEDNGLQAGAPLPPEGELAA
FT                   RLGVSRNSVREAIKALESVGVLESRRGIGVFVKAFSFEPLLENLAYGLGGALRQIEEVI
FT                   AIRRALEIGLIDKTLERIGEDDIKELRDTLEKMRQRAERGEGFPEEDRHFHQLLFRCQD
FT                   NEVLLRLIEVFWLAFYKASDFVNLENIDPMATWRDHVAIVDAIEARDVVAVRKQLDRHY
FT                   SGINQVIARNRTASLTGRKT"
FT   gene            395550..397127
FT                   /locus_tag="BMI_II408"
FT   CDS_pept        395550..397127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II408"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II408"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49541"
FT                   /db_xref="GOA:C7LHQ3"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHQ3"
FT                   /protein_id="ACU49541.1"
FT                   /translation="MRGSPRNLCRVQGMIEEIVNRLRGKLIVSCQPVPESPFDNVASVV
FT                   AYARAAEASGASGLRIEGAANVAATAQASTLPVIGLIKRDLDDSPVRITPFLEDVAALC
FT                   DAGAAIVAVDATDRRRPVPAAELIGEIKRRGRIAMADISTLAEARNALAAGADIIGTTM
FT                   SGYTGEGPTPKDPDLDLVAHCSRLGSFLIAEGRYNSPQQAGEAIRAGADAVVVGSAITR
FT                   PEHITGWFRDAVESAAKPSSPVLAFDIGGTKTLAALVRGREILERRVMTTPASVGSESW
FT                   IGAIASLSADWQGRYQRAAIAVTGRVDGEIWSSLNPETLAIPPDYPLGRRMGAALGAPV
FT                   EVINDAQAAAWGEYRFGAARGRDMVFLTISSGIGGGIVLGGRLIRGARGIAGSLGQVLV
FT                   AGPSGFVRLETLASGFGIAKMALEAGHAGDARSVFSAAAAGEGWARRILLDAASQLAAA
FT                   VAGLQAIVDPECIVIGGGVGMADGFLDMLREALGSHSAVMRPDIVAAELGADAGIIGVA
FT                   DLAATYFS"
FT   gene            397133..398317
FT                   /locus_tag="BMI_II409"
FT   CDS_pept        397133..398317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II409"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49542"
FT                   /db_xref="GOA:C7LHQ4"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR019936"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHQ4"
FT                   /protein_id="ACU49542.1"
FT                   /translation="MEWRKCMFSLIGAKRLAIGIAALAWSTGAVMASEHWPDLPVGIKN
FT                   GAAARIGNMAYVGLGSAGTDFYALDLNNPSKGWVKRANFIGPATNGAAMAAAGGKIFAF
FT                   SGNGKATPDAKSPIIFDTAYVYDPGSDGWSKLDTQTPVGLSGAKAVGLADGRIAIFGGY
FT                   NKELFDKYLADVGAIDKDKEPEAYRKLVDSYMGMKPEAYRWNDEVLVYDPAGNNWGSLG
FT                   ANPFLPNCDPAMATMGEGDFLLVSGEIKPGLRTPEAKLVKIRDGAAHWQKVSDLPPLSG
FT                   SEPQEGVAGAYAGKAGDDVLVAGGANFKGAQANAAAGKWFAHDGLAKSWRDDVYAFDGK
FT                   DWKVAGKLPRGLAYGAAFDAPGGLLVVGGEDRDGKARKEVFLLKWDGKALSVEN"
FT   gene            398418..398693
FT                   /locus_tag="BMI_II410"
FT   CDS_pept        398418..398693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49543"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHQ5"
FT                   /protein_id="ACU49543.1"
FT                   /translation="MEQSKMRIYQLLHEAISLKGILKEPFKPKDLRRIVPGWPYAWYFS
FT                   FLAQNCADNQPAGSAMFLRVGRGEYCLNQDADFAFDSARAATACGK"
FT   gene            complement(398694..399452)
FT                   /locus_tag="BMI_II411"
FT   CDS_pept        complement(398694..399452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II411"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II411"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49544"
FT                   /db_xref="GOA:C7LHQ6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHQ6"
FT                   /protein_id="ACU49544.1"
FT                   /translation="MGISSEDNVLHNIFENQPINSAFNTDDLGTLKSLPVSLKHYPPHT
FT                   IVSRQGDWTNSILIINSGWSCIYRDLPEGDRQILDFPMKGDFLGFRAGLGFNYYTLFAI
FT                   TDLSVVEISLDILAEKMRKSPPLAMTFMELTARQRTILLEHLINLGRRTSLARIAHLML
FT                   ELGFRTKANGTGDAHGFYCPLTQGELADALGLTPIHINRMLRELREDNLLVFKNNEVRF
FT                   LNRPALMQVCSFDENYLSANIFTNIHLIPR"
FT   gene            399815..400582
FT                   /locus_tag="BMI_II412"
FT   CDS_pept        399815..400582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II412"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II412"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49545"
FT                   /db_xref="GOA:C7LHQ7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHQ7"
FT                   /protein_id="ACU49545.1"
FT                   /translation="MNISPQFKDESKNPHNIYASKISTEKDQLYEVERPLLVIIDSRAL
FT                   DRECLAHGLTNNSVDMTIATFSSYEQWQHQRRNRKAAVVLFNVGGQKVSDPAVGNYLKN
FT                   LVADCAPAPVILLADKEEISQVVRALEHGVKGYIPTSVNVHVCVEALRLAMAGGTFVPA
FT                   SSVLALRHATEAGGQRIQPLGGMFTQRQAEVVNALRRGKANKIIAYELKLRESTVKVHI
FT                   RNIMKKLKASNRTEVACIINELFPSETAFSDLQ"
FT   gene            400619..402808
FT                   /locus_tag="BMI_II413"
FT   CDS_pept        400619..402808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II413"
FT                   /product="exopolysaccharide biosynthesis protein Bme12"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II413"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49546"
FT                   /db_xref="GOA:C7LHQ8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHQ8"
FT                   /protein_id="ACU49546.1"
FT                   /translation="MIISDVSSANGRQPVADLLETIKRRKLMLTLPIIAGVGVGFAGYL
FT                   TAPVSYVSESVLVLDMRRLQALPNESAITPLPQDSPVLRSELDIINSRMMAQKVIELLQ
FT                   AENIAVPTDVHSRTVLSSQPDRITLSKNARDFDPAVRERQQIDLLLSRLRVSNDGRSFT
FT                   IFISYRAPDPVYAARVANAFATAYLNHQVDVQQSAARRVSEWLGEKLVTLRNDLETAER
FT                   VAEDFRQKSRLAGEQGQISFQAQRVMALNTEIVAATGAVSTAQARLQTAQALKNNNEAP
FT                   AMTEILASPAIQNLRNEEARVQRHLDELKANGALKSAEIPVLMAERESLKQQITAQVDE
FT                   IIKSLSNEIRIAVQRRTSLEKELKEAETDLAKANQAQVRAAQLDREANASRVVYETYLT
FT                   RYKQLIEQDGIAIPEAQLISQAEPAMAKASPRLINWLLVGLGLGGLFAVAGTMLREALD
FT                   KIRPAQTTALALPGIPAATLLPVSPQLTVPILVNRGVDSASPFGRAIKSVHDRLRALIR
FT                   GRDSLALSVVSLSEGDGKGLLVTALAQQIAATGVPVAVIDTTCGKSGLGEAFGLPVGNM
FT                   QSLIGRKLNGAALIHDHGSGIDFITPNRQAQEGEWLGELIAQLRPDHRIILVNLPSYAE
FT                   DKRSALMTRATDTALLVVNADRRDAKATAAMVQVLASFGRKPALAVVSQMASPYAGWIG
FT                   KHIVAHGWAERIGAHLRAIRVRGREAPSTPMEEQA"
FT   gene            402818..404065
FT                   /locus_tag="BMI_II414"
FT   CDS_pept        402818..404065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II414"
FT                   /product="exopolysaccharide biosynthesis protein Bme11"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II414"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49547"
FT                   /db_xref="GOA:C7LHQ9"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHQ9"
FT                   /protein_id="ACU49547.1"
FT                   /translation="MSKIIVRNSITRHLRAALLSSALLLATGGLAAADGNIYRVGANDV
FT                   LQVTVYGQPALTGLYPVDVDGNIGYPVVGNISVQGLTTLQISEKIASSLSQHIPGLTVT
FT                   ATINQYAPVFVMGDVKAPGKYEFRPGMVALELMALGGGAGKGEAPSVTAGMQLISAQQE
FT                   YADLQMQITAQTIRRARFEAELKGTDFTYAVPEQTAANKDMVALTRHMVEGERTLFDVR
FT                   RNNLAAERRALEAQAASYGDEITTLQQSIKLHDTEIQLLQENVNSSKSLVDRGLAAKSS
FT                   LRDMERDLSSTRRDALELASFLARARQNQLAVEQRIANLDETRRSEAASSLQEIDLNMA
FT                   RMQRRSNSQLEAMAEIAKSSGQISSADMRRKLIFTISRNVNGAYQEIAANERTEIKPGD
FT                   ILRIELDMSKLGGSPS"
FT   gene            complement(404170..405150)
FT                   /locus_tag="BMI_II415"
FT   CDS_pept        complement(404170..405150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II415"
FT                   /product="fucose synthetase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II415"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49548"
FT                   /db_xref="GOA:C7LHR0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHR0"
FT                   /protein_id="ACU49548.1"
FT                   /translation="MISTAETGREPVYSLTGKKIFVAGHTGMVGSAILRRLQHEDCDII
FT                   TAAHSVLDLTRQGPTENFISGHRPDVIIIAAARVGGILANSRFPADFLYDNLAIGMNLI
FT                   HAAHQIGVERLLWLGSSCIYPRDAAQPLTEDALLTGPLEPTNEAYAIAKIAGLKYAQSC
FT                   ARQFGDRFITAMPTNLYGPNDNFDPTSSHVLPALIRRVHEARMRGAEEVVLWGSGKPLR
FT                   EFLHVDDLADACLHLLRFYNGIEPVNIGSGEEISIKELALTVARIVGYEGRFEHDLSKP
FT                   DGTPRKLLDTSRIEALGWQPRIRLEDGLRDVYRNWLEETAGSVAA"
FT   gene            complement(405134..406204)
FT                   /locus_tag="BMI_II416"
FT   CDS_pept        complement(405134..406204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II416"
FT                   /product="GDP-mannose 4,6-dehydratase Bme9"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II416"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49549"
FT                   /db_xref="GOA:C7LHR1"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHR1"
FT                   /protein_id="ACU49549.1"
FT                   /translation="MQDKTALIVGVTGQDGAYLSELLLGKGYRVHGLKRRSSSFNTARI
FT                   DHLYQDPHEEDIRFRLHFGDLTDATNLCRVIQEVQPDEIYNLGAQSHVQVSFETPEYTA
FT                   NADALGTLRLLESMRILGLGKSCRFYQASTSELFGNSSHHAQNEQTPFAPRSPYATAKL
FT                   YAYWTTVNYRDAYGFHASNGILFNHESPLRGETFVTRKITRAVAAIERGLQDRLRLGNL
FT                   EARRDWGHARDYVEGMWRILQEDTPDDYVLATGETHTVREFIEHAFKAVDKQIVWHGDG
FT                   VAEVGIDRKTGNCLIEIDPRYFRPNEVDFLMGDASKAKDRLGWQHTTGFENLVAEMVDW
FT                   DLRNIMREVGRNDFYG"
FT   gene            406378..407718
FT                   /locus_tag="BMI_II417"
FT   CDS_pept        406378..407718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II417"
FT                   /product="glycosil transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II417"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49550"
FT                   /db_xref="GOA:C7LHR2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHR2"
FT                   /protein_id="ACU49550.1"
FT                   /translation="MRPMPLCFLHCQPPCCDPHREGIRAIGSKLMRVVLANRYFYPDQS
FT                   ATSRMVTSLAHALVREGIETSVLASRSYHDRRKETLAARETIDGIEVHRIWTSGFGRGR
FT                   LAGRAVDYATFHLSAAAWFAANARKDDLCVMCTDPPLLSVSAALPIRFRRARLVNWVMD
FT                   LFPETAMELGLIRPDTVSGRLAMALRDWSMRQSALTICPIDRMAHYLAKRDIPAESLGV
FT                   VHHWADRNEIVPVEPVENPLRRAWGLGRKFVIGYSGNFGRAHEFRTILDAAEWLRHRKS
FT                   IVFLMIGEGQQRGFVESEVKRRGLANVMMKPFQPVEKLSESLGAANVHLVSLKPELEHC
FT                   IVPSKFYGVLAAARPTIFIGNPDGEIGSVVRDFQCGMALRPGDVDALVGAILHLRHSPV
FT                   SCTTMGNNARYLMETAYSREYGAAMWQAAIGRLEEKAAPSVMPVLDR"
FT   gene            407739..408974
FT                   /locus_tag="BMI_II418"
FT   CDS_pept        407739..408974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II418"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II418"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49551"
FT                   /db_xref="GOA:C7LHR3"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHR3"
FT                   /protein_id="ACU49551.1"
FT                   /translation="MDGSVVVSQLGARMHYAVPRIFASRERLAHFYTDICALQGWPRFF
FT                   NGLPPTMLPASVRRLVGRIPQGIPQERMTTFPGFGLHSAVRRLSNQTGPKSTANAIWAG
FT                   KTFGKLVAESGFHGASGLYAFSGEALELLATAKRQGLWTAVEQMIAPRMVVDQLALEEE
FT                   ALNPGWQHPVANDAHADVFAAREQAEWRIADVVVCPSAFVAHHLAEMGCAAEKIVVVPY
FT                   GVDDRFLLDPCPRLPGPLRVLTVGAVGLRKGAPYVGAVARMLKGEAQFRMVGPIEIQAE
FT                   AQVKLAASVELTGAIPRSEMRAQFKWADVFLLPSLCEGSATAVYEALAAGLPVICTPNT
FT                   GSVVRHGIDGYIVPIRDVHETAQILRQLADNPALLARMSESARERGADFTVSRYGERLV
FT                   AALARHDRRQRA"
FT   gene            408971..410167
FT                   /locus_tag="BMI_II419"
FT   CDS_pept        408971..410167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II419"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II419"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49552"
FT                   /db_xref="GOA:C7LHR4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHR4"
FT                   /protein_id="ACU49552.1"
FT                   /translation="MKIIHVIGSYDPAKGGPQAVVVRLAAAQASLGHRVTIVSYSDDAV
FT                   SRRAAEATAMIPDFDKVQTLLLPMQDIYETFTGGRTANAVTALIRGADFVHLHGIWETN
FT                   LLRASMLCRRFHIPYCVCCCGMLDIWSMQQKSWKKRLALKLGFRRMLDGAAFIHALNRD
FT                   EIELMRPLGLKAPSLVIPNGVFLNEVEVGDMDVPGLPARRFILFLSRLHYKKGLDILAD
FT                   AYCRIAPHFRDVDLVVAGPDGGAEDAFRRKIAEYGLQHRVHMPGGLYGLAKIAALKRAA
FT                   CFCLPSRQEGFSVAITEALACGAPVVITDACHFPEVGEAGAGVVCALNAEMVGDALAGV
FT                   LEDLDKAAQMGASGARLVRENYTWPRIARQTIEAYQMYRARKAEPVKGENPFRTIPAA"
FT   gene            complement(410238..410960)
FT                   /gene="omp31-2"
FT                   /locus_tag="BMI_II420"
FT   CDS_pept        complement(410238..410960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp31-2"
FT                   /locus_tag="BMI_II420"
FT                   /product="outer membrane protein, 31 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49553"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A7WNU9"
FT                   /protein_id="ACU49553.1"
FT                   /translation="MKSVILASIAAMFATSAMAADVVVSEPSAPTAAPVDTFSWTGGYI
FT                   GINAGYAGGKFKHPFSSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAET
FT                   DFQGSSVTGSISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKS
FT                   AFNLGDDASALHTWSDKTKAGWTLGAGAEYAINNNWTLKSEYLYTDLGKRNLVDVDNSF
FT                   LESKVNFHTVRVGLNYKF"
FT   gene            complement(411357..411971)
FT                   /locus_tag="BMI_II421"
FT   CDS_pept        complement(411357..411971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II421"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II421"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49554"
FT                   /db_xref="GOA:C7LHR6"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHR6"
FT                   /protein_id="ACU49554.1"
FT                   /translation="MTITQSGSPHSIAGRKQTSRPLEGGATFTLKHRLQRLLWQAAWLA
FT                   LAAWTPSCLWRWRGMVLNAFGADIHKSAIVRASAHIWWPGNLSMGAHSSLGPGAICYNV
FT                   APVTLAPFAIVSQRAHLCTAGHDIDQASFPLTAAPIHIAAYGWVAAEAFVGPGVHIGEG
FT                   AVLGARSVSFRDLDAWAVYTGNPAKPVRQRRKNTDYSIHRF"
FT   gene            complement(411983..413245)
FT                   /locus_tag="BMI_II422"
FT   CDS_pept        complement(411983..413245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II422"
FT                   /product="Bme3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II422"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49555"
FT                   /db_xref="GOA:C7LHR7"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHR7"
FT                   /protein_id="ACU49555.1"
FT                   /translation="MNLSLTWIFAGLVLCFLATGFLSRPERMYQFPFLAGVMTFGFILP
FT                   QLPALVNDPFFPDGAYAKTMTMGIFSLAMLALGWSLTRKPIRLLSMRFSERRLLRAAAG
FT                   LSIFGAIFYFLLSRLPGDISIGTQMTGMPVVYLFFAQLMPYGLGIALLCYARKSSWFAA
FT                   TIILFDLVFYLDRILVTGKRAEAIQLLLMFLLAFWFYRRMVVPRIVMFLGILTGTFLMT
FT                   SMGDYRHVTRAASGFVLDQILDIDYAANFNETLERGGPEMRNAVQRIDELDRRLEFDYG
FT                   KFHWNRIVFTFVPAQLVGGGVKASLYLDTPKPSREYNPPTGTTDTGLVDAFASFWYFGA
FT                   LKFLLLAWMIRRLWETAMAGEMLGQLLYMFSIVPAMHAISHQTDWVVPVWIHMALFLIP
FT                   ILSLCVIRNRSVYLPMSPQLS"
FT   gene            complement(413242..413859)
FT                   /locus_tag="BMI_II423"
FT   CDS_pept        complement(413242..413859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II423"
FT                   /product="Bme2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II423"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49556"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHR8"
FT                   /protein_id="ACU49556.1"
FT                   /translation="MTLYAFPCAILVGLAAMFFSQPLLTLQDDGRPADVIIVPGGDGAP
FT                   RAAQAAQLWKDGRSPYILATGDGDCLLNKHIMMAKGVPPSAILVECRSGSTWQNARFSA
FT                   PLLRRLHAKSALIVTNWFHSRRAVASFRTACPQMHFTSSPVADADMPGGFPGTPPVIEH
FT                   VVKEYAKLGWYLISGRIRPQNLTDSGPAMAFASVCNTTEAGL"
FT   gene            complement(413856..414737)
FT                   /locus_tag="BMI_II424"
FT   CDS_pept        complement(413856..414737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II424"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II424"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49557"
FT                   /db_xref="GOA:C7LHR9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHR9"
FT                   /protein_id="ACU49557.1"
FT                   /translation="MTVSVLIMTLNEEANLPACLASLDWCDDIVVLDSFSTDRTVEIAR
FT                   AAGARIYQRAYDTEDRQRMYGLTEIEFRHAWVYTPDADEITPPDLRDEMLAIAADPDRP
FT                   EVFFKARYKNMFMGRWIRHASLYPTWITRLVRPDRVHFERSVHSRASGGPGGELQAHFI
FT                   HYSFNKGLAAWYDKHNRYSSVEADLAASKRLERHIDWGGLLSGEPERRRRTLKSLSYNL
FT                   PFRPSLRFLYMYILRGGFLDGKPGYLYCRLLAAYEFMIVVKTEEHRRKQSAMPQAPARR
FT                   PLDAKEPERHMV"
FT   gene            complement(414734..415855)
FT                   /gene="rfe"
FT                   /locus_tag="BMI_II425"
FT   CDS_pept        complement(414734..415855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfe"
FT                   /locus_tag="BMI_II425"
FT                   /product="undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II425"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49558"
FT                   /db_xref="GOA:C7LHS0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHS0"
FT                   /protein_id="ACU49558.1"
FT                   /translation="MTSLSWITLLAFVLSVAFCMAFRGLAREWYLIDLPDYRKRHEGAV
FT                   PLCGGIAIFLSFFLTASLVKDGAGHADALVMMPGLTIILGTGVLDDRFRLPVTPRFAIQ
FT                   LFAAVLIIAMAGVQQVFLDLNPSFIDDSGNIFAFERLGGPFLLLFAVAFIVGLVNAVNM
FT                   SDGVDGLAGSASAASFFWLAVISFDIGEHRLGLQSLALVAACLGFLVFNMRHRWRAKAS
FT                   LFLGDGGSTLLGAALAGMVLILSSGRQAIAFPVLLWIVIVPVLDTLSLIVRRLAARRSP
FT                   FSADRQHLHHLLMDAGPTCGQTAIIVMALNLIAGATAYTAIRLDLPGWLMALALLAPAM
FT                   AHLAFILRCTRGPRIADPAQAAKPNITFPGTTT"
FT   gene            416148..417641
FT                   /locus_tag="BMI_II426"
FT   CDS_pept        416148..417641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II426"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II426"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49559"
FT                   /db_xref="GOA:C7LHS1"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHS1"
FT                   /protein_id="ACU49559.1"
FT                   /translation="MNRHRKGFIIATLEQYAGLMSNFLTMVAVSRLLGPAETGIGVVGL
FT                   GIAAIFFSMREFASAEFLIKIDKVEDRDVRTSLTLVMLATLILAAGLYLARDYLATSYR
FT                   DPSLMLFLNITIVAALVESASFPVVALLRREMAFGVLAWIRTAGSTCGAATTISMAYLG
FT                   FGHMSFAFGALSAALITTGFAFKAYPMKHLLRPSLASIGTAWQFGLYLGSSAGLNKICE
FT                   TFPQLILGKFMSAASVGIYSRAGAVSGVPDRIFLSSIFTVAFPMLSAQVREGADIRRSY
FT                   VQALSYISVVYWPAQAVVALLAYPAVHIILGKGWMEAAPIVALSSLASLFWFPVILTYP
FT                   LLMALGANRDAFLSNFISRAFSAGILCCAAFYGLMAVVLSQFISLPLQMVVSFVYVHRH
FT                   VQFSYRLLGLALLRSALVTFLTLLLPLGLVAADGFSLEIHWAKGILIGIVSVLCWLAAV
FT                   LATRHPFSAEVLPVLGWFGGKVTARLGLQGRRNMAAPAE"
FT   gene            417657..418670
FT                   /locus_tag="BMI_II427"
FT   CDS_pept        417657..418670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II427"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II427"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49560"
FT                   /db_xref="GOA:C7LHS2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHS2"
FT                   /protein_id="ACU49560.1"
FT                   /translation="MSGPSVDVVIPNYNYARYLRVCAESVLSQDMEKLRLLIIDNASTD
FT                   NSVAVAREIAAADPRVELLLRPVNKGPHASFNDGIDWAGADYFVLLFADDVLTPGALQR
FT                   AVSLMQHDRTIAFTYGRDIAIAGDAPMPELPLQPKAPPYRVETGRAFIERFCRLGVFQI
FT                   PAASLVVRTSAQKAAGHYSEALPHSDDYHMWLRLALRGRVAALDCIQVGLRTHGQNRSQ
FT                   QLLKDSQLQHILHTAHAGEYFFAHEGRALPDCDVLDGMLQKGIAERAYWSAMSHFLRGD
FT                   ARGMQLFRFAFSRRLQTAFLPPVNYLLHRPDTARRLKRFFGGLPAKAFPVSARNGG"
FT   gene            complement(418626..419867)
FT                   /locus_tag="BMI_II428"
FT   CDS_pept        complement(418626..419867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II428"
FT                   /product="exopolysaccharide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II428"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49561"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHS3"
FT                   /protein_id="ACU49561.1"
FT                   /translation="MKIGLFGQFGSGNTGNDGSLEAMLQMLARACPDADIVCICSRPEI
FT                   IAEKFHIAATPVGREPFVNGLLRRIDKALLQLPRRLSGFIAAVSIAQGLDLIIVPGTGI
FT                   LDDFSENPFGWPFVIMRWSLAARLGGAKFAFVSIGAGPVVQPLSRFFVRVASRLAAFRS
FT                   YRDNVSYEFMQTLGINTRIDTVTADIAFALPVPDAGSKATAGRRCIGLGVMTYRGWKKD
FT                   SAQAPVIYETYLDKMADMAEGLLASGYRIRLLTGDISDLMAVDDLMARLAAPARANIVF
FT                   EPVTSLNGLMQQIAHTDIVVASRYHNIVCALATGRPAISLGYAAKNDALLHDAGLDRFC
FT                   HHIEDFDPQTVLMQVRQMFANLEQLREGVEAGVARYRLHLARQEEVLRTSLLAGMPMEE
FT                   LTSVPGRYRESFRR"
FT   gene            419984..421363
FT                   /locus_tag="BMI_II429"
FT   CDS_pept        419984..421363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II429"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II429"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49562"
FT                   /db_xref="GOA:C7LHS4"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHS4"
FT                   /protein_id="ACU49562.1"
FT                   /translation="MRGQAIAMNWQRYISCPRYTGTRLRGSFSPEVRFPEPSRGKPGVQ
FT                   LKSLAMKCAYFVRPHIGGTYSVFTRLRASLARSGMDLRWLAAGAPGEAVAVPREQGLED
FT                   AMRRGDIIDRMGVLDEETRAKRFVDFLRENRFEAVFVNVLSHRFETNLVRYLPADILRV
FT                   MIVHSITPGTYAAAQAIRDHVHATVGVSKRCRDDLVRGYGFDPSRTLVIPNGLTPDPHV
FT                   RCAAPEIEGGRLRLLYLGRIDDSSKGVFWLPAILRRLQCDYHLTVAGDGPDLAALRIKL
FT                   APFGNRISFTGWVAPSDVSWLVSQHDVMVMPSRYEGFGSTLIEAMSQGCPVVASRIPGV
FT                   TDTIVTDGEDGFLFPIGNCRQAAQQIERLAADPRLRVAMGAAGVRKVIAEFDSEIVGRA
FT                   YAGLLQHLRENRPPITPPLALSQWSMPNALHKNLRSRLPQPVKNWLRRVRERVHTVWST
FT                   A"
FT   gene            421401..422762
FT                   /locus_tag="BMI_II430"
FT   CDS_pept        421401..422762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II430"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49563"
FT                   /db_xref="GOA:C7LHS5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHS5"
FT                   /protein_id="ACU49563.1"
FT                   /translation="MNLFTSQFRNSQLLASKAHALIPGGCHTYAKGDDQYPVLAPGFIQ
FT                   RGSGAHVFDVDGHEYIEYGMGNRAVGLGHAYPPVVRAVREALQDGCNFTRPSAIELDCA
FT                   ESFLELIEGAEMVKFCKDGSDATSGALRLARAYTGRDMVACCADHPFFSTDDWFIGTTK
FT                   MSAGIPASVSALTATFRYNDIASVEALFEDYPGRIAAIIMEPARADEPQDNFLHEAMRI
FT                   AHENGALFILDEMITGFRWHMRGAQKLYGIVPDLSCFGKALGNGFAISALAGKAEYMRL
FT                   GGLHHTDFPRVFLLSTTHGAETHAMAAAIATMAIYRDEPVIERLYEQGAKLAAGINEAI
FT                   AGHRLQDHVRLSGRPCCLTYSTLDGNGMPSQAFRTLFLQETIRRGVLMPSLVGSYTHSD
FT                   ADIARTIDAVHGALGIYVRALNDGVESCLVGRPSQVVYRRFNEDPASSCPPPRL"
FT   gene            422741..424075
FT                   /locus_tag="BMI_II431"
FT   CDS_pept        422741..424075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II431"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49564"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025277"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHS6"
FT                   /protein_id="ACU49564.1"
FT                   /translation="MPTAKIVRGIALFLLAFAMTGGARAIAADTQFPLQVSGDRHRLQD
FT                   AAATPCLLMGDAAWSLIAELRRDEAEAYLQDRRRRGFNAVLVNLLEHQFARNAPANAYG
FT                   DRPFKARAFGALNPQYFDHAAWVIGRAEALGITVFLAPAYLGANGGGQGWYMAMEMAGP
FT                   KRMRAYGEVIARRFAGYRNIIWVLGGDFDAPDKRLVSSLAEGIAAVLPDAIQTVHSSRD
FT                   TDTARHWAGAGWLALDTVYDYDDVHKAVLARTAGAEMPVILLETLYENEHGTDAGTIRR
FT                   NAYGALLAGAAGQFFGNSPIWHFSAPGLFDSGGNWRKALDSPGARSMGVLQNLFSRLDW
FT                   TKLQPDREKKITDRPGFYAARLPETGLAVIYGENGFALRKGAVDAGDAALWFDPASGKT
FT                   IVAGAPARENDLLVYHPPASRNADGHSDWVLLIGRMERLAFLQKE"
FT   gene            424196..425257
FT                   /locus_tag="BMI_II432"
FT   CDS_pept        424196..425257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II432"
FT                   /product="epimerase/dehydratase family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II432"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49565"
FT                   /db_xref="GOA:C7LHS7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHS7"
FT                   /protein_id="ACU49565.1"
FT                   /translation="MKVLVTGSQGYIGSVMVPMLIDAGHEVSGYDIGLYEHCLFKEGGT
FT                   VMNVPTIRKDVRDVSPRDLEGFDAVIHLAALSNDPLGNLNEDLTYAINHHASVAMAKAA
FT                   KLAGVGRFLFASSCSNYGISDAELIDETGELKPVTAYGRSKVRAEQEIRKLADASFCPV
FT                   YLRPATAYGVSPFLRFDIVLNNLVAWAVTKGLIYLKSDGTPWRPIVHIHDISRAFMAAM
FT                   EAPREKVWNEAFNVGSTAHNYRIRDIAGVVADNVPDCRIEYAQDAGPDTRSYRVSFEKL
FT                   AHVLPEAKPQWDAVAGTRELLAAYSRSTLTVEEFEGPRFQRIAHIRKLIAQGVLDADLR
FT                   RMDAHSHPLRAMA"
FT   gene            425257..426609
FT                   /locus_tag="BMI_II433"
FT   CDS_pept        425257..426609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II433"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49566"
FT                   /db_xref="GOA:C7LHS8"
FT                   /db_xref="InterPro:IPR012353"
FT                   /db_xref="InterPro:IPR032589"
FT                   /db_xref="InterPro:IPR032610"
FT                   /db_xref="InterPro:IPR032622"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHS8"
FT                   /protein_id="ACU49566.1"
FT                   /translation="MDSGAPGRAGGAAMAAPQPDGAAIHRLAARLYPICRSLAGDGVRE
FT                   TLAIIGEYLPLHIHEVPTGTPLYDWKAPQEWIIREACIADLAGRRIVDFARHNLHVVNF
FT                   SMPVRARMSLDALKNHIHTLPDQPDLIPYRTCYHGESWGFCMAHNALLAMEDGEFDVVI
FT                   DAERRDGSLVFGEFIHRGQTDATFLLSAHLCHPSLANDNCSGLALLALLGEAMKSRRTR
FT                   LTYRLLFGPATFGALAWLRQNEDNLDHVRHGLVLSCLGDGGGPNYKRSRRGNAEIDRIM
FT                   DHVLAHCGLSGAAMHDFWPYGYDERQFCSPGFNLPVGMFQRSLYGRFPEYHTSADNLDF
FT                   IKPEYLEQSFNMVMQTIEIAERNWVPLNMSPKGEPQLGRRGLYGSMGGDSRAAQNAMAM
FT                   LWVLNLADGGYSILDMAERSKLPFAMLADAADRLRDAGLIKETASQDLFAK"
FT   gene            complement(426572..427096)
FT                   /gene="rfbC"
FT                   /locus_tag="BMI_II434"
FT   CDS_pept        complement(426572..427096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="BMI_II434"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II434"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49567"
FT                   /db_xref="GOA:C7LHS9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHS9"
FT                   /protein_id="ACU49567.1"
FT                   /translation="MHFTPLNINGAWSIEPERLKDERGWFARVYCEAAFAERKLETHFP
FT                   QHSLSFSREKGTLRGLHYQNEPHSETKLVTCLQGIVWDVLVDLRPHSPTYRRWAGVELS
FT                   AENGVQLYIPEGCAHGFQTLTDDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPEKPSV
FT                   ISQKDLGWPFL"
FT   gene            427417..428718
FT                   /locus_tag="BMI_II435"
FT   CDS_pept        427417..428718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II435"
FT                   /product="methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II435"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49568"
FT                   /db_xref="GOA:C7LHT0"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHT0"
FT                   /protein_id="ACU49568.1"
FT                   /translation="MTIQAADISRDHSTVQARTGCRLCGKLLRHSFVDLGMSPPCESFV
FT                   TAERLDHMEPYYPLHAQVCDHCFLVQLKEYFSPADIFTEYAYFSSFATSWVSHAKNYCD
FT                   EITERLELNDNSFVVEIASNDGYLLQHFLPKNIPILGIEPAANVARTAIAKGVPTLVDF
FT                   FGSRLALEMIGEGRKADLIIGNNVLAQVPDLNDFVRGMQLLLKPEGVITLEFPHLVNLI
FT                   EQNQFDTIYHEHFSYFSLLTIRFMAQHHHLKVIDVEELPTHGGSLRVYLAHHGSKRKVG
FT                   PRVASLLKREESFGLNEISTYEQFAEKTRRTKRDLLSFLIAAKNAGKRICGYGAPGKGN
FT                   TLLNYCGIGTDFLGFTVDRNPYKHGRFTPGMHIPIYDVSAIDNYRPDYILILPWNFKDE
FT                   IIRQMQHVVEWGAKFIIPIPHVTLIDPALVTEER"
FT   gene            428721..429530
FT                   /locus_tag="BMI_II436"
FT   CDS_pept        428721..429530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II436"
FT                   /product="nucleotidyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II436"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49569"
FT                   /db_xref="GOA:C7LHT1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHT1"
FT                   /protein_id="ACU49569.1"
FT                   /translation="MKVVLFCGGLGTRIREYSENIPKPMIPLGHQPILHHVMEYYSDYG
FT                   HNDFVLCLGYKANVVKDFFLTIRPQTFADCVVSDGGRNVQLLEEVDRDWSVTLLDTGIW
FT                   RNIGERLWSARSHVMNEDIFLANYSDGLSDVDLDDMTQRFRASGKVACFLAVRPPLTYH
FT                   LADIAEGGDVRAFRTSNTSDIWINGGYFLFRKEIFDYMREGEELVLEPFSRLIAENQLM
FT                   AYKYDGFWRSMDTLRDWQTLEDMVEKGDMPWKKHKAEQRAANIAIAL"
FT   gene            429527..430183
FT                   /locus_tag="BMI_II437"
FT   CDS_pept        429527..430183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II437"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49570"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHT2"
FT                   /protein_id="ACU49570.1"
FT                   /translation="MIDLCALANPGRPLELLCLGAHSDDIEIGCGGTLLHLIETGTPLH
FT                   VEWCVLSGNEQRRAEAEASARDFLRGMDRFQLHVASFADSYFPAESRAIKEWLIAQRGR
FT                   GQPDIVFTHYHGDAHQDHRTVNELTWNLFRDQLILEYEIPKWDGDLGRPNAYSALPASI
FT                   MERKIDLLMKHFGTQRSKDWFGPETFRGLARLRGMECRAPETYAEAFHARKLRLF"
FT   gene            430251..430382
FT                   /locus_tag="BMI_II438"
FT   CDS_pept        430251..430382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II438"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49571"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHT3"
FT                   /protein_id="ACU49571.1"
FT                   /translation="MAADKINLPAIKIGTVLQLPLVIVQPEDGPEQLMKQRRSGLLF"
FT   gene            complement(430379..431659)
FT                   /locus_tag="BMI_II439"
FT   CDS_pept        complement(430379..431659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II439"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II439"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49572"
FT                   /db_xref="GOA:C7LHT4"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHT4"
FT                   /protein_id="ACU49572.1"
FT                   /translation="MGYFPSWRLTSNAVVLPDERLPAAAAVPMGIQHLLAMSGSTIVAP
FT                   LLMGFDPNVAVFFSGIGTLLFFLITAGRVPSYLGSSFAFIAVVIAATGYSGSGPNPNIA
FT                   IALGGIIACGALYSLIGLIVMFLGTGWVEKLMPPAVTGAIGVSIGLNLAPVAIGQLKGT
FT                   GAHTSIALLTVLCMAMISAYGPRGTRRLSVLFALLFGYLLVLIAGNGLGIVPGIDFTAV
FT                   KNAAWFGLPHFTTPAFNWQAVTLIAPVAIVLVAENLGHIKALGSITGRNMDGYIGRGFF
FT                   SDGLATMISGAGGGTGVTTYAENIGVMAMTKVYSTLIFVIAAIMALILGMSPKFGAILQ
FT                   TIPAPVLAGLAVSVFGLIASAMARIWIVNKVDFADSRNLFTVGVALIFGAGDFTLNIGN
FT                   FALGGIATSTLAALVLYQLLGIGRSDS"
FT   gene            complement(431776..433272)
FT                   /gene="glpK"
FT                   /locus_tag="BMI_II440"
FT   CDS_pept        complement(431776..433272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="BMI_II440"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49573"
FT                   /db_xref="GOA:C7LHT5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHT5"
FT                   /protein_id="ACU49573.1"
FT                   /translation="MSGYILAIDQGTTSTRSMLFDRNMRVVGLGQQEFTQHFPSSGWVE
FT                   HDAEEIWKSVQSTIRIALAQAGISAADVAAIGITNQRETTVVWDRISGKPVHRAIVWQD
FT                   RRTAQFCDELKRRNLEPLFTEKTGLLLDPYFSGTKLAWLLNHVPGLRERAQKGQVCFGT
FT                   IDSWLIYKLTGGKAHVTDATNASRTLIYHIGENRWDDELLDILGIPAAMLPEVKDCAAD
FT                   FGMTDPALFGVSIPILGVAGDQQAAVIGNACFEPGMMKSTYGTGCFALLNTGTDRVTSS
FT                   NRLLTTIAYRLDGVTTYALEGSIFIAGAAVQWLRDEMGFISVASEVSALAEKADPNQRI
FT                   YLVPAFTGLGAPYWDAEARGAIFGLTRGTGRAEFARAALESVAYQTFDLLEAMQGDWKG
FT                   ATNHTVLRVDGGMVASDWTMQRLADILNAPVDRPVFLETTVLGAAWLAASRAGIWPDRK
FT                   GFSERWQRDCRFEPAMPEKERESAIAGWRDSVSRCLTRPQ"
FT   gene            complement(433399..434700)
FT                   /locus_tag="BMI_II441"
FT   CDS_pept        complement(433399..434700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II441"
FT                   /product="major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II441"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49574"
FT                   /db_xref="GOA:C7LHT6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHT6"
FT                   /protein_id="ACU49574.1"
FT                   /translation="MSRIEDRSLNGIAAADNGLTLVEMPEEAKTYLTKGMPAYRNASLA
FT                   LFLSGFATFSLLYCVQPLMPLFAKDFSITPTASSLSLSLSTGFLAFAIFFAAIIAERFG
FT                   RKSLMFASLLGSALCTIGCAVVPDWHMLLALRSLQGLLLGGVPAVAMSYLAEEIDPRGL
FT                   GASMGLYIAGNAFGGMAGRVITGTLAEYYSWRPALAVMGLLGLAAAIGFWALLPTSRNF
FT                   TPRTGLGARFHVSAWLSHLRNPALPMLIAIGFLVMGSFVTIYNYIGFRLIEPPYNLSQT
FT                   ELGFIFTVYLFGIAASWSAGRIGDRLGHFTMLPIALAVEAAGCLLTLSASLPIIVGGII
FT                   FLTVGFFMSHSVASALVGRLALETKGHASSLYLLAYYLGSSIAGSAGGYFWTADGWWAV
FT                   ADFTFAMLALAFAAALAAAWFAREGQTDKPGLTF"
FT   gene            434805..435692
FT                   /locus_tag="BMI_II442"
FT   CDS_pept        434805..435692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II442"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II442"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49575"
FT                   /db_xref="GOA:C7LHT7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHT7"
FT                   /protein_id="ACU49575.1"
FT                   /translation="MELRHLRYFLAVAEEGNFTRAAAKLGIGQPPLSQQIRDLENEIGV
FT                   MLFHRVPHGAELTAAGAAFLEEATATIASSEKAKLAAQRAARGESGRLSLGFTASSAFN
FT                   PIVSGAIRHFRAKWPEVELFLTEMNTNLLIERLVRGELDTAFIRPGLEDPANVRMKRLA
FT                   DEPMLVALPSHHRLAVYERLPLSALAGEPFVLFPRIVGLSLYDDIAAACRMAGFEMNVT
FT                   QEAPQMPSVVNLVAANLGVSIVPAAIAQIRLDGVTYRPIEGEPLVARLALASMKSLRSP
FT                   VHDNLISLLPRECI"
FT   gene            435777..436217
FT                   /locus_tag="BMI_II443"
FT   CDS_pept        435777..436217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II443"
FT                   /product="methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II443"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49576"
FT                   /db_xref="GOA:C7LHT8"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHT8"
FT                   /protein_id="ACU49576.1"
FT                   /translation="MKYQKSAEAIAKLSAEQYRVTQENGTERPGTGEYLYNKEPGIYVD
FT                   IVSGEPLFASSDKYESHCGWPSFTKPIERANVTELTDMSHGMVRTEVRSAHGDSHLGHV
FT                   FPDGPVDRGGLRYCINSASLRFVPKDRMEAEGYGDYLDQVEG"
FT   gene            complement(436218..437345)
FT                   /locus_tag="BMI_II444"
FT   CDS_pept        complement(436218..437345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II444"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II444"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49577"
FT                   /db_xref="GOA:C7LHT9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHT9"
FT                   /protein_id="ACU49577.1"
FT                   /translation="MLLTDTQEQIREAARDFAQERLAPGAAARDREHAFPRAELTEMGA
FT                   LGFLGMLVPEEWGGSDLGMVAYALALEEIAAGDGACSTIVSVHSSVGCMPILRFGTEDQ
FT                   KRRFLPKMACGEWIGGFALTEPQAGSDASALKTRARLDGDHYVIDGSKQFITSGKNGNV
FT                   VIVFAVTDPAAGKKGISAFIVPTDTPGYEVMSVEHKLGQHSSDTCALGFTNMRVPVENR
FT                   LGAEGEGYKIALANLEGGRIGIAAQAVGMARAAFEAARDYARERITFGKPIIEHQAVAF
FT                   RLADMATRIETARQMVLHAAALREAGKPCLTEASMAKLVASEMAEQVCSAAIQIHGGYG
FT                   YLADYPVERIYRDVRVCQIYEGTSDVQRLVIARGL"
FT   gene            complement(437345..438535)
FT                   /gene="phbA-2"
FT                   /locus_tag="BMI_II445"
FT   CDS_pept        complement(437345..438535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbA-2"
FT                   /locus_tag="BMI_II445"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II445"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49578"
FT                   /db_xref="GOA:C7LHU0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHU0"
FT                   /protein_id="ACU49578.1"
FT                   /translation="MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAG
FT                   LAPEAVEEVIMGCVLPAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDL
FT                   ILAGSADVIVAGGMESMTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGT
FT                   FAEDCAEAYQFTREAQDAFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQ
FT                   PGKAKLDKIPTLRPAFREGGTVTAANSSSISDGAAALLLMRASEAEKRGLTPRAVITGH
FT                   ATYADKPNLFSTAPIGAIRKLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLDLPHDKV
FT                   NIHGGACALGHPIGASGARILVTLLAALETHGLKRGIAGICLGGGEATAMGIERII"
FT   gene            complement(438604..439371)
FT                   /locus_tag="BMI_II446"
FT   CDS_pept        complement(438604..439371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II446"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II446"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49579"
FT                   /db_xref="GOA:C7LHU1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHU1"
FT                   /protein_id="ACU49579.1"
FT                   /translation="MQIENRVFLITGAGSGLGAAVSKMAVEAGAKVVLLDVNAEAGEAG
FT                   AKALGASARFQRTDVASDTDGKAAIAAAIEAFGRIDVLVNCAGVAPGEKVLGREGAHKL
FT                   ETFTRTISINLIGTFNMLRLAAEAMAKNEPGQGGERGVIINTASVAAFDGQIGQAAYSA
FT                   SKGGVAAMTLPVARELARHGIRVMTIAPGIFKTPMMAGMPQEVQDALGASVPFPPRLGE
FT                   PAEYAALVRHIVENQMLNGEVIRLDGALRMAAK"
FT   gene            complement(439384..441054)
FT                   /locus_tag="BMI_II447"
FT   CDS_pept        complement(439384..441054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II447"
FT                   /product="acetyl-CoA synthetase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II447"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49580"
FT                   /db_xref="GOA:C7LHU2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHU2"
FT                   /protein_id="ACU49580.1"
FT                   /translation="MTESPASARLDRYDDAVAQFDIAKAIALLAGNPDTGINACIECCD
FT                   RYTGENRVALRAISIDNTLTELTFEDLRDMSARVGNMLADAGISAGDVVAGLLPRTPEL
FT                   VATILGAWRIGAIYQPLFTAFGPKAIEQRFGTSGAKLVVTNLANRSKLAEVENCPRVAT
FT                   ILAPGESLPEGDIDFRAAVAAASTECEPVMRKGSDLFMMMSTSGTAGLPKGVPVPLRAL
FT                   MAFGAYMRDAVGLRSDDIFWNIADPGWAYGLYYAVTGPLLLGVPTILNEGGFTAENTYD
FT                   IIERLGVTSLAGSPTAFRLLMAAGPESAARVKGRLRVVSSAGEPLNPEVIRWFDACLGA
FT                   PIHDHYGQTELGMVVNNHHGLEHPVRQGSAGYAMPGYRVAVLDEAGKEVGPNEPGVLAI
FT                   DIDNSPLLWFTGYYKKDTPSISSGYYRTGDTVEFEPDGSISFIGRADDVITSSGYRIGP
FT                   FDVESALLEHPAVNEAAVVGVPDPQRTEIVKAFVILAPGFEGTPELAEELALHVKKQLS
FT                   AHAYPRQIDFVAELPKTPSGKIQRFLLRKAEVEKQQQQN"
FT   gene            441181..442164
FT                   /locus_tag="BMI_II448"
FT   CDS_pept        441181..442164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II448"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II448"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49581"
FT                   /db_xref="GOA:C7LHU3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHU3"
FT                   /protein_id="ACU49581.1"
FT                   /translation="MERHNITPGFVEDALESVRQRGLDTAPLMAAAGLPQKVREPVTNV
FT                   QYGRLWWLIAQTIDDEFFGLAARPMRPGSFDLLCHAVLHAGTLERALRRALQFLNVVLD
FT                   DPRGELRIRDGMAHIVLTDAAGHRPAFAYRAYWLILMGVACWLVGRRIPLRTLDFACPA
FT                   PVHRQDYHKFFGAPVLFDQPATRLVFSSTYLALPIIRSDVALENFLREAPANILIRYRH
FT                   DHDISSRVRAQLNALPAQEWPSFDDLAKGLRMSAPTLRRRLKAEGQSFGTIKDELRFVI
FT                   AQKLLQEKKLSIAEVAAELGYSEPSAFYRAFQKWVGRSPGQFRVEP"
FT   gene            442212..442391
FT                   /locus_tag="BMI_II449"
FT   CDS_pept        442212..442391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II449"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49582"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHU4"
FT                   /protein_id="ACU49582.1"
FT                   /translation="MFSDAFLEIQCQGRGIYEWLKRKKAAPDWLDTKHSVDVGFAFIHV
FT                   VNRPSAVSAWKLPK"
FT   gene            442388..443626
FT                   /gene="serA-2"
FT                   /locus_tag="BMI_II450"
FT   CDS_pept        442388..443626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA-2"
FT                   /locus_tag="BMI_II450"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49583"
FT                   /db_xref="GOA:C7LHU5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHU5"
FT                   /protein_id="ACU49583.1"
FT                   /translation="MTERLSLSRDRINVLLLEGISQTAVEYFKSSGYTNVTHLPKALDK
FT                   ADLIKAISSAHIIGIRSRTQLTEEIFAAANRLIAVGCFSVGTNQVELKAARKRGIPVFN
FT                   APFSNTRSVAELVIGEIIMLMRRIFPRSVSAHAGGWEKTAIGSREVRGKTLGIVGYGNI
FT                   GSQVGNLAESLGMTVRYYDTSDKLQYGNVKPAASLDELLKTSDVVSLHVPSSKSTSKLI
FT                   TEAKLRKMKKGAFLINNARGSVVDLEALAKVLQEGHLAGAAIDVFPVEPASNGERFSTP
FT                   LQGLENVILTPHIGGSTEEAQERIGTEVTRKLLEYSDVGSTVGAVNFPQVQLPPRPTGT
FT                   RFMHVHENRPGILNSLMNVFSHHHINIASQFLQTDGEVGYLVMEADGVGEASDAVLQEI
FT                   REIPGTIRARLLY"
FT   gene            complement(443679..444173)
FT                   /gene="def-1"
FT                   /locus_tag="BMI_II451"
FT   CDS_pept        complement(443679..444173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def-1"
FT                   /locus_tag="BMI_II451"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II451"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49584"
FT                   /db_xref="GOA:C7LHU6"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHU6"
FT                   /protein_id="ACU49584.1"
FT                   /translation="MTVRLIVKYPDPRLRAAAEPVTTFDEGLRKLADDLLDTMRAAPGI
FT                   GITAPHIGISKRVVVLELDRAAGPKIYINPEIVWACEEKIRHQEGSVSMPGVVDEVERH
FT                   ARIRLRYQDLDGNEQTEESDGLLAVCHQHEIDQLDGIFWVQRLSRLRRERLIKRYEKLQ
FT                   R"
FT   gene            complement(444919..445860)
FT                   /locus_tag="BMI_II452"
FT   CDS_pept        complement(444919..445860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II452"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49585"
FT                   /db_xref="GOA:C7LHU7"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHU7"
FT                   /protein_id="ACU49585.1"
FT                   /translation="MASGLFALLDDIAAIAKMAAASLDDVAGQTAKASAKAAGIVIDDT
FT                   AVTPKYVVGLTPERELPVIWKITKGSLRNKLIFLLPIALVLGYFAPDFIMPLLMLGGIY
FT                   LAFEGTEKLVEFFLPHDEEEHSETQGNSAREIEASTVAGAIRTDFILSAEIMALTLAGL
FT                   PPSSIFTQAIILAAVGILITFAVYGVVGIIVKLDDMGASLFMHSHTSVGRKLGKGLVGA
FT                   MPVLLETLSSVGTIAMLWVGGSIIVHGLASLGFHTVEEFIRSVAQAIPAERFPFPEAVR
FT                   WVVTSFLQAVLAVLTGLVAVVIVHLAKRIARR"
FT   gene            446173..446496
FT                   /locus_tag="BMI_II453"
FT   CDS_pept        446173..446496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II453"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II453"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49586"
FT                   /db_xref="GOA:C7LHU8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHU8"
FT                   /protein_id="ACU49586.1"
FT                   /translation="MDTRLVTREQMEARANEVAELLKTLSHPARLMLACTLAEGEYSVV
FT                   ELEEMLGIRQPTLSQQLGVLREADIVETRREAKQIYYRLVETKAAKLIDALYGIFCKEG
FT                   TDS"
FT   gene            446496..446903
FT                   /locus_tag="BMI_II454"
FT   CDS_pept        446496..446903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II454"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49587"
FT                   /db_xref="GOA:C7LHU9"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHU9"
FT                   /protein_id="ACU49587.1"
FT                   /translation="MALYMQALLGGMLIGLSAVLLLLLNGRVAGISGIVGRLLDGKQIS
FT                   GNLLFIIGLLMGPVVYAWIFGAFPATDIAASWPVILIAGLLVGVGTRMGSGCTSGHGIV
FT                   GLARFSRRSLVATIVFLIAGVIAASLAGAFL"
FT   gene            446900..447337
FT                   /locus_tag="BMI_II455"
FT   CDS_pept        446900..447337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II455"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49588"
FT                   /db_xref="GOA:C7LHV0"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHV0"
FT                   /protein_id="ACU49588.1"
FT                   /translation="MNRLSFLRLGAALAAGVIFGFGLSLSGMINPARVIGFLNIASGHW
FT                   DPSLAFVMGGGLLVTIPGIALCRRLSAPAFDTAFHLPTKTQIDRRLIAGSALFGIGWGL
FT                   GGFCPGPAVAALSLGLPQVALFVLAMAVGMIIHDRWLAKTL"
FT   gene            complement(447360..448067)
FT                   /locus_tag="BMI_II456"
FT   CDS_pept        complement(447360..448067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II456"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II456"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49589"
FT                   /db_xref="GOA:C7LHV1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHV1"
FT                   /protein_id="ACU49589.1"
FT                   /translation="MILLETKMAKENSNSGARWFPVYQGLCEAVVGHSLLPGTKLPEDE
FT                   LASIYTVSRAVVRSALQALAHDRLVRLEPNRGAFVAEPSPEEAREVFEARSLIEPEIAA
FT                   LAAKKATPKQIEELRQHLEREHDALQAGHDSDAIRLSALFHSYLAKIAGHSIFASFVSE
FT                   LLPRSSLIIALYWQRREITCQNDAHHALVNAIEKHDAHEAAALMKTHILDLLSGLSLNR
FT                   IKKEQKRLADVLR"
FT   gene            448313..449371
FT                   /locus_tag="BMI_II457"
FT   CDS_pept        448313..449371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II457"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49590"
FT                   /db_xref="GOA:C7LHV2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHV2"
FT                   /protein_id="ACU49590.1"
FT                   /translation="MSVQRASFYILLTLVTIAFAWLLIPYYTAVLWAVIMAVIFYPVQQ
FT                   WLVLLLRGRRNIAAFLSVLMCICLVIIPMLAIFGSLVDEGTSLYQRLSSREFDINGYIA
FT                   RIMAALPESLEEWLKRFELGTFADWRARISSVVMQGSQLFAARLVSFGQNTLQFFIGFG
FT                   IMLYLLFFLFRDGADVGKKIRRAIPLSDDYTRQFLEKFTAVIRATVKGNIIIAIIQGMI
FT                   GGVTFWLLGIEAALLWGVIMTFCSMLPAVGAALVWTPAAVWFFVSGDWWSGAILVVVGV
FT                   LVIGLVDNLLRPPLVGKGTRMPDYVVLISTVGGISLIGINGFVIGPLIAAMFIAAWSLL
FT                   AEEQKDQHMPDQ"
FT   gene            449457..449645
FT                   /locus_tag="BMI_II458"
FT   CDS_pept        449457..449645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II458"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49591"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHV3"
FT                   /protein_id="ACU49591.1"
FT                   /translation="MPRSGSVFGRRSKTEHPQNRCDYTRLQGTILQGRYAFTNSLKKKP
FT                   PRSDLSALGRYSLLQVE"
FT   gene            449948..450667
FT                   /locus_tag="BMI_II459"
FT   CDS_pept        449948..450667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II459"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II459"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49592"
FT                   /db_xref="GOA:C7LHV4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHV4"
FT                   /protein_id="ACU49592.1"
FT                   /translation="MADSEDKKPPQASLSSEQTRKALIVAALRLFGAKGYEATSTREIA
FT                   SLAKANIGSIAYHFGGKEGLRLAAADYIVETFRLIAAQALGNFQPAGFSREEREDARAQ
FT                   MISALERMVHFIVARPETGEIVQFLLRELAHPTAALDRIYKGVFEPVHKRLCMIWEAAT
FT                   GEAAESEATRLVVFTLVGQIFYFRIAQEAVKRRMNWPVMGSDQADMVAGVVKQNLAAML
FT                   DARGPTGAQQPVADGGK"
FT   gene            450672..451616
FT                   /locus_tag="BMI_II460"
FT   CDS_pept        450672..451616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II460"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49593"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHV5"
FT                   /protein_id="ACU49593.1"
FT                   /translation="MSLLCVIPFVSSLFAACGTQSLAVGYVEGEFVQLAPLQVAQVRDI
FT                   AVKRGDRVEAGEPIATVEDTDARIAVAQAEAALAQAQAQLANLQVGKRPEEIAVLEAAV
FT                   RSARAQADDAQRTLLRTRDLARRGVATQAQLDDAATQLEVAEAAIGQSTANLAVGKLPA
FT                   RPEEIKAAENAVKSAEAQLQTAKWQRAQRTIEAPAAGRITDVVRNPGDIAGPSAPVLTM
FT                   LPDGAVKLKVYIPEERFSDVAVGSVLSVHCDGCAPGLQARVSYVSPDPEFTPPVIYSLE
FT                   TRQKLVYLVEAHPVDPASPLQPGQIVDVDLGAK"
FT   gene            451528..452547
FT                   /gene="drrA"
FT                   /locus_tag="BMI_II461"
FT   CDS_pept        451528..452547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="drrA"
FT                   /locus_tag="BMI_II461"
FT                   /product="daunorubicin resistance ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II461"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49594"
FT                   /db_xref="GOA:C7LHV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHV6"
FT                   /protein_id="ACU49594.1"
FT                   /translation="MSISWRPTLSIPLRPCSRGRLSMSILVRNRGAVMPNAIDVKGLVK
FT                   RFGKATVVDHVSMTVAEGEIVGFLGPNGSGKTTTIRIMCGLLTPDEGEGQVLGYDLRTE
FT                   GLKIKREVGYMTQRFSFYEDLTIAENLEFVARLYKLDPVKDHVAQTLDELGLTTRGGQL
FT                   AGTLSGGWKQRLALAACIMHKPKLLLLDEPTAGVDPKARRDFWDEIHRLADGGLTVLVS
FT                   THYMDEAERCHRINYISYGKLLATGTVSEVIERTGLTTFFVSGKRLGNVARELEEMPGV
FT                   DQVAPFGATLHVVGSDREKLTAALDRIKHREDIHVEAGQTSLEDVFIQFMAGAKDNMQ"
FT   gene            452543..453683
FT                   /pseudo
FT                   /locus_tag="BMI_II462"
FT                   /note="daunorubicin resistance transmembrane protein
FT                   pseudogene"
FT   gene            453721..454119
FT                   /locus_tag="BMI_II463"
FT   CDS_pept        453721..454119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II463"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49595"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHV7"
FT                   /protein_id="ACU49595.1"
FT                   /translation="MVEITRNGSQASRKGPAEWFTGNVRIDPLFVANEARRAEASTVTF
FT                   EPGARTAWHTHPLGQTLVVTAGLGLVQREGGPIEKIRPGDVVWFEPGEKHWHGASPSTV
FT                   MTHIAIQEKLDGKVVDWLEHVTDEQYGG"
FT   gene            complement(454126..454944)
FT                   /locus_tag="BMI_II464"
FT   CDS_pept        complement(454126..454944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II464"
FT                   /product="taurine ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II464"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49596"
FT                   /db_xref="GOA:C7LHV8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHV8"
FT                   /protein_id="ACU49596.1"
FT                   /translation="MSDADVSKTARPVRPVEFRGGGFAPSPVRGIGLAVFVVLMVAAEI
FT                   GTRSGFISNLTLPRPSAVLETFGQLWQTGLLWQHLLPSLQRLIIGASLGIAVGISLGVM
FT                   IGLFSYVRAGLVPLVAALFPIPKIALLPLFLIWFGIDEMSKYMLIAFGTFTPTVVATYG
FT                   AVDNVDRSLIRMGQSFGLSWWSIVRKIVLPGAFPAILSGLRVSISIAIILLVAAEMLGA
FT                   QYGVGSYILEAGSLYDLEKLFAGVAILSVMGLIVNVVIGWVERRFLNWRG"
FT   gene            complement(454937..455704)
FT                   /locus_tag="BMI_II465"
FT   CDS_pept        complement(454937..455704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II465"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II465"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49597"
FT                   /db_xref="GOA:C7LHV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHV9"
FT                   /protein_id="ACU49597.1"
FT                   /translation="MDLKLQNISHFYGKVEVLKDISLDIPQGQIVCLIGPSGCGKSTLL
FT                   RFLGGLERPGSGQVLQIGDPPPDSLNPLTYVFQHFALLPWRTVEGNIKLVLEDHRLSQR
FT                   EMNDIVTDVLERTRLGDFRTALPKQLSGGMRQRVAISRALAVRPAVMLMDEPLSALDSQ
FT                   TRALLMDDLVSLWTRQPFTSVYVTHNLAEAVRLGHRVVVLSRRPGRIRQIVDIDIPLSE
FT                   RALGDPALEAKQKMLWDLMREEAMAADKELTDV"
FT   gene            complement(455750..456772)
FT                   /locus_tag="BMI_II466"
FT   CDS_pept        complement(455750..456772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II466"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II466"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49598"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHW0"
FT                   /protein_id="ACU49598.1"
FT                   /translation="MKFSLNRRQALLGMGAAGAAVAFGFPARAATRNLAVLHLASHAPS
FT                   FIAHERGYFKDAGLDIELKFFEAAQPSAVAIASGDADFGVTAMSGGLISLAQKGAVKVI
FT                   GGALIEEKGVVGAIILASNKAYDAGLTDPSRLAGKTFGITTAGSSFHFMAHKIAQANNI
FT                   DLKQIQLRPLQKLGAVVGALSSGQIDAWAIQPNIAKKLIREGAARQIGLVADYAPNYQV
FT                   TTAFTSTRNATDERALTEAFVKAYSRAIDDYNAAFVDNKTDDAERDALARIVHKYVESD
FT                   SPFDTARQNLIDGAMRINPGLALALDSCVEQLDWFKSEGMVKDSITNEQLFDTSYVKTI
FT                   "
FT   gene            457119..457622
FT                   /locus_tag="BMI_II467"
FT   CDS_pept        457119..457622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II467"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II467"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49599"
FT                   /db_xref="GOA:C7LHW1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHW1"
FT                   /protein_id="ACU49599.1"
FT                   /translation="MTTSDNEFPESELAESELPENELNAAFTMGLSTAARKMRNLFDSR
FT                   VRERGLTLARARVLLLLAQQRDWNQRELADALEIEHPSVVRLLDGLEKQGMIVRASVEG
FT                   DRRAKRIELTEEAQAQVRQLGEITRTIRQEMLENIDRQSLETTLEVFHAISRKVEKALN
FT                   GQDG"
FT   gene            457629..459260
FT                   /locus_tag="BMI_II468"
FT   CDS_pept        457629..459260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II468"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II468"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49600"
FT                   /db_xref="GOA:C7LHW2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHW2"
FT                   /protein_id="ACU49600.1"
FT                   /translation="MPDAPDDKKEAPEAAPAAPQPAHMPLYMSIIYIAASMLLWSTRGL
FT                   SMYFISANTQQIQGSLGATLTETTWLVAAYMAPFASLTILLLKIRTQFGLRRFAEVAIA
FT                   VFLVASLLHLLVYDVWSAIPVRFIAGAAAVPISSVGFLYMLEAFPPDKKRTWGLSLALT
FT                   CSGAAGPFARIISPMLFDIGQWQQLYMLEIGLALACFAVVYVLPLTQIPRAKVLHWLDF
FT                   VAYTFIAIGFGALVVVLVQGKNYWWFEAPWIGVCLAISILSLAIAAAIELNRDQPLMNL
FT                   HWLASPEILRFTLILLVFRMVLAEQTSGALGLFQVFGLQDAQSKGLYTLILLASFAGGI
FT                   TCGALLKVERVPVIFGFALLCIAVGAFLDSHATNLTRPHNVYVSQGLIAFGGALFLPPA
FT                   MLAGITKAMKQGPAYMTSFIVVFLFTQNIGGLIGSALFSTFISIREKYHSAHLVEQLVM
FT                   SDPLVAQRVQALSGTYAKVLADQGLTKAEGLVLLGQQVTKEATILSYNDAFLAISVIAA
FT                   IALCCQVTYRVYEAFRARRSALAVMS"
FT   gene            459285..460334
FT                   /locus_tag="BMI_II469"
FT   CDS_pept        459285..460334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II469"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II469"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49601"
FT                   /db_xref="GOA:C7LHW3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHW3"
FT                   /protein_id="ACU49601.1"
FT                   /translation="MSVSKKYIRGGFAILIGLLGVFIILWAWQLPPFKHSVETTDNAYV
FT                   RGQVTVMSPQVSGYITKVNVTDYEQVKKGDLLFEIDSRSYQQKLDQALAALDSKKAALA
FT                   NSEQSQRSAEATIKAREAQISGAKAALEVAKANTVRVDALLPRGVTTQSSADTAHGNML
FT                   QAQAAVDQAEAALAVAKEDLRTIIVAREGLNADLHNAEAAVALARIDLQNTKILAPRDG
FT                   KLGEVGVRLGQYVTAGTQLVSLVPAVKWIMANFKETQLYGMKVGQPVTLTVDALRHAEL
FT                   KGHIEAFSPATGSEFSVIKSDNATGNFTKITQRLSVRISIDEGQPDAELLAPGMSVVVR
FT                   VDTASTPDK"
FT   gene            complement(460406..461830)
FT                   /locus_tag="BMI_II470"
FT   CDS_pept        complement(460406..461830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II470"
FT                   /product="osmolarity sensor protein EnvZ, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49602"
FT                   /db_xref="GOA:C7LHW4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHW4"
FT                   /protein_id="ACU49602.1"
FT                   /translation="MRLPLPHSLPIWLLTILISGLLTTQIATLWIVSQDRADANNALEL
FT                   FRLSERATYLVKLLHATPPDDWNNLAIRVSGSGEAMNITSEPDVTTALASEDDLAELED
FT                   VLVARLTRYGVVDARIRRDTTGYRLPKEETAVHDSTEMGIIEKQIDSLAATTRSGASLT
FT                   TSLQFNDGRWLNFITHITPIDPIVTSDTIPLFTLVALCVILGAIWATQRLIAPYRILED
FT                   AIDRIGGDLKSPPLPETGIREYTAAARAVNSMQARLLDYVAEREQLAAALAHDLRTPLT
FT                   RMKLRMELLDDDALRQSLSRDLNDIEAISRSVIDFATSELAHEKAERLDLWSLLLSVAD
FT                   KYPQVSLDEKGSDYRDAICLCQPISIQRCITNLIDNALAYGGKVRLSLHRDGDDLLLRI
FT                   KDNGPGISPERIEEMFKPFSRADKSRNRESGGFGLGLTIARNIARKNGGEISLRNDPAG
FT                   GLIAELRLPGSRLMPR"
FT   gene            complement(461827..462543)
FT                   /locus_tag="BMI_II471"
FT   CDS_pept        complement(461827..462543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II471"
FT                   /product="transcriptional regulatory protein OmpR,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II471"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49603"
FT                   /db_xref="GOA:C7LHW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHW5"
FT                   /protein_id="ACU49603.1"
FT                   /translation="MKEDAHILIVDDDKDIRDLLHEFLKRRGMHVSIACNGDEMLDVLS
FT                   RTPIDLVILDVMLPGKSGIEICQDVRRTSRVPIIMLTAIADAADKILGLEIGADDYIAK
FT                   PFDPRELLARIRAVLRRFEGNRSPQRALTQIYRFAGWTLDCARRRLTSPHDVRVELTTA
FT                   EFNLLEAFVKSSQHILSRDQLMEMAGHQAVYGYDRSVDILISRLRKKLEDDPRAPKLIL
FT                   TIRGGGYQFGHEVEIA"
FT   gene            complement(462737..462937)
FT                   /locus_tag="BMI_II472"
FT   CDS_pept        complement(462737..462937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II472"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49604"
FT                   /db_xref="GOA:C7LHW6"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHW6"
FT                   /protein_id="ACU49604.1"
FT                   /translation="MLAAHNTQKTKPAAAFDVLIELNMRSLRYWVRFQFLKQTLYDIAS
FT                   LLVFFANVAFCFSIVAQANAA"
FT   gene            462867..463232
FT                   /locus_tag="BMI_II473"
FT   CDS_pept        462867..463232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II473"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49605"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHW7"
FT                   /protein_id="ACU49605.1"
FT                   /translation="MFNSINTSKAAAGFVFWVLCAASITLPSLPHEAGAAPLVTRSQRC
FT                   ERLKHQLQTALSGHVKIGRVHQVEVLQRRGARFCASKRQAQGLRAYAEALKLLGVKPDM
FT                   AEPGTQGRSIPPSGTSK"
FT   gene            463229..463498
FT                   /locus_tag="BMI_II474"
FT   CDS_pept        463229..463498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II474"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49606"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHW8"
FT                   /protein_id="ACU49606.1"
FT                   /translation="MRIWKMKKSLISALGLAVVLGLSAPVLAASSDTVPAAVMTPAKNI
FT                   KQGQTMTAPMVKLQKAHKKAEMKKLEKAHKKAEMKKLEKAHKKH"
FT   gene            463693..464043
FT                   /locus_tag="BMI_II475"
FT   CDS_pept        463693..464043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II475"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49607"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHW9"
FT                   /protein_id="ACU49607.1"
FT                   /translation="MAEVSLKRIYEEPSPQDGYRVLVDRVWPRGMTKEKARIDVWAKDI
FT                   APSTELRKWFGHDPAKWGDFQKKYREELESKLPALKDLLAGAGGKHITLLYGAKDEEHN
FT                   QAVVLHNFMEKL"
FT   gene            complement(464166..465491)
FT                   /locus_tag="BMI_II476"
FT   CDS_pept        complement(464166..465491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II476"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II476"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49608"
FT                   /db_xref="GOA:C7LHX0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHX0"
FT                   /protein_id="ACU49608.1"
FT                   /translation="MVTPENISGISKAGIFQMDAANSPHIVVVGAGFGGLQLIRDLDGA
FT                   KVRITLIDQRNHHLFQPLLYQVATTILSTSEIAWPIRNLFRDRAEVTTLLGTVIDVDTA
FT                   RKSVFLENGDEVSYDMLVLATGARHAYFGNDQWEKLAPGLKALEDATTIRRRLLLAFER
FT                   AEREPDMARRQALLTFSIVGGGPTGVELAGIIAELARRTLWPEFRNIDTRQARVLLLEA
FT                   GPRILSAFPEDLSAYARRALEKLGVEVRLGIPVKDITQEGVTVGDEFIPCHTTVWAAGV
FT                   AASPAALWLDAESDRAGRVKVLSNLSVPGHEDIFAIGDTAWVEGDDGRPVPGIAPAAKQ
FT                   QGAYVAKVIRSRVENKTPPLPFRYKHQGNLATIGKGAAVVDMGRIRLKGTIAWWFWGIA
FT                   HIFFLIGTRSRAAVAWSWLWTYITGQHSARLITQGKPSDEFR"
FT   gene            complement(465523..465972)
FT                   /locus_tag="BMI_II477"
FT   CDS_pept        complement(465523..465972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II477"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II477"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49609"
FT                   /db_xref="GOA:C7LHX1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHX1"
FT                   /protein_id="ACU49609.1"
FT                   /translation="MSNGPEIPFETTLFVRDTCLCLHVQRAARALARLFDEALRPAGLT
FT                   NGQFSLMMSLNRPSPPPMKPVAELLAMDQTTLTAALKPLQRRGWVEILVNPADRRERLL
FT                   QLTAEGKAVLASAVPIWTATHAQIEARLAGGNGDALRHDLIMLSS"
FT   gene            466254..467033
FT                   /locus_tag="BMI_II478"
FT   CDS_pept        466254..467033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II478"
FT                   /product="glyoxalase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II478"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49610"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHX2"
FT                   /protein_id="ACU49610.1"
FT                   /translation="MKNGGSPFVWYELMTSDAKQAQDFYSKVIGWTAKDAGMPGMKHTL
FT                   FDALGCTIAGMMALSDLPGEGCMDARPGWLGYIGVADVDAAAEKVMAEGGKILRAAGDI
FT                   PGVGRFAVAADPQGAVFSLYSPKADMEPPADFGSRKVGHPSWHELYARDGEAVFPFYEK
FT                   VFGWKLSRDFDMGSMGKYKVFSVDGADMGGIMTAPPGAENGWGFYFMVDGVGAAAARIK
FT                   SLGGTVLAGPMEVPNGEWVIKCCDPQNVSFSLVSAKE"
FT   gene            complement(467097..467267)
FT                   /locus_tag="BMI_II479"
FT   CDS_pept        complement(467097..467267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II479"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49611"
FT                   /db_xref="GOA:C7LHX3"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHX3"
FT                   /protein_id="ACU49611.1"
FT                   /translation="MQPRVSLHAPPVLRATAGGREASMSNIIFWTALVVVPILVGTAYA
FT                   YLRHFHHEDDF"
FT   gene            complement(467314..468747)
FT                   /locus_tag="BMI_II480"
FT   CDS_pept        complement(467314..468747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II480"
FT                   /product="amino acid carrier family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49612"
FT                   /db_xref="GOA:C7LHX4"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHX4"
FT                   /protein_id="ACU49612.1"
FT                   /translation="MATIIDFLNNVFWNYVLVYGLLAVGLFFTIRLKFVQFVHFPELFR
FT                   VVFAAGRRDEAGISPFQALTISIASRVGTGNITGVAVALYLGGPGAIFWMWIVALVGLA
FT                   TAYSESALAQLYKIRNQDGQYRGGPAFYIARGLGLPWAGALFSICLILSFGLVFNAVQA
FT                   NAIADSMVMAFNMPKLGTGIVLAILSGVVIFGGIRQIARVAEVVVPFMAFAYILMAICI
FT                   LAINFQAVPSTIALIFSSAFGLHEAVGGVTGGITAAMLNGVKRGLFSNEAGMGSAPNIA
FT                   AVATPAPHHPSSQGFVQSLGVFIDTILVCTATAIMILLSGILEPGSGLTGTQLTQMAMT
FT                   HHIGDVGVYFIAAAIFFFAFTSIIGNYSYAESAMTFLGLGGKVPITILRCALLAMVVWG
FT                   AYESIHTVFDAADASMGLMATINLIAIVLLSGTVKKLTVDYFAQRRAGQVPTFHAADYP
FT                   ELQGQIDMEIWSEQNTTNK"
FT   gene            468734..469018
FT                   /locus_tag="BMI_II481"
FT   CDS_pept        468734..469018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II481"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49613"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHX5"
FT                   /protein_id="ACU49613.1"
FT                   /translation="MIVAMKNPRLVGRFNDNHGLLSSPDGNFDFDNVERARWLSTRAEI
FT                   KSEYKIAGAGYRNACGRSHFAFGKCSQTSMELLLARFCQNTIASHGEFE"
FT   gene            469175..470095
FT                   /gene="metA"
FT                   /locus_tag="BMI_II482"
FT   CDS_pept        469175..470095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metA"
FT                   /locus_tag="BMI_II482"
FT                   /product="homoserine O-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II482"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49614"
FT                   /db_xref="GOA:C7LHX6"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHX6"
FT                   /protein_id="ACU49614.1"
FT                   /translation="MPIKIPDDLPATSVLEAEGVMVMREADAVRQDIRPLRIGLLNLMP
FT                   NKVTTETQIARLLGATPLQVELTLVRMTNHVARHTPADHMLSFYCPWEEVNDQRFDGFV
FT                   ITGAPVERLPFEEVTYWDEMRRVFDWTQSHVHRTLNICWAAQAAVYHFHGMKKYDLPAK
FT                   ASGVFRQRSLVPASPYLRGFSDDFAIPVSRWTEVRKSDIPADSGLKVLVDSTETGLCLL
FT                   DDPRHRSLHMFNHVEYDTTSLADEYFRDIQVQPEAKVPVNYFPGDDAKRPPENRWRSHA
FT                   HLLFGNWINEMYQSTPYDIERIGKV"
FT   gene            complement(470163..471152)
FT                   /locus_tag="BMI_II483"
FT   CDS_pept        complement(470163..471152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II483"
FT                   /product="glycosyl hydrolase, family 25"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II483"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49615"
FT                   /db_xref="GOA:C7LHX7"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHX7"
FT                   /protein_id="ACU49615.1"
FT                   /translation="MLQPQPSAETTSSIVRPVPPAPMHELASAPEVSVPQPREEILAWA
FT                   GPIPDAIPNAGPFKAEPPVPIAPQPEQRPVARISVPKPEIAAYPPVRLSQPQRTKIYSH
FT                   RFRDAKPINFGRASPRKLAVHGVDVSRWQGDIDWVKLRTQGANFAYIKATDGGDHLDPM
FT                   FRKNWREAKAAGIKRGAYHFFYWCRVASQQADWFIRNVPNDPDALPPVIDVEWNGDSSC
FT                   KRRPSRAQVLEKMQIFMDKLERHYGKRPIIYTAPDFYDDNLKGTFTDYPFWLRAVAQHP
FT                   SKVYPGRRWLFWQYSGSGLSQGVNEKIDLNVFHGSEDEWHRWVGRVTS"
FT   gene            complement(471505..472485)
FT                   /locus_tag="BMI_II484"
FT   CDS_pept        complement(471505..472485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II484"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II484"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49616"
FT                   /db_xref="GOA:C7LHX8"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHX8"
FT                   /protein_id="ACU49616.1"
FT                   /translation="MTVCSSRLAGFGHAVPDRRVENAEIEAQLGLETGWIERRTGIRCR
FT                   RWAMPDETLSHLAASAADMALSDAGIERSDIALTLLATSTPDHLLPPTAPLLTHWLNLQ
FT                   NSGAADLAGACTGFLYALVLADGFVRAQGKPVLVVAANLLSRRINMAERASAVLFGDAA
FT                   GAVVLAPSAKANSFQSQFITNGSHYDLIKVPAGGSARAYAPERDASEFLMTMQDGRAVF
FT                   TEAVRIMSGASQNVLASAAMLPQAIDRFFPHQANIRIVDKVCETIGVPRAKAASTLETY
FT                   GNSSAATIPLSLSLANLEQPLREGERLLFAAAGAGMTGGAVLMQV"
FT   gene            complement(472482..473756)
FT                   /gene="bioA"
FT                   /locus_tag="BMI_II485"
FT   CDS_pept        complement(472482..473756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="BMI_II485"
FT                   /product="adenosylmethionine--8-amino-7-oxononanoate
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II485"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49617"
FT                   /db_xref="GOA:C7LHX9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHX9"
FT                   /protein_id="ACU49617.1"
FT                   /translation="MNPNTSPVWHPFTQHRLEPRPDRIVRTEGAYLFREDGSAVLDMIS
FT                   SWWVITHGHRHPAIMDAIRQASADLDQIIFADFSHQPAEELAKGLIALAPDGLSHVFYS
FT                   DSGSTAVEVAIKMALGYFYNRGEPRSRIAVLQHSYHGDTIGTMSAGERGVFNAAYGALL
FT                   FNVETLPFPSPGHEQPMLDRLEDVCRGGDLAALLVEPLVLGAGGMKMYPAHILAAMREI
FT                   TERHGVLLAVDEVMTGWGRTGTLFACEQAGITPDILCTSKGLTGGSLPLAATLCTAAIF
FT                   DAHYSDDRSKTFFHSSSYTANPIACAAALANLQVWLSEPVTERISALTRMQTERLHRFK
FT                   DDSRFAGLRQTGTITALELDVPAGGYLSDAGPKLRTFFKQNGVLLRPLGNVIYVMPPYC
FT                   VTAEELDRTYDVITQGVDMIAGQTR"
FT   gene            complement(473753..474391)
FT                   /gene="bioD"
FT                   /locus_tag="BMI_II486"
FT   CDS_pept        complement(473753..474391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="BMI_II486"
FT                   /product="dithiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II486"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49618"
FT                   /db_xref="GOA:C7LHY0"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHY0"
FT                   /protein_id="ACU49618.1"
FT                   /translation="MNSRLIVTGTDTGIGKTVFSAALCHALGAAYWKPVQSGLEEETDS
FT                   EIVARLAQASPQRILPEAWRLNTPASPHLSARLDGVEIRPEEMHIPATSLPLVIEGAGG
FT                   LLVPLNDKTLFADLFAIWRIPAILCARAALGTINHTLLSLEAMRSRDIPVLGIAFIGEA
FT                   NEDTETTIAHLGRVKRLGRLPLLDDLSPEKLHHSFARNFHIDDFAGVAR"
FT   gene            complement(474388..475524)
FT                   /gene="bioF"
FT                   /locus_tag="BMI_II487"
FT   CDS_pept        complement(474388..475524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="BMI_II487"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II487"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49619"
FT                   /db_xref="GOA:C7LHY1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHY1"
FT                   /protein_id="ACU49619.1"
FT                   /translation="MKLDTYLTRLENLERKGRRRNLALADGLDFSSNDYLGLATHPGIK
FT                   AAVEAALQRGVPLGATGSRLLRGNHAEHEALEAEAAAHFSAPRMIYFGSGYMANLAALS
FT                   TLPQPGDLIVYDELIHASAHAGIRAGRAEAVGARHNDAQAFEDRIRAWRENGGRGTPWI
FT                   VVESIYSMDGDQAPLKALHAIATRYDGVLYIDEAHATGVYGANGGGFAATLGDAENIVT
FT                   LHTCGKALGGSGALLGAHATLCDYLVNRASGFIFTTAPSPLQAAALREALRILRDQPER
FT                   RARLFSRISHANERIATALGQPVSGTQIIPIIVGDNERAVRLAAQMQAQGFDIRAIRPP
FT                   TVPHGTARLRISITLNVGLADIDRMVETLSYATFREAA"
FT   gene            complement(475521..476507)
FT                   /gene="bioB"
FT                   /locus_tag="BMI_II488"
FT   CDS_pept        complement(475521..476507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="BMI_II488"
FT                   /product="biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II488"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49620"
FT                   /db_xref="GOA:C7LHY2"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHY2"
FT                   /protein_id="ACU49620.1"
FT                   /translation="MPDRGGENGASCSVGRWSAEEARAIYNLPFNDLLFRAHGLHRENF
FT                   DPNRIQLSKLLNIKTGGCPEDCGYCSQSASAENGLKASKLMEIETVLEEARKAKAAGAT
FT                   RYCMGAAWRSPKDRDMPALTHMIESVKAMGLETCMTLGMLDSDKAEKLADAGLDYYNHN
FT                   IDTSERFYPAVITTRSFEDRLDTLANVRNAGIKVCSGGILGLGEEAEDRIDMLVTLANL
FT                   PEPPESVPINMLIPMPGTRLAKAAPVDPLEFVRVVALARILMPKSHVRLTAGRTAMSDE
FT                   MQALCFFAGANSLFMGDTLLTAANPGDDRDSSLLRRLGIQAETEQPA"
FT   gene            476779..476940
FT                   /locus_tag="BMI_II489"
FT   CDS_pept        476779..476940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II489"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49621"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHY3"
FT                   /protein_id="ACU49621.1"
FT                   /translation="MRPAKVRMMKRGRRSDGLCRKARHDELIRKKQRDRVLPVKRNCSS
FT                   YIRQSWFS"
FT   gene            complement(476918..477199)
FT                   /locus_tag="BMI_II490"
FT   CDS_pept        complement(476918..477199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49622"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHY4"
FT                   /protein_id="ACU49622.1"
FT                   /translation="MPFSRDYHYGRFKTAELENLQAAYLKTCEALGHCPITSPQKDHIA
FT                   HQIIQIYECGVSNPDKIAELMVQIESVKPKPLVEELFTKTSATKTRIA"
FT   gene            complement(477296..477409)
FT                   /locus_tag="BMI_II491"
FT   CDS_pept        complement(477296..477409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II491"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49623"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHY5"
FT                   /protein_id="ACU49623.1"
FT                   /translation="MKSTAVFANENAALAVRVKLLRGHPRLRKVNYLPIGS"
FT   gene            477462..477980
FT                   /gene="mogA"
FT                   /locus_tag="BMI_II492"
FT   CDS_pept        477462..477980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mogA"
FT                   /locus_tag="BMI_II492"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II492"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49624"
FT                   /db_xref="GOA:C7LHY6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHY6"
FT                   /protein_id="ACU49624.1"
FT                   /translation="MKIGVVTVSDRASRGEYEDLSGPAIEAWLKGAIVTPYEIVRRVIP
FT                   DGMESVRDTLIDLCDTVACDLILTTGGTGPSPRDETPEAMKAVLHKELPGFGEQMRRVS
FT                   LEQTPTAVLSRQTAGSRGKSFILNLPGKPASIAMTLQAIFPAVPYCLDLIGAGRIDTDP
FT                   SVVKAHRPG"
FT   gene            complement(478032..478631)
FT                   /locus_tag="BMI_II493"
FT   CDS_pept        complement(478032..478631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II493"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49625"
FT                   /db_xref="GOA:C7LHY7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033877"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHY7"
FT                   /protein_id="ACU49625.1"
FT                   /translation="MNNALLDSIKKRRTQYALGKTLPHAREDVAELIREAIKHTPSSFN
FT                   SQSSRAVILFGQESDKLWNIVKETLRPIVPAEAFPQTEAKIDGFAAGAGTVLFYEDQSV
FT                   VKGLQENFPLYADNFPVWSEQSGGMAQHAVWAALANAGIGASLQHYNPLIDAEVAKTWD
FT                   VPSNWKLRAQMPFGSNEQPFPEKQFMNDAERFKVFF"
FT   gene            478955..480283
FT                   /locus_tag="BMI_II494"
FT   CDS_pept        478955..480283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II494"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49626"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHY8"
FT                   /protein_id="ACU49626.1"
FT                   /translation="MKSFIIIGGGASGVIIAAQLLRRAQDATVRIFEKSGRLGAGIAYS
FT                   TGNPSHLLNVRAGNMSAFPDEPEHFVNWLRTTDEGGGWDAQSFAPRRLYRDYLAGLLQP
FT                   YHLEAHPRLFVEKVEAADIVLEDGKPVVVAAAGTRFSADAIILATGNEASIATPGKHVA
FT                   EYWSSNGYFNIPIDAPVAIFGTGLSMIDSVLSLLDNGHKAEIFAISRRGLVPVRHLGGQ
FT                   PMQIGAEELTPASSLPSLVQHIRALMRKVEQKGGNWRDVMDGLRPHTQRLWSGLSVGQK
FT                   VRFLRHLRPWWDVHRHRMAPAAADRIAAAVKSGQLKVMAGRLVSVRQDGEDIAVCYSPR
FT                   GKGGEQMLRVAAIIDCRGGNQHFSTTRNPALIRLMEQGLARPDALDLGLDVTNDLQVVN
FT                   ARGEPSGPFFALGPVTKGMFWEVTAVPDIRVQAEKLAQRLLQE"
FT   gene            480724..483642
FT                   /locus_tag="BMI_II495"
FT   CDS_pept        480724..483642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II495"
FT                   /product="monovalent cation/proton antiporter, MnhA/PhaA
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II495"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49627"
FT                   /db_xref="GOA:C7LHY9"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR005663"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHY9"
FT                   /protein_id="ACU49627.1"
FT                   /translation="MTMDGRILFLLVLLPFLGSAITGLFRRADRSGSAWFTAAIALVAF
FT                   VATASIYPIVSGGKVLHGTLEWLPAYGLNVTLRMDGFAWLFAMLITGIGLLVVIYARYY
FT                   MSPEDPVPRFFSFLLGFMGSMLGIVLSGNIVLLAVFWELTSVFSFLLIGYWYHNASARD
FT                   GARMALTVTGIGGFCLLAGVLLLGHVVGSYDLDRVLAAGDLVRAHPLYTVILVLIALAA
FT                   FTKSAQFPFHFWLPNAMAAPTPVSAYLHSATMVKAGVFLLARLWPVLAGTEEWFWILGG
FT                   AGLISLLIASFFAVFQQDLKGLLAYSTISNLGLITVLLSLGSPLAAVAAIFHMVNHAIF
FT                   KASLFMAAGIIDHETGTRDMRRLSGLLKPMPYTATLAMVASAAMAGVPLLNGFLSKEMF
FT                   FAESVETHLVSWLDTITPYVATIAGIFTVAYSVRFIYSTFFGPPPHDLPKEPHEPPHWM
FT                   RRPIELLVLLCLLIGIVPGLSIGPFLHSAVISVLGQATPVYSLAVWHGFNLPLMMSIVA
FT                   MVGGILLHWLLKNYLATSEDGPPFFRHLQGQRIFERVLVTLSWNWARKAETFLSTRRLQ
FT                   PQLRIVVAFAVVAAAWPILEAGIPTGMLGVQPVDPIFAGLWILGGACAVGAAYQAKFHR
FT                   LVALILLGGAGLITCITFVWLSAPDLAVTQLLVEIVTTVLLLLGLRWLPKRWEDPDAAA
FT                   SVNFGPRLRRYRDLALAVVSGAGVAVIAYAMMTRPSPSSIGDYFLENAYSGGGGMNVVN
FT                   VILVDFRAFDTFGEIAVLGIVSLTVFALLRRFRPAPESTGSTDQQKIQDAYDEAMPGRK
FT                   AGETLADYLAVPSVIMHWLFPVIIVLAVHLFLRGHDFPGGGFAAGITLAIAFLLQYLAS
FT                   GTRWVEDRLRILPLRWIGLGLLFAAATGMGAWFFGYPFLTSFFRYAEIPHIGKMPIASA
FT                   LLFDFGVFLLVVGATVLVLIALAHQSIRKHRVEKLAAAKEEN"
FT   gene            483642..483980
FT                   /locus_tag="BMI_II496"
FT   CDS_pept        483642..483980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II496"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49628"
FT                   /db_xref="GOA:C7LHZ0"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHZ0"
FT                   /protein_id="ACU49628.1"
FT                   /translation="MELVLALAIGVLMASGVWLILRPRTFQVAIGLSLVSYAVNLFIFS
FT                   MGRLRTDAPPVLESGLDVQAAQYTDPVPQALVLTAIVIGFAMTALFLVVLLASRGLTRT
FT                   DHVDGKEN"
FT   gene            483983..485611
FT                   /locus_tag="BMI_II497"
FT   CDS_pept        483983..485611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II497"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II497"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49629"
FT                   /db_xref="GOA:C7LHZ1"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHZ1"
FT                   /protein_id="ACU49629.1"
FT                   /translation="MDWKTHLVVAPIVLPLVTAAVLLLFDERRRRLKMAISFVSMVCLI
FT                   ALAITLVGMASEKAPEAIVYLIGNWPAPFGIVLVLDRLAALMLVLASLLGLAALSFSFA
FT                   SWHKASPHFHTIFQLLLMGLNGAFLTGDLFNLFVFFEVMLAASYGLALHGSGPARVKAG
FT                   MHYIAVNLVASSLFLIGVSLIYGVTGTLNMADLAQRISHVAAQDRMLLEAGAAVLGVAF
FT                   LIKAGMWPLNFWLAPAYTAAAAPVAAVFAIMSKVGIYVLLRLSPLMFGISAGSSYGFGN
FT                   DWLYFGGMITLAFGLIGVVASQAMGRLASYSILVSSGTLLAAIGSGNTAMTGAALFYMV
FT                   SSTLAIAAFFLLIELVERGQDAAANVLAVTMEAYGDDEEEEDEEEVGTVLPATLAILGT
FT                   CFCICAILLIGLPPFSGFLAKFLILTAVFNGDGSAPQLTAPVSAASWVLVSLILLSGLS
FT                   ALIAMTRTGIRTFWASLEGNVPRVLVREVVPIAGLLGVCLALTIAAGPTMRYMDETARS
FT                   LHNPDDYINSVLRAPRTGAETAGAQ"
FT   gene            485608..486123
FT                   /locus_tag="BMI_II498"
FT   CDS_pept        485608..486123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II498"
FT                   /product="monovalent cation/proton antiporter, MnhE/PhaE
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II498"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49630"
FT                   /db_xref="GOA:C7LHZ2"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHZ2"
FT                   /protein_id="ACU49630.1"
FT                   /translation="MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMA
FT                   LEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRLILSPGRQRHPGFVVIPLELQNRTA
FT                   LAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFGAVD
FT                   IVEGEKSA"
FT   gene            486120..486401
FT                   /gene="phaF"
FT                   /locus_tag="BMI_II500"
FT   CDS_pept        486120..486401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaF"
FT                   /locus_tag="BMI_II500"
FT                   /product="potassium efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49632"
FT                   /db_xref="GOA:C7LHZ3"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHZ3"
FT                   /protein_id="ACU49632.1"
FT                   /translation="MSAVLIFWALLAAQVMLVAAMGCAVYRLLVGPRAQDRILATDALY
FT                   LDALLLLLTFGIRTGSIIYFEAALIIALLGFVATVALSKFLMRGEVIE"
FT   gene            486398..486760
FT                   /locus_tag="BMI_II499"
FT   CDS_pept        486398..486760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II499"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49631"
FT                   /db_xref="GOA:C7LHZ4"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHZ4"
FT                   /protein_id="ACU49631.1"
FT                   /translation="MIEAADFPLWAAILVSFLLVAGAFLTLVGCIGLVRFKTFYERVHA
FT                   PTIGSSFGAGGILLASIIFFSILQSKPILHEVLITVFVVVTTPVTLMLLSRAVLHRDRT
FT                   RDSKELPSSSESFQGR"
FT   gene            486777..487109
FT                   /locus_tag="BMI_II501"
FT   CDS_pept        486777..487109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II501"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49633"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHZ5"
FT                   /protein_id="ACU49633.1"
FT                   /translation="MRRRPESGCLRGVKWGNCGLPGGRAACLSLNVPIAVLECVSRQAI
FT                   ALFRKHIHHLPSPCARLFAFPRDRKGWPMPFGGVRGLRPIVLMRPASGMRIEGLVQLDY
FT                   LDFSNF"
FT   gene            487185..487721
FT                   /locus_tag="BMI_II502"
FT   CDS_pept        487185..487721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II502"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II502"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49634"
FT                   /db_xref="GOA:C7LHZ6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHZ6"
FT                   /protein_id="ACU49634.1"
FT                   /translation="MGSRWGINRTVGQIYALLYLSPEPLCADEIVEVLGVSRSNVSMGI
FT                   RELQGWNLVLLKHIPGDRRDFFTTPDDVWQILRTLAEERKKREIDPTLSVLREVLMEQP
FT                   QDDSDRYAQDRMKDMYSLIERLTNWYDDVKKLDTDRLTSLLALGAKVTRFLETTDRIVA
FT                   LGRGRTSAKKEPKRE"
FT   gene            487829..489454
FT                   /gene="cydD"
FT                   /locus_tag="BMI_II503"
FT   CDS_pept        487829..489454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydD"
FT                   /locus_tag="BMI_II503"
FT                   /product="ABC transporter, ATP-binding protein CydD"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II503"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49635"
FT                   /db_xref="GOA:C7LHZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHZ7"
FT                   /protein_id="ACU49635.1"
FT                   /translation="MLQTLAAVLWLPQAALLAYAAGRLADTGFDSSIYYCAAALFVIGC
FT                   LRSVLDARGGTQAFDAARLQLTSLREKAFAALARRSPLDVSRPSSGEAASILAEQAEMV
FT                   VPYLSRFVPVRYRVMLVPLIILAAVLWFSWVAALILLVAAPLIPVFMALIGWRAKAASE
FT                   KQLVALGGMNGFLLDRLRGLTTIRTFHAVDMTAKRLRENAETLRAKTMAVLRIAFLSSA
FT                   VLELFAALGVAMVAIYIGFHLLGTLQFGAWGHKLTLGEGLFILLLAPAFFEPLRDLSAV
FT                   WHDRAAGEAAIDALESLTHHTMPVVGEGGSAEVARCAPSVTLRDVGFRYSGGPVVLEGF
FT                   SLDIAAGEHIALLAPSGYGKSTLLALIAGLAAPQAGEITIGDTLLEPRTAVALRKRMSW
FT                   VGQKPHIFAGSARHNITLGRYADRAAIAGIIDDTALSHVAGVAGNRLIGENGAGMSGGE
FT                   ALRLALARIAVDPEADIILADEPTAHLDHETAEKIAENLVRLAQGKTLIVATHDETLAR
FT                   RMHRIVRLDHRGDDAAVIQRRAAE"
FT   gene            489451..491133
FT                   /gene="cydC"
FT                   /locus_tag="BMI_II504"
FT   CDS_pept        489451..491133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydC"
FT                   /locus_tag="BMI_II504"
FT                   /product="ABC transporter involved in cytochrome bd"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II504"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49636"
FT                   /db_xref="GOA:C7LHZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHZ8"
FT                   /protein_id="ACU49636.1"
FT                   /translation="MKGLHSLRPVLRLFFRSRAVALYAGIAAATITVLAGIALLGLSGW
FT                   FITATAIAGLSAATAVAFDVFAPAAGIRLLAILRTGARYLERLVTHDATLAVLAALREK
FT                   LFRSWAQPSAAHALLKRPARLLFRLTADIDALDSLYLRVLVPIGAALATALFAGVALGF
FT                   MHPLFGLLVALTLLVIGLGLPVIAAMRSEPAMRRRAKGTEALRARAIDLVAGQTELLMA
FT                   GRMEAQQAALVRADAYMGSADKALNRIEIATGAGLGIAHAAILAGGLAGVGLLVGAGMI
FT                   DAPVAVLGILIILGAMEPFAALRRGAMELGRTVLAARRVGPQLEEPAKAACLPLPVPGQ
FT                   AVVLENVSVRHEGAAATALKGFNLDIAEGERVAVVGTSGAGKSTLFNLLAGEIAAESGS
FT                   VAALPTRLLTQRTELFQDSLRNNLLLAKPDATDAELIDALQAAGLGEFMRNAPAGLDTA
FT                   LGEGGMGLSGGQARRLALARLFLTDAPLWELDEPTEGLDHATAEDVLARLSEKAAGRTL
FT                   LIATHIGRETKICNRIIVLNQGALILSVRKGEPLFDDILKTMR"
FT   gene            491277..492854
FT                   /gene="cydA"
FT                   /locus_tag="BMI_II505"
FT   CDS_pept        491277..492854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="BMI_II505"
FT                   /product="cytochrome d ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II505"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49637"
FT                   /db_xref="GOA:C7LHZ9"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C7LHZ9"
FT                   /protein_id="ACU49637.1"
FT                   /translation="MELDIVSLSRLQFAITALYHFLFVPLTLGLSVLLAIMETVYVMTG
FT                   RLIWRQMTKFWGTLFGINFVMGVATGIVMEFQFGMNWSYYSHYVGDIFGAPLAIEGMMA
FT                   FFLEATFVGLFFFGWDRLSKVGHLVATYAVAAGSNFSALWILIANGWMQNPVGSAFNPE
FT                   TMRMEITDFFAVLTNPVAQAKFVHTVSAGYATASIFVLGISAWYLLRGRSVELAKRSLT
FT                   VAASFGLAASLSVVVLGDESGYLTNEHQKMKIAAIEAMWETEPAPASFTLFGFPDQEAR
FT                   ETHFAVRIPWVMGLIGTRSLTTPIEGIDQLVQNAEKHIRNGIVAYDALQKIRAAGGTNA
FT                   VSQEVRDAFADNSQWMGYALLLKRYVDDPRNATDEQIVKAANDTVPGVLPLFWAFRIMV
FT                   GIGFFLILLTGTFFVLSARRALDRYPFLLKVAVFAIPLPWIAAEMGWVVAEFGRQPWSI
FT                   EGILPTAVAVSNLGASTVLLTIVGFVVIYTVLFIIEMGLMLRAIKAGPEPDSKPEAMLA
FT                   PASIAPAE"
FT   gene            492860..494014
FT                   /gene="cydB"
FT                   /locus_tag="BMI_II506"
FT   CDS_pept        492860..494014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="BMI_II506"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II506"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49638"
FT                   /db_xref="GOA:C7LI00"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI00"
FT                   /protein_id="ACU49638.1"
FT                   /translation="MILSDLLDYQTLRIIWWVLLGVLLIGFAAMDGFDLGVGTLLPFVA
FT                   RTDVERRVVINTIGPVWEGNQVWLILGGGAIFAAWPPLYAVSFSGFYLAMFVILFALIL
FT                   RPVGFKFRSKRDGETWRNSWDWALFIGGFVPALIFGVAVGNVLQGVPFRLNGDLQIFYE
FT                   GSFFGLLNPFALLCGILSVTMLTMHGAAWLVLKTDGVIQARARAYGSVAALLTVILYIV
FT                   AGAISWLWVSGYRITSAVVMDGPSNPLQKTVELDHGAWFANYANYPILLIAPALGILGA
FT                   LAVLATLRGGRELAPLLFGKLSIFGIISSVGVSMFPFILPSSIDPQSSLTVWDSSSSHQ
FT                   TLFIMLVVTVVFIPIIVAYTAWVYKVLWGKVDKSMIEDESNHAY"
FT   gene            493992..494186
FT                   /gene="ybgT"
FT                   /locus_tag="BMI_II507"
FT   CDS_pept        493992..494186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgT"
FT                   /locus_tag="BMI_II507"
FT                   /product="cyd operon protein YbgT"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II507"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49639"
FT                   /db_xref="GOA:C7LI01"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI01"
FT                   /protein_id="ACU49639.1"
FT                   /translation="MRATTLTDWKGSKMWYFSWLLGLPLAAAFAVLNAMWYELMDDRAR
FT                   KRLAADPTAELALEGNKHH"
FT   gene            complement(494237..495010)
FT                   /locus_tag="BMI_II508"
FT   CDS_pept        complement(494237..495010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II508"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II508"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49640"
FT                   /db_xref="GOA:C7LI02"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI02"
FT                   /protein_id="ACU49640.1"
FT                   /translation="MSGNFGAFLPKNLQGSAPSSGAGPLYVQLRQSLEAAIRAGQLADG
FT                   EALPPERDIAEYANISRVTVRKAVDDLVKAGLLVRRHGSGTFVVRPGERVQQSLSMLTS
FT                   FTEDMARRGIATQSRWLERGLYYPSPEEMMKLGLSSETRVARLGRLRMVGDMPLAIERA
FT                   SLSSEFLPDPDAVQGSLYAELGRTGFRPVRAVQRIAACNIKTSDARILGVQEGDAGLSI
FT                   ERLSYLASGRVVEFTKSLYRGDAYDFVAELTIPQS"
FT   gene            complement(495007..495894)
FT                   /locus_tag="BMI_II509"
FT   CDS_pept        complement(495007..495894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II509"
FT                   /product="N-acetylglucosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II509"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49641"
FT                   /db_xref="GOA:C7LI03"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI03"
FT                   /protein_id="ACU49641.1"
FT                   /translation="MTEFFIGVDGGGTGCRAVVAGRDGTILGFGHSGSANIVTDPQTSL
FT                   VNVKAAIDNAFDEAGLDKAHYATSHAVLGLAGGNVEGAGLPIERGLPFAHANVEFDGLI
FT                   ALQGALGDKDGVVAILGTGTAYIIRKGARIHSVGGWGFPLSDLGSGARLGQSLLQECLL
FT                   VHDGIHPGSPLTTAILNEFGNKPDNLVEFAWTAKPGDFGKYAPRIFQYAREGDPTAHML
FT                   LKHSAAYVSETLEVLIGQGAERISLLGGMAPLYVEWLPLHQQKLLVEPAADALTGALQL
FT                   ALNRYGPKNGRACG"
FT   gene            496058..496246
FT                   /locus_tag="BMI_II510"
FT   CDS_pept        496058..496246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49642"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI04"
FT                   /protein_id="ACU49642.1"
FT                   /translation="MALIRPEGERNAAEGEDRGLRDGAQSGGGRYLSRAARGDHTVTVW
FT                   RISPLLRIRAIKTGEGQ"
FT   gene            496243..497502
FT                   /locus_tag="BMI_II511"
FT   CDS_pept        496243..497502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II511"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II511"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49643"
FT                   /db_xref="GOA:C7LI05"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI05"
FT                   /protein_id="ACU49643.1"
FT                   /translation="MIRNTLKLMLLGSTLLATGSVAFAEDVTLTVESWRNDDLQIWQEK
FT                   IIPAFEAKHPGIKINFAPSAPTEYNAALNAKLDAGSGGDLIACRPFDTSLELFNKGKLA
FT                   DLTDLEGMKNFSDVAKSAWTTDDGSKTFCVPMASVIHGFIYNQEAFDKLGLKAPTTEAE
FT                   FFDVLEKIKADGTYIPMAMGTKDMWEAATMGYQNIGPTYWKGEEGRKALIAGKEKLTDP
FT                   EWVEPFKVLAKWKDYLGDGFEAQTYPDSQNLFTLGRAAIYPAGSWEIGLFNTQAQFKMG
FT                   AFPPPVKNAGDTCYISDHNDIGLGLNAASKNAEQAKVFLNWVASPEFAEIYANALPGFF
FT                   SLNSTAVKMADPLAQEFVSWREKCKPTIRSTYQILSRGTPNLENETWVESANVINGTDT
FT                   PDEAGKKLQAGLDSWYKPAK"
FT   gene            complement(497727..497855)
FT                   /locus_tag="BMI_II512"
FT   CDS_pept        complement(497727..497855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II512"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49644"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI06"
FT                   /protein_id="ACU49644.1"
FT                   /translation="MFSLDRIRLHETVPNFIFTHIQPESGVSVAISPVRAHFDLDE"
FT   gene            497875..498819
FT                   /locus_tag="BMI_II513"
FT   CDS_pept        497875..498819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II513"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II513"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49645"
FT                   /db_xref="GOA:C7LI07"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI07"
FT                   /protein_id="ACU49645.1"
FT                   /translation="MSQSADMPAIVHKRPKRWHIAVFLLPCVLIYTAVMVLPLIETLRQ
FT                   AFYNVVDGQRVFVGLANFEALFGDPNWSRDFWNALKNNVIFFLIHMLVQNPIGIFLAAM
FT                   LSLPRLRFSAFYRMALFLPTLLSFVIVGFIWKLILSPIWGVAPWMMDLVGLKWAFAPWL
FT                   GKADTALVTVSLVSVWQFVGIPMMLIYAALLNIPEEIVEAAECDGITGWSQFFKIKLPL
FT                   ILPSIGLISVMTFVANFNAFDLIYSMQGALAGPDKATDILGTFLYRTFFGFQLQLGNPS
FT                   MGATIAAVMFLIILAGVSLYLFGIQRRMRRYQF"
FT   gene            498832..499671
FT                   /locus_tag="BMI_II514"
FT   CDS_pept        498832..499671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II514"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II514"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49646"
FT                   /db_xref="GOA:C7LI08"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI08"
FT                   /protein_id="ACU49646.1"
FT                   /translation="MSKARTSPVRTALVHATLIFYMLIAVFPVALTLINSFKSRNAIFR
FT                   EPLRFPTPESFSLIGYETVLKQGSFLTYFQNSAIVTVVSIFLVILFGAMAAFALAEYRF
FT                   RGNMLTGLYLAIGIMIPIRLGTVALLQGMVAAGLVNTLTALILVYTAQGLPLAIFILSE
FT                   FMRTVSDDLKNAGRIDGMSEYAIFFKLVLPLIRPAMATVAVFTMIPIWNDLWFPLILAP
FT                   SEATKTVTLGAQLFIGQFVTNWNAVLAALSLAMFPILILYVLFSRQLIRGITAGAVK"
FT   gene            499668..500738
FT                   /locus_tag="BMI_II515"
FT   CDS_pept        499668..500738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II515"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II515"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49647"
FT                   /db_xref="GOA:C7LI09"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI09"
FT                   /protein_id="ACU49647.1"
FT                   /translation="MSSENQAPVRVLSAGLGNMGRSHALAYHRNPGFEIVGLVNRTKVP
FT                   VPDELAGYIIHPSFHEALKELKPDLACVATYSESHAEYAIAAMEQGADVFVEKPLATTV
FT                   EDARRVIDCARANGRKLVIGYILRHHPSWMRLIEEARKLGGPYVFRMNLNQQSSGATWE
FT                   THKNLMNTTSPIVDCGVHYVDVMCQITDARPVEVRGMGLRLSDEIKPDMYNYGHLQVLF
FT                   DDGTVGWYEAGWGPMMSETAFFVKDVISPNGCVSIVMNEAVTKSDDVDAHTKTANIRIH
FT                   RAERDADGRFLHPDTNLSMADEPGHQELCEREQAFMLKAIRENLDLDRHMNDALQSLRI
FT                   CLAADESVRSGQPVKL"
FT   gene            500768..501769
FT                   /locus_tag="BMI_II516"
FT   CDS_pept        500768..501769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II516"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II516"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49648"
FT                   /db_xref="GOA:C7LI10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI10"
FT                   /protein_id="ACU49648.1"
FT                   /translation="MGSLQLKSVHKRYGAQEVLKDINLEVNDGEFIIFVGPSGCGKSTL
FT                   LRSIAGLEDVSAGQVLINGEDVTVTPPSRRGIAMVFQSYALYPHLTVKANMGLGLKQAG
FT                   APKDEIEGRVAKASAMLALEPYLARRPAELSGGQRQRVAIGRALVRNPELFLFDEPLSN
FT                   LDAALRVQTRLEIAKLHRELKATMIYVTHDQVEAMTLADRIVVLNAGRIEQIGSPMELY
FT                   NRPDNLFVAGFIGSPQMNFIEAARIGATGARTIGIRPEHLSVSRESGTWKGKVIHAEHL
FT                   GADTILYVETETAGLVTARLFGEQHYNEDDVIFLTPEEGKTHRFDEAGKAIR"
FT   gene            501822..502073
FT                   /locus_tag="BMI_II517"
FT   CDS_pept        501822..502073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II517"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49649"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI11"
FT                   /protein_id="ACU49649.1"
FT                   /translation="MRFEMRIAIRILVVRKERCGQNIAPHTIFLFLKLWRERKQYQPVL
FT                   TLSAMIGKNIALEGANSFHIKPPINHGNKLISSQARRS"
FT   gene            502370..503602
FT                   /locus_tag="BMI_II518"
FT   CDS_pept        502370..503602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II518"
FT                   /product="2-oxoisovalerate dehydrogenase E1 component,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II518"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49650"
FT                   /db_xref="GOA:C7LI12"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR022593"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI12"
FT                   /protein_id="ACU49650.1"
FT                   /translation="MSDDVVLSLHVPEPEWRPGDAPDFSHVKIPRAGSVRRPEIDEKPE
FT                   AMRDMAFSIIRVLNREGEAVGPWAGTLTDEELKDGLRHMMMLRAYDARMMMAQRQGKTS
FT                   FYMQHLGEEAVSCAFRKALRKGDMNFPTYRQAGLLIADDYPLVTMMNQIFSNEQDPLKG
FT                   RQLPVMYSSKEHGFFTISGNLATQYTQAVGWAMASAISHDTKIAAAWIGDGSTAESDFH
FT                   AALVFASTYKAPVVMNIVNNQWAISTFQGIARGGSGTFAARGHGFGIPSLRVDGNDYLA
FT                   VHAVAKWAVERARRNLGPTTVEYVTYRAGGHSTSDDPSAYRPKAENDAWPLGDPILRLK
FT                   NHLIKRGVWSEERHKQAEAEVMDIVVSAQREAEAIGTLHDGRKPSMRDMFEDVYAETPP
FT                   HLIRQRQEAGF"
FT   gene            503706..504719
FT                   /locus_tag="BMI_II519"
FT   CDS_pept        503706..504719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II519"
FT                   /product="2-oxoisovalerate dehydrogenase, E1 component,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II519"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49651"
FT                   /db_xref="GOA:C7LI13"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI13"
FT                   /protein_id="ACU49651.1"
FT                   /translation="MTKMTMIEAIQNAHDIAMERDQKVVVFGEDVGYFGGVFRCTAGLQ
FT                   KKYGKERCFDAPISELGIVGTAIGMAVYGLRPCIEVQFADYVYPAYDQIVSEAARLRYR
FT                   SAGEFTCPIVIRMPSGGGIYGGQTHSQSPEALFTHVSGLKTVMPSTPADAKGLLLAAIE
FT                   DPDPVIMFEPKRLYNGPFDGHHDKPVTSWKKHDLGEVPEGYYTVPLGKAAIRREGSDVT
FT                   VLAYGTMVHVALAAAEETGVDAEVIDLRTLLPLDTETIMASVKKTGRCIIVHEATLTCG
FT                   YGAELAALVQRDCFYHLEAPIMRVTGWDTPYPHAQEWAYFPGPDRVGRALVSIMEA"
FT   gene            504720..506015
FT                   /locus_tag="BMI_II520"
FT   CDS_pept        504720..506015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II520"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49652"
FT                   /db_xref="GOA:C7LI14"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI14"
FT                   /protein_id="ACU49652.1"
FT                   /translation="MAHFAIKLPDVGEGVAEAELVEWHVKVGDIVREDDLLAAVMTDKA
FT                   TVEIPSSRAGKVIAINGEVGEKIAVGSELVRLEIEGGATEKAEEPQPQAAEPTAPAAAV
FT                   PEAPVLLQTPVPEKPAAPKRENAGRPFTGAGPLRPEGEKPLATPSVRLRARDAGIDLRR
FT                   VRGTGPAGRITHEDLDAFFQMESGAAPALSGYAADTSINEIKVIGLRRKIAERMAEAKR
FT                   HIPHITIVEEVDVTQLEELRNGLNHEKKEGRPRLTLLPFIIRTIVKAVKEQPGLNAHFD
FT                   DEADIIRQFGGVHVGIATQTPNGLIVPVVRHAESMSVFAAATELSRVTEAARNGTAKRE
FT                   ELTGSTITITSLGPLGAIATTPIINRPEVAIVGINKMAVRPMWDGTQFVPRKMMNLSCS
FT                   FDHRVIDGWDAAVFVQKLKSLLETPAMIFVEG"
FT   gene            506020..507414
FT                   /gene="lpdA-3"
FT                   /locus_tag="BMI_II521"
FT   CDS_pept        506020..507414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA-3"
FT                   /locus_tag="BMI_II521"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II521"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49653"
FT                   /db_xref="GOA:C7LI15"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI15"
FT                   /protein_id="ACU49653.1"
FT                   /translation="MSEISCKLLIIGGGPGGYVCGIRAGQLGIDTVLVEKTRLGGTCLN
FT                   VGCIPSKALIHAADEFHRLTTFAAKSPLGITTQNPAIDFARTLEWKDGIVHRLNSGVAG
FT                   LLKRSRVRMFQGQARFQDGKTVLVDTDTGRQTIHAENIVIATGSVPVEIQALPFGGNII
FT                   SSTEALSLEKIPERLAVVGGGYIGLEIGTAFAKLGSRVTVVEATDRILPQYDAELTRPV
FT                   MARLKTLGVEVLTGTSAKGLSADGKALEIRTQDGAVKAIEADKILVTVGRKPQTDGWGL
FT                   SEIRLDMDGRFIRIDDRCRTSMRGIYAIGDVTGEPMLAHRAMAQGEMVAEIIAGGKHAW
FT                   DKRCIPAVCFTDPEIVTVGLSPDEARKAGHNIQTGLFPFQANGRAMTMERDDGIVRVVA
FT                   RADNHVILGIQAVGAGISELSAAFAQAVEMGARLEDIAATIHAHPTLGEGFAEASMKAL
FT                   GHALHV"
FT   gene            complement(507403..508164)
FT                   /locus_tag="BMI_II522"
FT   CDS_pept        complement(507403..508164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II522"
FT                   /product="SurF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II522"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49654"
FT                   /db_xref="GOA:C7LI16"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI16"
FT                   /protein_id="ACU49654.1"
FT                   /translation="MPLPSKANGQIVRKRSRFFLGFMAVLGAAFFLLFVGLGIWQVERL
FT                   QWKLDLIARVDARVHADPVAAPGKDEWAHINRKDDEYRHVTLTGTYLNDKEILVHALTE
FT                   RGSGYWVLTPMRSDAGVLIFINRGFVPGEKRDAASRAQTQIAGETTVTGLLRMPEPGGF
FT                   FLRPNDPSRDDWNSRDIAAFAEKENLGPVAPYFIDADAQSNPGNLPVGGLTVVKFRNSH
FT                   LSYAITWFALAAMVAGAAIFVWRHERRSSNM"
FT   gene            508423..508677
FT                   /locus_tag="BMI_II523"
FT   CDS_pept        508423..508677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II523"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49655"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI17"
FT                   /protein_id="ACU49655.1"
FT                   /translation="MNSPPAMGITTLCETQDIANLRLVFRWFWHLCMNTLQYLLRNGAF
FT                   LFGRPNDYASHRSFSLFIGIRQPPGCPSQAPRMYEWMKY"
FT   gene            complement(508858..511323)
FT                   /gene="ftsK"
FT                   /locus_tag="BMI_II524"
FT   CDS_pept        complement(508858..511323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="BMI_II524"
FT                   /product="cell division protein FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II524"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49656"
FT                   /db_xref="GOA:C7LI18"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI18"
FT                   /protein_id="ACU49656.1"
FT                   /translation="MRNLRENFSYSNGNRVENASDPKLQRGQAEAQNPASDGAWKIHFS
FT                   LGENVRFTRTPEVELMRRRGEVLPDVNEQHPRAEAPVPAVDVKKAAQAQPMAVAALQKT
FT                   VSQNMVRTPVAPVPPVIPSAPASVATTVDNEPRQAASAAPATTTTTTTQTPVPAFAYLS
FT                   DSAFWEGCDIDIALMPSTLVVAAVPAEPRKPAPSVESILARFRVREWQKPQEETPVAVV
FT                   APQPVQPIAETAKPVAAEPFVEEPAAPAVEMAVAQGESTEDEVVLSVAEAEEHEAEEVA
FT                   APAAIVEAPAPVKAAPSIALYQPQPLPRAETPVIFGAYEFPPRALLQEPPSLEGNVITQ
FT                   EMLERSAGLLESVLEDFGVRGEIIHVRPGPVVTLYEFEPAPGVKSSRVIGLADDIARSM
FT                   SALSARVAVVPGRNVIGIELPNANRETVYLREMIDSRAFESSNYRLPLCLGKGIGGEPI
FT                   IAELAKMPHLLVAGTTGSGKSVAINTMILSLLYRFKPEECRLIMVDPKMLELSIYDGIP
FT                   HLLTPVVTDPKKAVVALKWAVREMEDRYRKMARLGVRNIEGFNQRAASAKGKGETVMCT
FT                   VQSGFDKETGEPTYIQEELDLTPMPYIVVIIDEMADLMMVAGKDIEGAVQRLAQMARAA
FT                   GIHLIMATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGQGDMLHM
FT                   AGGGRIVRVHGPFVSDEEVEKVVNHLKEQGRPDYLATVTEDEEEEDVAAEPAVFDNTAM
FT                   GGEDGEDVYEQAVKVVMRDKKCSTSYIQRRLGIGYNRAASLVERMEKEGLVGPANHVGK
FT                   REILTGQRD"
FT   gene            complement(511618..512640)
FT                   /locus_tag="BMI_II525"
FT   CDS_pept        complement(511618..512640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II525"
FT                   /product="D-aminopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II525"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49657"
FT                   /db_xref="GOA:C7LI19"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI19"
FT                   /protein_id="ACU49657.1"
FT                   /translation="MTGNARDFGIVCGIMPTGERNAITDVPGVQVGHHTLRDGNINTGV
FT                   TAIIPHGGNLYRRKVLAACDIINGFGKSTGLVQIEELGSLETPILLTNTFGVGTCANAL
FT                   IRDAIAANPDIGRATATVNPVVLECNDGPLNDIQAMAVTEEHARLALRSAQVNVPQGNV
FT                   GAGTGMTCFGFKGGIGTSSRRFEFDGKLHHLGILALTNFGRAGDLVLPDGRRPSPKAET
FT                   QPEKGSVILVLATDVALEHRQLKRVTRRCGAGLARLGAFWGHGSGDIAIGFTTGITFDH
FT                   DEPNDFIPMMILNENRIDTLFRAAAEATEEAVLNSMCRAQAMRGRAGNRRRSLADWLSH
FT                   "
FT   gene            512887..514197
FT                   /locus_tag="BMI_II526"
FT   CDS_pept        512887..514197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II526"
FT                   /product="major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II526"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49658"
FT                   /db_xref="GOA:C7LI20"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI20"
FT                   /protein_id="ACU49658.1"
FT                   /translation="MNITIEETLDQAGTGSFQRGLLGIFGLVWAADAMQVLAVGFTGAA
FT                   IAKTFGLTVPQALQTGTLFFLGMLVGAALFGRLADKYGRRRILLITVACDALFGLLSAF
FT                   APDFGSLLALRFLTGLAVGGTLPVDYAMMAEFLPAKNRGRWLVMLEGFWAVGTVVIAIA
FT                   AWATSVAGVEDAWRYIFIVTAAPALIGIWLRFRVPESPMHLLKSGRVEEAKAVINLVLS
FT                   RNGKPELPPGAKLLAPRLVTNERLLSPNLRQRTLTSLAIWFLVSVSYYGIFTWIPAKLA
FT                   SDGFGFVRGYGFLVVVALAQLPGYALAAYGVEAWGRRKTLIGFLFVSAAACALFTVATS
FT                   SSVVGASILIMSFALLGTWGALYAFTPELYPTALRASGMGAAGAMARLGGLLAPSAMAV
FT                   VINQSFYTAVAMFAGLLALAGIIAFFINVETRQQALN"
FT   gene            complement(514356..514994)
FT                   /gene="alkB"
FT                   /locus_tag="BMI_II527"
FT   CDS_pept        complement(514356..514994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkB"
FT                   /locus_tag="BMI_II527"
FT                   /product="alkylated DNA repair protein AlkB"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II527"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49659"
FT                   /db_xref="GOA:C7LI21"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI21"
FT                   /protein_id="ACU49659.1"
FT                   /translation="MKDLFDNLNTREIMAPGAVLLRGFALACEESILSAVARVCAAAPF
FT                   RHMTTPGGYRMSVAMTNCGPVGWVTDRTGYRYSPADPETGKPWPSMPDTFLALAQDAAR
FT                   QAGYPDFTPDACLINRYEPGARLSLHQDKDERNFSNPIVSVSLGLPATFQFGGMKRTDP
FT                   ITKYILHHGDVVVWGGPSRLFYHGILPLKSGEHERLGPFRLNLTFRKAF"
FT   gene            complement(515076..516686)
FT                   /locus_tag="BMI_II528"
FT   CDS_pept        complement(515076..516686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II528"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II528"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49660"
FT                   /db_xref="GOA:C7LI22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI22"
FT                   /protein_id="ACU49660.1"
FT                   /translation="MTTENILSVRDLRVTFDTHDGPVQAVRGINLDVKAGETIAIVGES
FT                   GSGKSQTTMAMMGLLAQNGKATGQALYRGQDLIGLSEKELNKIRGAKITMIFQEPMTSL
FT                   DPLYRIGDQLAEPLRYHRGLSKKDARPRILELLKLVGIPEPERRIDSYPYELSGGQRQR
FT                   VMIAMALANEPDILIADEPTTALDVTIQAQILDLLADLQKRLGMAVVFITHDLGIVRRF
FT                   ADRVYVMRSGEVVETGVTEKLFTAPEHPYTRMLLDAEPEGEKAPPPDDSPVLIRADNVK
FT                   VNFLINKPWIGAANYLTAVNDVSLTLKEGQTIGIVGESGSGKSTLGRAILRLIESEGRI
FT                   AYLGQELPRESQAMRAKRRELQLVFQDPFGSLSPRMTIGRIITEGLLIHEPQLSAKDRD
FT                   RRAQEALREVGMDPAMRNRYPHEFSGGQRQRIAIARTMILKPRVIVLDEPTSALDRSVQ
FT                   KQIITLLRDLQKDHGLSYLFISHDMAVVRAVSDYVIVMKNGKIVEQGDTEQVFDHPREE
FT                   YTKALMAAALSEERFGTNG"
FT   gene            complement(516688..517848)
FT                   /locus_tag="BMI_II529"
FT   CDS_pept        complement(516688..517848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II529"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II529"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49661"
FT                   /db_xref="GOA:C7LI23"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI23"
FT                   /protein_id="ACU49661.1"
FT                   /translation="MHGLIRGFAMTDLTVPTETAELSMPSRSLWQDAFLRLRKNKAAVT
FT                   SAIVLVLMALIGIFGPLLSPHPYDKIYPQFVRVAPSLEAYPRADTIMPGLEQVLARARL
FT                   KAAGEPELTGNQLVLNVTAQRPTDERVLRYFQRSDLFSNPKIELAPDGLSGKLTMNVSR
FT                   NYFLLGTDNLGRDLMTRIFIGVRMSLAIGLLASAMALVLGVGYGAISGYLGGRVDNVMM
FT                   RLVDILYSLPFIFFVILMLVFFGRSIFIIFIAIGATEWLDMARIVRGQTLSLKRQEFVR
FT                   AAEALGATRSGVITRHIIPNALGPVIVFVTLLVPKAILLESLLSFLGLGVQDPLTSLGL
FT                   LISEGAQNMRGASWQLIWPAATLTIILFALNFLGDGLRDSLDPKDR"
FT   gene            complement(517814..518737)
FT                   /locus_tag="BMI_II530"
FT   CDS_pept        complement(517814..518737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II530"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49662"
FT                   /db_xref="GOA:C7LI24"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI24"
FT                   /protein_id="ACU49662.1"
FT                   /translation="MLGYTLRRLGSAIPTIFIIITLTFFLIRLAPGGPFDLERPIDPLI
FT                   LENLKKAYNMDAPLWQQYLIYLGNLLHGDLGPSFTRRDFTVNDLFASGLPVSIILGTLG
FT                   LTLAAIIGTFLGTLAALKQNSATDYFVVALATFGITTPNFVVAPLLSLLFGVILGWVPA
FT                   GGWSSANVAYWILPVLTLALPQVGVIARLVRGATIEALRANHVRTARAYGLPSRVVVGI
FT                   HALRAAMLPAVSYLGPTAAALLTGSVVVETIFGIPGIGRYFVQGALSRDYTLVMGTVVV
FT                   ISIFVVVFNLIVDLLYAWLDPRVRYD"
FT   gene            complement(518952..520529)
FT                   /locus_tag="BMI_II531"
FT   CDS_pept        complement(518952..520529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II531"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II531"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49663"
FT                   /db_xref="GOA:C7LI25"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI25"
FT                   /protein_id="ACU49663.1"
FT                   /translation="MVRGILMTGICLLALNSAASAQIVLNRGNDTDPATLDQHHTSTVS
FT                   ENRVLRDLYEGLLAQNGKGEAIPGAASSWDISEDGKFYTFHMRDGAKWSNGDPVTAGDF
FT                   EFSFRRIMDPKTAAGYASVLYAIQNGEEVATGKMPVDQLGVKALDDKTLQITLKSPAPY
FT                   FLELLTHQTGFPVNKKAVEKFGDKFTLPGNLVTNGPYQLVSFVPNDKIVMKKNPNYWDA
FT                   ENVKIDTVNWMPFEDRSSCMRRFEAKEVDICSDVSAEQMDYVKKNLSKEFRLAPYLGIY
FT                   YVDIKGEPSSKLRDPRVRRAISLAADREFMADEVWRGVMLPAYSMVPPGIANYVKDAPK
FT                   LDFANEDILDREDKAKELLKEAGVEPNTLSVTLRYNTSENHKNTMAAFANMLKNIGINA
FT                   KLDEVEGTTYFNYLQEKGMFDLTRDGWIGDYNDPNSFLELYTTGNYFNYAEWSNKDYDA
FT                   LMDKSAVTTDLAERAKILAEAEEILLKEGAIVPLMYYSSTALVADRVQGYDDNLMNSHG
FT                   TRWLSVKN"
FT   gene            complement(520639..522216)
FT                   /locus_tag="BMI_II532"
FT   CDS_pept        complement(520639..522216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II532"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II532"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49664"
FT                   /db_xref="GOA:C7LI26"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI26"
FT                   /protein_id="ACU49664.1"
FT                   /translation="MYRKFLLMGVCLLALAGAASAEAVLNRGNDTDPATLDHHHTSTVA
FT                   EGNVLRDLYDGLTIQDADGKAIPGVAKSWDISEDGTVYTFHLRDNAKWSNGDPVTAGDF
FT                   QFTFRRLMDPKTAAGYASMLFIIKNAEDVAAGKKPVDQLGVEAVDDHTLKITLNSPAPY
FT                   FLELLTHQTGFPLHQKSVEANGDKFTTPGKMVTNGAYMLESFTPNDKIVMKKNPYYYEA
FT                   DQVKIDKVNWIPFEDRASCMRRFEAKEVQICSDVPAEQMDYVKKNLSKEFRMAPYLGVY
FT                   YLPVKGKTADSKLKDPRVRQAISMAIDRDFLADQVWQGTMIPGYSMVPPGIANYVKDAP
FT                   KLDYSDDMLEREDKAKELLKEAGVEPNTLSIELLYNTSENNKNTMAAIADQLGNIGIKA
FT                   RLNETEGASYFNFLREDGPFDIARASWIGDYNDPQNFLYISQGNVSFNYAKWKNADYDA
FT                   LMAKAEKTQDLGERANILADAAKIQLNELGAIPILYYSSLALVSSDVDGWNDNLMNSHK
FT                   TRWLSLKK"
FT   gene            complement(522310..522480)
FT                   /locus_tag="BMI_II533"
FT   CDS_pept        complement(522310..522480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II533"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49665"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI27"
FT                   /protein_id="ACU49665.1"
FT                   /translation="MPQAGSPCRYMRLSTPGNYGNFLRETIMFRERETRLQGSRTYWKQ
FT                   GACFTEIFYNI"
FT   gene            complement(522643..522990)
FT                   /locus_tag="BMI_II534"
FT   CDS_pept        complement(522643..522990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II534"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49666"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI28"
FT                   /protein_id="ACU49666.1"
FT                   /translation="MFKKTLIAAIAFSFVGASFAQAQDWRPQHGQHKVEPRRPMPPHKF
FT                   ERNDRRDYGKHNRWSKGQRYNDWRRHQEIRDYKRYGLRAPARGQRWIKVDDQFLLITAA
FT                   TGLIVGVLAGR"
FT   gene            complement(523244..523468)
FT                   /locus_tag="BMI_II535"
FT   CDS_pept        complement(523244..523468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II535"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49667"
FT                   /db_xref="GOA:C7LI29"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI29"
FT                   /protein_id="ACU49667.1"
FT                   /translation="MVLQTGKQYCGRVSACGGTYVLADVRPRRDAALCPSIHTPEDGMM
FT                   QWIYWIEFAMIVAMVAVVFGLTWMETLRK"
FT   gene            523785..524798
FT                   /locus_tag="BMI_II536"
FT   CDS_pept        523785..524798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II536"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II536"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49668"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI30"
FT                   /protein_id="ACU49668.1"
FT                   /translation="MGAIFNSLTSNTIEKARRHVLVAGGAGFLGSHLCERLLNEGHSVI
FT                   CVDNFSTGRIENIRHLLNFDGFSFIRHDIVNTLDLRVDEIYNLACPASPPHYQADPVHT
FT                   MKTNVIGSLNLLELAAHYKARIFQASTSEVYGDPHVHPQPENYWGNVNSFGPRSCYDEG
FT                   KRSAETLFHDFHQQYGVDIRIVRIFNTYGPRMRPDDGRVVSNFIVQALKGEDITVYGDG
FT                   SQTRSFCYVDDLIEGFHRLMYSPHAIRVPVNIGNPGEFTVGALAEQIIAMTGSRSRIVY
FT                   YPLPVDDPRQRRPDITVAKRELGWEPTVALAQGLEPTIAYFEHQLRKPTGKLVEAA"
FT   gene            524798..525784
FT                   /gene="galE-2"
FT                   /locus_tag="BMI_II537"
FT   CDS_pept        524798..525784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE-2"
FT                   /locus_tag="BMI_II537"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II537"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49669"
FT                   /db_xref="GOA:C7LI31"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI31"
FT                   /protein_id="ACU49669.1"
FT                   /translation="MSANNVLVVGGAGFIGSHTAKLLAGQGYAPVVYDNLSTGHQSAVR
FT                   WGDFVEGDILDQARLVETMEKYAPVAVIHFAASAYVGESVEDPAKYYRNNVGGTQSLLD
FT                   ACRLTRTQNVIFSSSCATYGVPSRLPIGEGEAQNPINPYGRTKLIAEHMLADYAVAYGL
FT                   RYVALRYFNASGADIDGELGEKHDPETHLIPRAMMAAAGRLDVLEVYGDDYETPDGTCI
FT                   RDYIHVTDLARAHVLAVEHLKEAGGNLAVNLGTGRGTSIREIVQSIGRLTGRSVPVAMR
FT                   ARRAGDPPALYADPALAAEKLGFHTVYSDLDTIIRTAAPHFGLEVRG"
FT   gene            525781..527625
FT                   /locus_tag="BMI_II538"
FT   CDS_pept        525781..527625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II538"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II538"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49670"
FT                   /db_xref="GOA:C7LI32"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI32"
FT                   /protein_id="ACU49670.1"
FT                   /translation="MKMRSTDSRADQVSAWAPVFGGWRRVEYLLGAGVWVAAIIYFWHW
FT                   WLQPANHTYLVGSILVTAILAWVTLLPAYFIFLFFRARRPVGPLNLPAGSRIAMVVTKA
FT                   PSEPFGVVAETLRAMLAQNVPHDTWLADEDPSPETLAWCREHGVFVSTRRGRADYHLHT
FT                   WPRRTRCKEGNLAFFYDHYGYERYDFVAQLDADHVPTEGYLFEMLRPFADPAIGYVSAP
FT                   SICDRNAHESWSARGRLYAEASMHGSLQAGYNNGLAPLCIGSHYAVRTVALREIGGLGP
FT                   ELAEDHSTTLMMNAGGWRGAHALDAIAHGDGPRTFADLVTQEFQWSRSLVMILLQYSPR
FT                   LVRTLPFRMKFQFLFSQFWYPLFSAFMALMFMLPIIALVAGQNFVAVTYPDFLAHFVPQ
FT                   AVILILLAYRWRAFGTFRPFDAKILSFEATLFLFARWPWALAGTLAALRDWATGSFVDF
FT                   RVTPKGASEVDPLPLRVLAPYGVMAILSIMPVLLIRDASESSRGFYIFAIMNALAYVVL
FT                   LLVIIVQHARENTVRYRTRFYQPALAASLLALMALPAVATVERGRDGIVALSWGTRSFS
FT                   LFDDRFSVAGAGIGGRDIHKVIFNPHWRVGATGNPDQK"
FT   gene            527640..529064
FT                   /gene="ugd"
FT                   /locus_tag="BMI_II539"
FT   CDS_pept        527640..529064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="BMI_II539"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II539"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49671"
FT                   /db_xref="GOA:C7LI33"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI33"
FT                   /protein_id="ACU49671.1"
FT                   /translation="MKIAVIGTGYVGLVSGTCFAAWGHEVVCVDKNARKIAVLERGILP
FT                   IYEPGLDELVERNCAEGRLRFTCNLAEAVRGAEMVFIAVGTPPRAGHGDADLSFVYMAA
FT                   RELAPLIDENAVVVVKSTVPVGTGDIVQKLIGSVRRAGTFSVASNPEFLREGVAIRDFL
FT                   YPDRVVIGVEDERARKALLDLYGTPLKEQKTPIVVTQRRTSELIKYAANAFLATKITFI
FT                   NELADLCEHVGSDVSQLALGIGLDKRIGESFLNAGPGYGGSCFPKDTLALLRTAQDHGV
FT                   ALRIVEETVTANEARKRRMALKVLDALGGDVEGLTIAVMGLTFKPDTDDMRDAPSVPLI
FT                   ETLQRFGARIRAYDPIGAENARNILSDVELCDDPYECVRAADAMVVITEWDSIRRLDLS
FT                   RVRQAMRQPVLIDLRNAYEPNVAENLGFRVSAVGRAATARHETSIKDALSLLASRSRRA
FT                   DSAEELVPEGGGSNDL"
FT   gene            529054..529599
FT                   /locus_tag="BMI_II540"
FT   CDS_pept        529054..529599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49672"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI34"
FT                   /protein_id="ACU49672.1"
FT                   /translation="MTFKPEKAFHAFVALPTVTILLMATTAFAGPVASAPQASETPTGT
FT                   RVMTAMELYTLYRNKSWQWTDGAGYMTGKDRSFAAWVDGPNGKSWGEGRWVITDTGRMC
FT                   LKANWYTKKGVFPAETCFEHRIGDGSIYQRREPDGTWYVFRHDPMQDGDEAQKLVSADL
FT                   VSAHREEMKAALAAIPVK"
FT   gene            529649..530593
FT                   /locus_tag="BMI_II541"
FT   CDS_pept        529649..530593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II541"
FT                   /product="endoglucanase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II541"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49673"
FT                   /db_xref="GOA:C7LI35"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI35"
FT                   /protein_id="ACU49673.1"
FT                   /translation="MKRLLKVSAALLCGTMVCGAVYAASGVSGANVDTRNIFQDKRPVI
FT                   TANSVTPGAYDPHGDYTNDPNSKIEHLFLPWEDVDLTSLHAADAYARERGRSLLITIEP
FT                   WSWARDWRVGPEDLLSGILNGRYDSNMAAVCSEAAKLKSPVTIRWAQEMEDDAGQFTWA
FT                   FWKPEGYVKAYRHVIDVCRKSLPSARYMWSPKGEEGLEAYYPGDNYVDIIGLSVFGYQP
FT                   FDQLEVGRDTTFVERTKPGYDRVARFNKPIAIAELGYEGDDDYVRAWAAEANKPHAEFP
FT                   AMTAVVYFNDREVYPWTRDVGRPDWRVANHPLD"
FT   gene            530590..531207
FT                   /locus_tag="BMI_II542"
FT   CDS_pept        530590..531207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II542"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49674"
FT                   /db_xref="GOA:C7LI36"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI36"
FT                   /protein_id="ACU49674.1"
FT                   /translation="MIGGCRRYGAAALAAPIPVFVFLHDCRLYGLQLSRWNRNMMMSSI
FT                   RFSIAGAAFSVLLLTGAAGAAPGTEADIAVQKMALAAAPMSAAALEQLYGGRTWRWNDG
FT                   GGYFSTKKHRFTAVTRKGTARSFATGRWFATDGGKLCMKAYWSNAGGGSGAITCFLHRE
FT                   QDGVVYQKPNLGGQWYVFRHNPVQKDDEARKLLRGDRIRQGR"
FT   gene            complement(531324..531650)
FT                   /locus_tag="BMI_II543"
FT   CDS_pept        complement(531324..531650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II543"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49675"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI37"
FT                   /protein_id="ACU49675.1"
FT                   /translation="MNIANIFDRMNFRRAVMFTVAAIGLAASPLFTAPAQAGEARKSRE
FT                   DIRLVYLAKYRVNGDVRYSKQPRGKLMRVSVSQYRTSNSYVCTPSGFGQKSHCHTANQI
FT                   KEYF"
FT   gene            complement(531793..532914)
FT                   /locus_tag="BMI_II544"
FT   CDS_pept        complement(531793..532914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II544"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II544"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49676"
FT                   /db_xref="GOA:C7LI38"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI38"
FT                   /protein_id="ACU49676.1"
FT                   /translation="MAADDGSQFVERRRWPRVSQAPLGEGLTASPALVPLRFETSSLPT
FT                   DQQFAAWQAHMSVLLTTHLPESAQPDDGFSVTQHVWNLDGILIVQQDTSAFHFERSANE
FT                   VRFSPIDHWMITIMRSGQSWTGMNGQVVENHPGLVEIRSLGQPFSGRTLAASSTSLIIP
FT                   ADAFADRGGLPITCNNVALGGHRAQLLIGYLTSVEASLGKLAQGDLAGVKANLRELVFD
FT                   AIAPLVEHIDEKDNVSQIALMTKARRFIQNNLASPDLTPDALGRELALSRTRLYELFET
FT                   FGGVANYIRRRRMLAAHAMLADPADTRKVAEVGEVIGFDSAANFSRAFTHQFGYSPSNI
FT                   RKQTATGAPATRNTPDIPPQATFESLLLTLGLF"
FT   gene            complement(533279..533673)
FT                   /pseudo
FT                   /locus_tag="BMI_II545"
FT                   /note="pseudogene of transposase orfB of IS711 insertion
FT                   sequence"
FT   gene            complement(533705..534016)
FT                   /locus_tag="BMI_II546"
FT   CDS_pept        complement(533705..534016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II546"
FT                   /product="transposase orfA of IS711 insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II546"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49677"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI39"
FT                   /protein_id="ACU49677.1"
FT                   /translation="MSNGTGSKHIFRGELVRPAAVASITDYLSTPSCGWRPMQRTGAIC
FT                   LRPSANGQRFMPAFGAGRTPVYGKGFSMPWLIRRTLNMSSLIAPYRKSTQMRRAQKGG"
FT   gene            complement(534013..536037)
FT                   /locus_tag="BMI_II547"
FT   CDS_pept        complement(534013..536037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II547"
FT                   /product="hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II547"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49678"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI40"
FT                   /protein_id="ACU49678.1"
FT                   /translation="MAVATRIGDLTEDSGTNTAAVSGNTIRAQTIVNDSSNTLEGKLSD
FT                   DYASSTLGTSSLTFGTPFGLEPRHVTQGAILAETAQINIATGHKATVSEGIIGTQNTAK
FT                   QEVAAGASLSLQENTIDASLAVNNAANRIAIDKEGDPTFQGSVLITNLQQNKEGSVDAE
FT                   TTESGILAQATEGDVANVMSILSGSLNVAENIVSSSATGNQTVGAAGAAGHQIVIGGQL
FT                   SVDSNTTGNGSSTISHDGGSAFAETAADFVIANNQANIGTDAADHLTISSASIGVEGTP
FT                   TIGAVVDAVEGGSVVLADNAVTSQAVGNNTSAAILKDDDSAVGFDATAALANHQINLFS
FT                   DIAATTQNGSVVAIVGKARDSIFDEGTVDVSGNKISALAFGNSASQQLALDANNLTAGD
FT                   STGLLTGGPNDETTHDSGLRAKAGAMLTSLQANYSSDISANNAASVVGVYGDNKVGSDI
FT                   SGAKLTVENNTQQATAIGSDATNLLGQVHYEDGKADHVAGLGGNSVAGSAGIANVQVGD
FT                   AGSSVIASLTDAVAGFPGISSRAPITLPFFNANVKQEESSFSVTDNVQSASASGTQSRN
FT                   ELVVESNSVTANIGTGAQEHPTSSNTGLDGAYVRDNEDSFHTIHQPMIMATYGLINDQS
FT                   IGGRVNALGPVCIQGFPFVRNSDSRLLKENSREQTKPYR"
FT   gene            complement(536613..537218)
FT                   /locus_tag="BMI_II548"
FT   CDS_pept        complement(536613..537218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II548"
FT                   /product="IS66 family element, orf4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II548"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49679"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI41"
FT                   /protein_id="ACU49679.1"
FT                   /translation="MKAPKRAKLLTLDQLETWFDKAEPAPPCRGVSTLNGFLTGLAAGP
FT                   VFLLPNDWMFHVIGKHEEKAFVGNKTYAVIETIVDHYNLIAHQLTAPGRYAPMFMRTDD
FT                   EEVLPGDWADGFYGAIKLNLAAWAPLMAEKQTGDPIMAILMQATEPDLLEMVSAVYPKP
FT                   PEAILKDAWRAIPTAIETIYAHCKPMRFNPGAPANDIS"
FT   gene            complement(537373..538887)
FT                   /locus_tag="BMI_II549"
FT   CDS_pept        complement(537373..538887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II549"
FT                   /product="IS66 transposase orf 3"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II549"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49680"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI42"
FT                   /protein_id="ACU49680.1"
FT                   /translation="MAWTGQEWRRSQSNGPQKQRDLIGIDRQFRADLLDFGMLNRGQHL
FT                   PRDPDILVGMILERDAEIERLKVLLKAANAKPFGQRSEQLAHMVERQIRLDLGDVVHEP
FT                   EVASASEGAGLPKMPRQASAHSRPRRNIGALPEHLERVVEVIEPSSLECACCQGKLHCI
FT                   GEDESEVLASRPATLYVLRTVRPKYACRACEAGIVQAKAKPRLFDGGLATTSMISNVVV
FT                   WRYAWYLPLNRQVQMLKGQGVRLDTSTLCSWVKRSAWWLKSLYDKLLAYIHSHSRVFVD
FT                   ETRMPVLKRDRTRTKICQFWAHAVDDRPWNGPAYPAVAYVFAQGRGKTEIQSQLVRYSG
FT                   ILQVDAYKAYKSLTRPDRRAGSIALAYCLAHARRKFVDVFKKYKSELAKVVIERLAEVY
FT                   AIEASIRSTSAEHRLGVRQAKSKVLMADLKMLLMDTLKDISAKDPVASAIKYTLGHWAG
FT                   LTLFLEDGRLEIPSSAICAASHSGASTACSPAVMAVPRPGPYWAPC"
FT   gene            complement(538826..539212)
FT                   /locus_tag="BMI_II550"
FT   CDS_pept        complement(538826..539212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II550"
FT                   /product="IS66 family element, orf2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49681"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI43"
FT                   /protein_id="ACU49681.1"
FT                   /translation="MHGVQSAQGLGVISLGSDLRIMIASKPVDFRKGINGLAALVSTAL
FT                   GANPYSGDIYVFRSKRNDRLKMVVWDGSGMVLLTKVLEDRRFIWPAVHAGAVRLSASEL
FT                   ALLLDGLDWTRVEKKPVKRPAKTA"
FT   gene            complement(539176..539643)
FT                   /locus_tag="BMI_II551"
FT   CDS_pept        complement(539176..539643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II551"
FT                   /product="IS66 family element, orf1, transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II551"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49682"
FT                   /db_xref="GOA:C7LI44"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI44"
FT                   /protein_id="ACU49682.1"
FT                   /translation="MDLGSVDVDEKASPHSADDRHQHYAVSKVVDDRPAPRRVEVLLGK
FT                   ERRRRWSADEKAEITAASFVPGANISAVARQYGVSQGLLHYWRRCAREHMSDDEEMRFV
FT                   PVVRADEGLGVPAAVTALTIRVEINGTCAVIEGGIDEQALCMVFKALRASA"
FT   gene            complement(539723..540119)
FT                   /pseudo
FT                   /locus_tag="BMI_II552"
FT                   /note="ISBm1 transposase orfA pseudogene"
FT   gene            540787..541260
FT                   /locus_tag="BMI_II553"
FT   CDS_pept        540787..541260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II553"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49683"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI45"
FT                   /protein_id="ACU49683.1"
FT                   /translation="MTLYCLIEGRQAYSFHCFIVCLMSNIETIFSSGLDQLMTFSIGAS
FT                   AGIVGLALAKRGVEYAKSFVGFSDPFSYVHSIDGVESGDFDGFSLRYNGMYFEDESELN
FT                   DYLLDQNDPDREANWQAYLRDIGYYESSGVDSYIREALANDSASAYDDHEQSF"
FT   gene            complement(541385..541474)
FT                   /locus_tag="BMI_II554"
FT   tRNA            complement(541385..541474)
FT                   /locus_tag="BMI_II554"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCA"
FT   gene            541733..542191
FT                   /locus_tag="BMI_II555"
FT   CDS_pept        541733..542191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II555"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49684"
FT                   /db_xref="GOA:C7LI46"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI46"
FT                   /protein_id="ACU49684.1"
FT                   /translation="MSLESVKAFFASKAPEVEVIELPTSTATVALAAEAHGVEPGQIAK
FT                   TLSFSTKDQTILIVTRGDARIDNRKFKDRFGTKPRMLDAQTVLAETSHPVGGVCPFGLP
FT                   GALPVFCDISLKTYDEVVPAAGATNSAVRIAPQKMADLVEAEWVDVCQ"
FT   gene            542437..542898
FT                   /locus_tag="BMI_II556"
FT   CDS_pept        542437..542898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II556"
FT                   /product="RrF2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II556"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49685"
FT                   /db_xref="GOA:C7LI47"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI47"
FT                   /protein_id="ACU49685.1"
FT                   /translation="MRLTRQTNYAIRMLMYCAANDGKLSRIPEIARAYNVSELFLFKIL
FT                   QPLVEHGLVETVRGRNGGVRLGRASQDISLFDVVRVTEENFSMTECFENDASECPLVDS
FT                   CGLNAALREALNAFFAVLMKYSIADLVKARPNVRLLLGLDEMEAPRIAS"
FT   gene            543015..543329
FT                   /locus_tag="BMI_II557"
FT   CDS_pept        543015..543329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II557"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49686"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI48"
FT                   /protein_id="ACU49686.1"
FT                   /translation="MFIAMNRFKVRIGSETDFETVWKNRDSQLSDVPGFESFHLLRGAT
FT                   NEDEGYTLYASHTVWRSQEDFIGWTRSEQFRHAHRNAGENKPLYLGPPQFEGFTAVLGQ
FT                   "
FT   gene            543785..544096
FT                   /locus_tag="BMI_II558"
FT   CDS_pept        543785..544096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II558"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49687"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI49"
FT                   /protein_id="ACU49687.1"
FT                   /translation="MLVCSCNIITEKEIEDTIIELLDEDCWQLIVPGTVYNAMNQRGRC
FT                   CGCFPNVVETIIRVTEEYYLRRNQMDENVIQFMDRVRSLRDKFGSSWNERRTKGHRAA"
FT   gene            544062..544547
FT                   /gene="bfr"
FT                   /locus_tag="BMI_II559"
FT   CDS_pept        544062..544547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="BMI_II559"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II559"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49688"
FT                   /db_xref="GOA:C7LI50"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI50"
FT                   /protein_id="ACU49688.1"
FT                   /translation="MKGEPKVIERLNEALFLELGAVNQYWLHYRLLNDWGYTRLAKKER
FT                   EESIEEMHHADKLIDRIIFLEGFPNLQTVSPLRIGQNVKEVLEADLKGEYDARASYKES
FT                   REICDKLGDYVSKQLFDELLADEEGHIDFLETQLDLLAKIGEERYGQLNAAPADEAE"
FT   gene            544711..546024
FT                   /locus_tag="BMI_II560"
FT   CDS_pept        544711..546024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II560"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /EC_number="1.3.1.74"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49689"
FT                   /db_xref="GOA:C7LI51"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI51"
FT                   /protein_id="ACU49689.1"
FT                   /translation="MSAPRVSFVSLGCPKALVDSERIITGLRSEGYEISRKHDGADLVI
FT                   VNTCGFLDSARDESLEAIGLALNENGKVIVTGCLGAEPDVIRERHPNVLAITGPQAYES
FT                   VMNAVHEVAPPAHDPFVDLVPPQGVKLTPRHYAYLKISEGCSNRCSFCIIPALRGDLVS
FT                   RPINEVLREAEKLVQAGVKEILVISQDTSAYGLDIKYQEAMWQDRTVRTKFLDLSRELG
FT                   EMGVWVRMHYVYPYPHVDEVIPLMAEGKILPYLDIPFQHASPAVLKNMRRPAHQEKTSR
FT                   RIQAWRETCPDLAVRSTFIVGYPGETEEDFQMLLDWLDEAKIERAGCFKYEAVKGAKAN
FT                   DLGLEQVPEEVKEARWHRFMAKQQQISTNLLKKKVGKRLPVIIDEANGTIGKGRTRYDA
FT                   PEIDGSVHISSRRPLRVGDIVTVKIEASDAYDLHGTAV"
FT   gene            complement(546164..547231)
FT                   /locus_tag="BMI_II561"
FT   CDS_pept        complement(546164..547231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II561"
FT                   /product="bmp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II561"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49690"
FT                   /db_xref="GOA:C7LI52"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI52"
FT                   /protein_id="ACU49690.1"
FT                   /translation="MKKTLMVIATVAGFMLGGAAHAEEKLKVGFIYIGPPGDFGWTYQH
FT                   DQARKELVEALGDKVETTFLENVAEGADAERSIERLARAGNKLIFTTSFGYMDPTVKVA
FT                   KKFPDVKFEHATGYKTADNMSAYNARFYEGRYVQGVIAAKMSKKGIAGYIGSVPVPEVV
FT                   QGINSFMLGAQSVNPDFKVKVIWVNSWFDPGKEADAAKALIDQGVDIITQHTDSTAAIQ
FT                   VAHDRGIKAFGQASDMIKFAPDTQLTAVVDEWGPYYIDRAKAVLDGTWKSQNIWWGMKE
FT                   GLVKMAPFTNMPDDVKKLAEETEARIKSGELNPFTGPIKKQDGSEWLKAGEKADDQTLL
FT                   GMNFYVAGVDDKLPQ"
FT   gene            complement(547314..548234)
FT                   /locus_tag="BMI_II562"
FT   CDS_pept        complement(547314..548234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II562"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II562"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49691"
FT                   /db_xref="GOA:C7LI53"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI53"
FT                   /protein_id="ACU49691.1"
FT                   /translation="MDLTQAILLTIATAATPLLIAAIGELVVERSGVLNLGVEGMMLMG
FT                   AVSGFAVAQITGSAWLGLVAAVLVGALFAAVFGFLTLTLVTNQVATGLALTILGVGVSA
FT                   LLGESFVGLPGVRLNPIYIPYLTDLPLIGRFLFGQDPIFYMSIALVIGVAWFLFRTRAG
FT                   LTLRAIGDSHGSAHALGVHVVRTRYLAVLFGGAYAGLAGAQLSLVYVPQWVENMTAGRG
FT                   WIALALVVFASWRPWRVLVGAYLFGAVTIGQLHAQALGFGLPSQFLSALPYLATIVVLV
FT                   IISRNKRLTMMNTPASLGKPFVPDR"
FT   gene            complement(548239..549321)
FT                   /locus_tag="BMI_II563"
FT   CDS_pept        complement(548239..549321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II563"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II563"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49692"
FT                   /db_xref="GOA:C7LI54"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI54"
FT                   /protein_id="ACU49692.1"
FT                   /translation="MRIELVKRPQPSRLFSALSPVLALALTLIFGGLAFLVMGKDPLHA
FT                   LYVFFVEPLFDIWSWHELLVKAAPLILIAVGLCVCFLSNNWNIGAEGQFIMGAIAGSIL
FT                   PVMFPDLESWIVLPLMMAMGMAGGAAYASIPALLKVRFNTNEILTSLMLVYVAQLFLDW
FT                   LVRGPWRNPEGHNFPETRQFNDSAILPEIWSASGRAHWGFIFALVAAVMVWFLLKHTLK
FT                   GFEVKVIGQSPRAGRFAGFSAGRMVFFVFALSGALAGLAGIAETSGAIGQLRPVISPGY
FT                   GFTAIIVAFLGRLNPLGAIVAGLVLALSYLGGEAAQVAIGISEKSARVFQGMILFFVLA
FT                   CDTLILYRIRIVMNRQAGKA"
FT   gene            complement(549321..550883)
FT                   /locus_tag="BMI_II564"
FT   CDS_pept        complement(549321..550883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II564"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II564"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49693"
FT                   /db_xref="GOA:C7LI55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI55"
FT                   /protein_id="ACU49693.1"
FT                   /translation="MSARSTDRPLLDVRRLTKVFGQLRACDGVDLTIAEGEIHALLGEN
FT                   GAGKSTFVKMLFGALQPLEGQIVWKGQGVAIHEPAAARKLGIGMVFQHFSLFDSLTAAE
FT                   NIALSLDRSLPLAEVARRAREVGRTYGLPVDPQAHVGDLSVGERQRIEIVRCLLQQPDL
FT                   IILDEPTSVLTPQEADRLFETLERLRAEGKSILYISHRLEEVKRLCDRATVLRHGKVVG
FT                   HCDPRKETAASLARMMVGNDIDVVARSTIAANGAGEPLFEIRAMSQPPRGPFSTALKDI
FT                   SLCVAAGEVVGIAGVAGNGQGEFFEAISGEVLQAGASVVRIGGKDAGRLGISERRMMGA
FT                   AFVPEERLGHGAVPGMTLTDNLFLSRYKTDSRAFLRGGKLKLIAESALRSATKRIIERM
FT                   DVRKSAENPAASALSGGNLQKFIIGRELDRAPSVMVVNQPTWGVDAGAAAHIRQALVDL
FT                   ARSGSAVLVISQDLDELLEISDRIAVMNHGRLSDPIPIADVTLEKIGLLMGGMAGETQA
FT                   GAA"
FT   gene            complement(550987..551961)
FT                   /gene="qor"
FT                   /locus_tag="BMI_II565"
FT   CDS_pept        complement(550987..551961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="BMI_II565"
FT                   /product="quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II565"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49694"
FT                   /db_xref="GOA:C7LI56"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI56"
FT                   /protein_id="ACU49694.1"
FT                   /translation="MINAIRVHRTGGPDVLHYEQVEIGEPGPGEARVRHEAVGLNFIDV
FT                   YFRTGLYKAAKMPFTPGNEGAGIVVAVGAGVENVRVGERVAYAATPGSYADERILPADR
FT                   LVKVPDTIDLKTAASMMLKGMTAQYLLRRTFRVEPGQTILFHAAAGGVGLIAGQWAKHL
FT                   GATVIGTAGSEEKIALARKHGYDHVINYRSENFVERVRELTNGEGVDVVYDSVGRDTYM
FT                   GSLDVLKPLGMFACFGQSSGVIPPFDLGILAQKGSLFATRPTLFNYIARRADLEKTTAE
FT                   LFDVVESGAVKIEINQTYALKDACKAHEALEARKTTGTSILLP"
FT   gene            complement(551958..552758)
FT                   /gene="pcs"
FT                   /locus_tag="BMI_II566"
FT   CDS_pept        complement(551958..552758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcs"
FT                   /locus_tag="BMI_II566"
FT                   /product="phosphatidylcholine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II566"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49695"
FT                   /db_xref="GOA:C7LI57"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR026027"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI57"
FT                   /protein_id="ACU49695.1"
FT                   /translation="MKTKLTGKLKAKKVTAPQAKAFSVHLLTASGSFLAFLSVVAASDG
FT                   RYTAMWWWLGLALFVDGIDGPIARKLEVKYVLPNWSGELLDSIIDYVTYVLIPAFALYQ
FT                   SGFMGTNLSFISGAIIVVSSAIYYADTGMKTKENFFKGFPVVWNMVVFTLFIVRPGEWV
FT                   AFGTVVASAILSFLPINFLHPVRVVRLRPLNLTIFLLWCAFGVIALYYMLDAPLWVRIG
FT                   ISVTGLYIYFIGAIMQLFPSLGREAALAKARKLVEKQQKSGEAP"
FT   gene            552974..554332
FT                   /gene="ubiH"
FT                   /locus_tag="BMI_II567"
FT   CDS_pept        552974..554332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="BMI_II567"
FT                   /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II567"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49696"
FT                   /db_xref="GOA:C7LI58"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI58"
FT                   /protein_id="ACU49696.1"
FT                   /translation="MIAIWFKCGGNASGKNRFCCQYQERRLHPKPPWPRMSAMNDVVVN
FT                   KPLTDIVISGGGPAGMMAALALGVRGYHTVLLGPETDKTDRRTTALMMPAIRFLEQIGV
FT                   WAAIELEAAPLQSMRIVDATRRLIRSPAVMFRASEIDEIAFGYNIPNAVLNAKLAEAVA
FT                   ASRNIRRITVPAIEYRPNGDHVTVTLKGGDTLHTRLLVAADGRNSGARDAAGIRTRRWS
FT                   YPQTAVVLSFSHMIDHENISTEFHTEEGPFTQVPLKGRRSSLVWVVNPARAEKLLSMSD
FT                   EALAVHIEEMMQSMLGKITLEVRPQAWPLSGLVPHVFAAKRTILIGEAAHVFPPIGAQG
FT                   LNLGTRDVETLVKAIESDSVDPGSERVMRAYDRARRPDIFARTGSVDALNRSLLSSMLP
FT                   AQILRGVGLEMLRSFAPLRAFFMREGLRPGSGFSHLLPRLPRLPGKADDAARQ"
FT   gene            554405..554743
FT                   /locus_tag="BMI_II568"
FT   CDS_pept        554405..554743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II568"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49697"
FT                   /db_xref="GOA:C7LI59"
FT                   /db_xref="InterPro:IPR011722"
FT                   /db_xref="InterPro:IPR036623"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI59"
FT                   /protein_id="ACU49697.1"
FT                   /translation="MGMAQIKHAKYQIGQVVKHRLFPFRGVIFDVDPEFANTEEWYQNI
FT                   PEDARPRRDQPFYHLLAENGETEYVAYVSEQNLVPDLSGEPLRHPQIDEMFDRMDNGTF
FT                   RVKAQHSN"
FT   gene            complement(554876..555493)
FT                   /locus_tag="BMI_II569"
FT   CDS_pept        complement(554876..555493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II569"
FT                   /product="invasion associated locus B (IalB) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II569"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49698"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI60"
FT                   /protein_id="ACU49698.1"
FT                   /translation="MSSTKTIAAASAIAGAFALLASATMPASAQQPPQGWFKVCSKQED
FT                   NDICNTQNIVTADSGQLLTAVNLIEIKGKINRKIFQVTVPIGRLIPAGVGLQIDNNKPV
FT                   KLEYGICFPDRCIAEAPLTDELINALKKGSKLTLTSVNYQNKPNPIPVALTGFSQALTG
FT                   PALKQSELEERQKELQDAVQKRQKEFEAKMKAEQDKAKGAAK"
FT   gene            555838..557685
FT                   /locus_tag="BMI_II570"
FT   CDS_pept        555838..557685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II570"
FT                   /product="peptide ABC transporter, periplasmic
FT                   peptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49699"
FT                   /db_xref="GOA:C7LI61"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI61"
FT                   /protein_id="ACU49699.1"
FT                   /translation="MLNRFIAFFRSVFLIGLVATAFGALPARAANETAPDYALSMHGDV
FT                   ALPADYTHFPYTNPDAPKKGSLTVGVVGTFDSLNPFVLKSMRTTARGLYNDGEFGNMVY
FT                   QTLMLRSRDEPFTLYSLLAEKVAIDPERKWVEFTLNPKAKWSDGQPVTVDDVLFTYDIL
FT                   TEKGRPPYNSRMSRVAKIEKTGERSVRFTFNEKSDREFPMLIAGSMPVLPKHAINRDTF
FT                   GNSTLEPPIGSGPYVVASVQPGQRIVYKRNPDYWGKDLPSQRGFNNFDKISIEYYRNET
FT                   SLFESFKKGILDIFIEGNPIRWEKLYDFPAVEQGKVIKDTFEKGTPADMLGFVFNTRRP
FT                   IFADRRVRQALGLLFDFEWANRNLFAGQYRRTQSFWEGSQLSSVGRPADARERELLAPF
FT                   PGAVREDVMNGTWHPPVTDGSGHDRVPAKKAYDLLSQAGFQFKDGMAIDPTGKPFAFEI
FT                   MTRSPDEEKIALAYQRNLSRLGIAVEIHTVDDAQYQQRLQTFDYDMILGALASSLSPGN
FT                   EQWLRWGSASRDVQGSFNFAGVADPAVDAMIEALLAARNRADFVSAVRALDRVLISGDY
FT                   YVPLYHLPYQWVARWDRIEHPQKTPLSGYQLPAWWHTSQ"
FT   gene            557864..558538
FT                   /locus_tag="BMI_II571"
FT   CDS_pept        557864..558538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II571"
FT                   /product="frnE protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II571"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49700"
FT                   /db_xref="GOA:C7LI62"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI62"
FT                   /protein_id="ACU49700.1"
FT                   /translation="MTGKKITIDVVSDVVCPWCFLGRKRLEAALASLPDVEAEIRWRPF
FT                   QLDPTLPPHGKDRQTYLREKFGTGSKIDDSHRQLRALGEEYGIVFDFDAIIRAPNTLDA
FT                   HRVIHWAAQAAPDTQDRMVGMLFSLYFEQGQDIGNHEVLVDAAASVSMDAEVVARLLQS
FT                   EADKDTIRDEIATANRIGVRGVPCFIIDQKYAVMGAQTPDVLADAIRQTAEGFEPGIAE
FT                   DR"
FT   gene            complement(558714..559112)
FT                   /locus_tag="BMI_II572"
FT   CDS_pept        complement(558714..559112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II572"
FT                   /product="fosfomycin resistance family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II572"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49701"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI63"
FT                   /protein_id="ACU49701.1"
FT                   /translation="MTFIVRDLDRMEEILTTVFDARRVYDSGAETFSLSKERFFLIGNG
FT                   KEPIWIATMEGEPLPTRTYNHVAFKIANNEYEAYLKRIRALGLEVREGRSRVPGEGQSI
FT                   YFYDDDNHMFELHTGTLDERLKRYGQGR"
FT   gene            complement(559205..562573)
FT                   /gene="mfd"
FT                   /locus_tag="BMI_II573"
FT   CDS_pept        complement(559205..562573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BMI_II573"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II573"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49702"
FT                   /db_xref="GOA:C7LI64"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI64"
FT                   /protein_id="ACU49702.1"
FT                   /translation="MYIVRDGQRIADLEQVLGFVSPDLPVLHLPAWDCLPYDRVSPGAD
FT                   AAARRLAALSALCALKKAPHPAVILTTANAVLQKLPPQAALGEQVISARPGNQLDMNDL
FT                   AARLERNGFERVSTVRDIGEYAVRGGILDLYAPGAEEPLRLDFFGDTLETIRAFDPASQ
FT                   RTTGTRKEFVLQPMSEITLSSDMISRFRKNYVAMFGAPQRDDALYQAISEGRRFAGMEH
FT                   WLPLFYDNLETVFDHAGPMPVVFDHLVHEALTERHTMVVDHYEARLRQAEGKEAGSDAV
FT                   PYKPVKPEMLYLTPGQVEEAAEAAGLRIDLTPFGAPEVSGRTIIHADVHKGRSFAEERA
FT                   ATDVNLFEAVVKHIADLRASGKKVLVAAWTEGSLDRLCQVLDEHGLEKIETVDRLSTVK
FT                   ALSRDKVTAAVLAVESGFDAGDLVVVAEQDILGDRLIRRSRRRKRDQDFISEVASLTAG
FT                   DIVVHVDHGIGRFIGLKTITAAGAPHDCLEIHYAGDDRLFLPVENIELLSRYGSEGSDA
FT                   VLDKLGGGAWQARKAKLKKRLLEIAGHLIQIAAERQMRSAPVMTPPDGLYAEFAARFPY
FT                   DETDDQLTAIEAVADDLAQGKPMDRLICGDVGFGKTEVALRAAFIAAMSGVQVAVVVPT
FT                   TLLSRQHFKTFSNRFHGLPINVAHASRLVGAKELAATKKGLEEGTVDIVVGTHALLGSS
FT                   IKFKNLGLLIIDEEQHFGVKHKERLKELKSDVHVLTLSATPIPRTLQLALTGVRELSLI
FT                   TTPPVDRMAVRTFVSPFDPLVIRETLLRERYRGGQSFYVVPRIADLTDIEEFLKEHVPE
FT                   LKVAVAHGQMAPGVLDDIMNAFYDGQYDVLLSTTIVESGLDIPTANTMIVHRADMFGLA
FT                   QLYQLRGRVGRSKQRAFALFTLPAGKMLTQMAERRLKVLQSLDTLGAGFQLASHDMDIR
FT                   GAGNLLGEEQSGHIKEVGFELYQQMLEEAVATLKGSGEVEDSQWSPQIAIGTAVMIPEA
FT                   YVPDLQLRLGLYRRLADLEEPQDIDAFGAELIDRFGPMPDEVQHLLKIVYIKALCRRAN
FT                   VEKLDAGPKGVVIQFRHATFNNPVGLVKMIGEQGSMAKIRPDQSIVFIRDWPTPEKRLN
FT                   GSAVIMTQLAKIAAA"
FT   gene            complement(562728..563015)
FT                   /locus_tag="BMI_II574"
FT   CDS_pept        complement(562728..563015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II574"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49703"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI65"
FT                   /protein_id="ACU49703.1"
FT                   /translation="MTGSTMATENLDVRRRKLLFRAWHRGMREMDLILGQYADKYIVSF
FT                   NDDQLNEFEHILEVLDRDLLKWVTGESPIPAEYDTPLFRDIVAFRDRVEF"
FT   gene            563154..565274
FT                   /gene="recG"
FT                   /locus_tag="BMI_II575"
FT   CDS_pept        563154..565274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="BMI_II575"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II575"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49704"
FT                   /db_xref="GOA:C7LI66"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI66"
FT                   /protein_id="ACU49704.1"
FT                   /translation="MFDPMRPSMLDPFFASVRSLSGIGPKVAVLLGKLLGTDVPGGEPK
FT                   IGQLLFLPPHSIIDRRNRPGIAFAQEGAIVTLEVTVDQHQPAPKGRGNVPHRVFAHDDT
FT                   GEIALTFFHAQLPWLQKMLPEGETVIVSGKVEWFNGRASMVHPDYIASMDDAASLPLVE
FT                   PVYPLTAGLSPKTLGRAIKEALTRVPVLPEWIDAPLLAREGFPAFQQALNTLHQPEDPG
FT                   DIALESITRRRLAYDEFLAGQLALALVRAKTRRLSGRPLEGTGNIVAEIMRHLPYRLTK
FT                   AQEQAVREIITDLKSPQRMLRLLQGDVGSGKTVVGLLSMAHAAESGGQSALMAPTEVLA
FT                   RQHFATIAPLAEKAGLKAALLTGREKGRERNAVLEGLKSGEIDIVIGTHALFQEKVEYH
FT                   DLVFVIIDEQHRFGVHQRLMLTAKGSAPDMLVMTATPIPRTLVLTAFGDMDVSKLTEKP
FT                   VGRQPITTAIVPMERMGELVERIRKAVSEGQKIYWICPLVEESEVVELTSAEERFESLK
FT                   SVFGERIGLIHGRMSGAEKDEAMRAFKQGETRLLVATTVIEVGVDVPDATIIVIEHAER
FT                   FGLSQLHQLRGRVGRGDKPSTCLLLYKGPLGEIAQARLKVMRETEDGFRIAEEDLKLRG
FT                   EGELLGTRQSGTPGFRLASIEAHGDLLEIARKDARYILASDPDLESERGQALRVLLYLF
FT                   GRDEAIRLLRAG"
FT   gene            complement(565429..567252)
FT                   /gene="glmS"
FT                   /locus_tag="BMI_II576"
FT   CDS_pept        complement(565429..567252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BMI_II576"
FT                   /product="D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II576"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49705"
FT                   /db_xref="GOA:C7LI67"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI67"
FT                   /protein_id="ACU49705.1"
FT                   /translation="MCGIIGIIGNDEVAPRLVDALKRLEYRGYDSAGIATLQNGRLDRR
FT                   RAEGKLVNLEKRLAGEPLPGVIGIGHTRWATHGRPVERNAHPHITTRLAVVHNGIIENF
FT                   AELRAMLEAEGRKFETETDTEAVAHLVTRELEKGKSPVEAVRDCLPHLKGAFALAFLFE
FT                   GDEELLIGARQGPPLAVGYGEGEMFLGSDAIALAPFTDTISYLEDGDWAVLTRNGVSIY
FT                   DENNKPVERPVQKSQNTNMLVSKGNHRHFMQKEMFEQPEVISHTLANYLDFTTGKVRKE
FT                   AIGIDFSKVDRLTITACGTAYYAATVAKYWFEQIARLPVDSDIASEFRYREMPLSKDSL
FT                   AMFVSQSGETADTLASLRYCKAQGLKIASVVNVTGSTIARESDAVFPTLAGPEIGVAST
FT                   KAFTCQLSAMASLAIAAARARGAIDEVREQELVHQLSEAPRFINQVLKLEDQIAAVCHD
FT                   LSKVNHVLYLGRGTSFPLAMEGALKLKEISYIHAEGYAAGELKHGPIALIDETMPVIVI
FT                   APSDRLYEKTVSNMQEVAARGGRIILITDKKGAESASIDTMATIVLPEVPEFISPLVYA
FT                   LPIQMLAYHTAVLMGTDVDQPRNLAKSVTVE"
FT   gene            complement(567356..568720)
FT                   /gene="glmU"
FT                   /locus_tag="BMI_II577"
FT   CDS_pept        complement(567356..568720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BMI_II577"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II577"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49706"
FT                   /db_xref="GOA:C7LI68"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI68"
FT                   /protein_id="ACU49706.1"
FT                   /translation="MTDRTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRG
FT                   TGKSDVALVVGRGAEDVRSAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLI
FT                   VFGDTPLIEAQSLLAARERLAQGADLVVIGFRPASPHGYGRLIEEGGRLVAIIEEKEAT
FT                   DEQKKIGFCNGGLMALRGQHALALFDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVP
FT                   VDNVIGINNRAELAEAETIWQNRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNV
FT                   FFGPSVHVASGALIHSFSHLEGAQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAK
FT                   VGKGAKINHLTYIGDAVIGASSNIGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPV
FT                   EIGDNAYIASGSVITADVPADALALGRARQETKEGRAKILREKYAAIKAAKSVSK"
FT   gene            complement(568802..569563)
FT                   /gene="ccdA"
FT                   /locus_tag="BMI_II578"
FT   CDS_pept        complement(568802..569563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="BMI_II578"
FT                   /product="cytochrome c-type biogenesis protein CcdA"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II578"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49707"
FT                   /db_xref="GOA:C7LI69"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI69"
FT                   /protein_id="ACU49707.1"
FT                   /translation="MKEVLVLDISYMTAAGAGALSFLSPCVLPLVPPYLCYMAGVSVED
FT                   FRADASKATAKPSARRSLGFAALCFVLGFTTVFVALGAGASSIGAFLRTWQQQIAIVAG
FT                   VVIILMGLNFLGLLRLSFLSREARFQARNAPASPLGAYIMGLAFAFGWTPCIGPVLGPI
FT                   LTLAGGSSTVGEGALLLATYSLGLGIPFLIAALFSGAFMRFLSRFRVHLGKVEKAMGVL
FT                   LIIAGVVFLTGGMQSFSFWLLENFPALGRLG"
FT   gene            569712..572354
FT                   /locus_tag="BMI_II579"
FT   CDS_pept        569712..572354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II579"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49708"
FT                   /db_xref="GOA:C7LI70"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI70"
FT                   /protein_id="ACU49708.1"
FT                   /translation="MLWWDDISMSLIDDEIPSSQPQVSGRHFGWLKQYQHFLFPIAGIA
FT                   IALLAIYVLENLLRHTSRTETLAALHNISWTTLALAVFFTALSYAAVALYDVVAVDTIA
FT                   PNQIPRRIAAVAGAAGYAISNALGFSLLTGGALRYRIYAAEGISLADIGKIVGTSWFAI
FT                   WFALIIMVGAALLIDPQDVPFLSAIDIRIDIVAGILILGGIGWLIYWLSHGERNVSIGS
FT                   FSLRLPNSKGALTQIFAGVVDVGAAAATLYVLLPEGAVPSFAVFALVYVIAIVLGIASH
FT                   APGGLGAFEATVIAGLGLGGKPDAIAGLLAYRLIYTVLPLVVATAGILIWEVMRRRHML
FT                   GKQARFAKRLVEPLVPGLSASIIFLGGIILLISGATPDMRYRVKLLSDIVPEFLVEMSH
FT                   LAASLVGVALLIVARGLSKRLERAWVAAMVLLLCGAVFSIAKGLDWEEASILCLFALSL
FT                   WGFRDSFYRRPIAGPFELSWNWIATVGTTVLVSTWLGFFVYRHIEYSSDLWWDFAWNGN
FT                   APRFLRATVLVFAVVAAVGLHSIINRHGQRRRKVDHSIPDAVPALVARCPHTDAALAML
FT                   GDKQFLLAPDDSAFIMYAQSGGSLIALGEPIGDAEAGKELAWSFHSLADRLALRTVFYG
FT                   VGPQSLPLFLDMGLIALKLGEVARVDLTDFSLEGPRRQPFRYADRKVDKDGLTFEIIPA
FT                   ADVPPLIPRLRAISDAWLDHKSGSEKGFSLGYFNDEYLKRFDIAVLKKDGEIVAFANIW
FT                   RGADKYEITVDLMRYMPNVHKLLMDALFAKLLTFSKQEGYKWFNLGAAPLSGLSGSRLA
FT                   SRWNRFGSFIYRRGADLYHFDGLKAFKEKFDPVWTPHYMVCPGGLETPRALLDATTLIN
FT                   GSPLEFIRK"
FT   gene            572603..573763
FT                   /locus_tag="BMI_II580"
FT   CDS_pept        572603..573763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49709"
FT                   /db_xref="InterPro:IPR010333"
FT                   /db_xref="InterPro:IPR011225"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI71"
FT                   /protein_id="ACU49709.1"
FT                   /translation="MDAMLARNIIVMPVELGPWRAALDKEDGECNYLDSDFEAIAKEAL
FT                   RGLDLGVYFHPVLTGIGQGATIAYAAASDSPDATIAGAVSLDPTPARTRLPSCTEKAEA
FT                   IKGPDGGFTYSVNAALPAPALLISPPGSPVNNPVEARRKNIAVLQTAPDFSARMKMAVD
FT                   NVVAMADQDAKNEALPIIDLPAKGGNADMVAVFYSGDGGWRDIDKSIGEWLQAHGVHVI
FT                   GVDSLRYFWSERTPEEIANDTTAMIKKADPTGKLPVAVLGYSFGADTFPFAWKYLDPSI
FT                   QDRTRMVGLLGVETTTTFQVSIEGWLGMNGDKDVVPAIASIPLDRVVCVYGQEEDDTAC
FT                   TADELKGMDTMKLPGGHHFDENYEPIAAALLDKMRSRAGLPPRPAR"
FT   gene            complement(573848..573923)
FT                   /locus_tag="BMI_II581"
FT   tRNA            complement(573848..573923)
FT                   /locus_tag="BMI_II581"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            complement(574037..574285)
FT                   /locus_tag="BMI_II582"
FT   CDS_pept        complement(574037..574285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II582"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49710"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI72"
FT                   /protein_id="ACU49710.1"
FT                   /translation="MLFALLINGVKSRTVKPLRLFGAAFLSKIRGAACRLAEGQAMPAL
FT                   AVFPDNYDSLLKLCARSREHKTGCFVRVEVVSGGTGG"
FT   gene            complement(574267..574767)
FT                   /locus_tag="BMI_II583"
FT   CDS_pept        complement(574267..574767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II583"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49711"
FT                   /db_xref="GOA:C7LI73"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI73"
FT                   /protein_id="ACU49711.1"
FT                   /translation="MLKSLKKVMVGMLGATFLISALAPVSAAPTMLSAPAVANENLQQV
FT                   RDHRWGGGDRHWGGHRPGYRPGWQGRPGYWNGHRGYRYYRHGYRRHSDGWWYPLAAFGA
FT                   GAIIGGALAAPPPPPPPVYPAPAYRYSNAHIQWCYNRYKSYRASDNTFQPYNGPRQQCY
FT                   SPY"
FT   gene            575007..576476
FT                   /locus_tag="BMI_II584"
FT   CDS_pept        575007..576476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II584"
FT                   /product="sensory box protein, light activated LOV domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II584"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49712"
FT                   /db_xref="GOA:C7LI74"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI74"
FT                   /protein_id="ACU49712.1"
FT                   /translation="MAIDLRPFIPFGRGALSQATDPFRAAVEFTLMPMLITNPHLPDNP
FT                   IVFANPAFLKLTGYEADEVMGRNCRFLQGHGTDPAHVRAIKSAIAAEKPIDIDIINYKK
FT                   SGEAFWNRLHISPVHNANGRLQHFVSSQLDVTLELSRLVELEKERKTLSIETARSKDQL
FT                   DYIVEVANIGFWTREFYSGKMTCSAECRRIYGFTPDEPVHFDTILDLVVLEDRMTVVQK
FT                   AHQAVTGEPYSIEYRIVTRLGETRWLETRAKALTGENPLVLGIVQDVTERKKAEANKAL
FT                   VSREIAHRFKNSMAMVQSIANQTLRNTYDPEQANRLFSERLRALSQAHDMLLKENWVGA
FT                   TIQQICATALAPFNSTFANRIHMSGPHLLVSDRVTVALSLAFYELATNAVKYGALSNEK
FT                   GVINITWAIMEDKGEKKFHMRWAESRGPEVMQPARRGFGQRLLHSVLAEELKAKCDVEF
FT                   AASGLLIDVLAPITPEVFPGMGHNVPEQRIA"
FT   gene            576604..577407
FT                   /gene="lipB"
FT                   /locus_tag="BMI_II585"
FT   CDS_pept        576604..577407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="BMI_II585"
FT                   /product="lipoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II585"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49713"
FT                   /db_xref="GOA:C7LI75"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI75"
FT                   /protein_id="ACU49713.1"
FT                   /translation="MPTGKLRQKPPYAAIMTNSPVTPSTETQQPKRDALYARFLPQEAD
FT                   APPVEWLIAEGLTDYEEALAFMEARVQAIREGTASELVWLVEHPPLYTAGTSANAEDLL
FT                   TPDRFPVFNTGRGGEYTYHGPGQRVAYVMLDLKRRREDVRAFVASLEQWIIETLAAFNI
FT                   KGERREDRVGVWVVRPEKPRLADGSMCEDKIAAIGIRLRRWVSFHGIAINVEPDLSHYG
FT                   GIVPCGISEHGVTSLVDLGLPVTMGDVDVALGKAFESVFGPRQTK"
FT   gene            complement(577411..578340)
FT                   /locus_tag="BMI_II586"
FT   CDS_pept        complement(577411..578340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II586"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49714"
FT                   /db_xref="GOA:C7LI76"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI76"
FT                   /protein_id="ACU49714.1"
FT                   /translation="MPKTTGGGVEAHVKGMGFMVLSVLMLPLMDAIGKWLAMMDDLPPA
FT                   TATFMRFFVQCWLMFFIILVVGGLRALATSHLMGNLLRGALMGFGGLCFFTAVKYMPLA
FT                   DAMAVFFAEPLILTLFSALFLKEKVGWRRFSAVGIGLIGTMIVIQPSFEIFGMVSLLPL
FT                   ATAVTFAIYLILNRKYGAKESPLTMQLYAGLGGWLFVGVAMLLAADRSFDDMHFALPHS
FT                   VQPWLLLLLLGTIGTVSHLIVVQAFKLAPASMLAPFQYLEIVNAVLVGLIIFGDFPTPS
FT                   KWLGIAIIIGSGFYVFMRESKKKTGRIS"
FT   gene            578645..580744
FT                   /gene="parE"
FT                   /locus_tag="BMI_II587"
FT   CDS_pept        578645..580744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="BMI_II587"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II587"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49715"
FT                   /db_xref="GOA:C7LI77"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI77"
FT                   /protein_id="ACU49715.1"
FT                   /translation="MDDSNDLFSRVVNNARERQMERQTGENTVAQPVVQPAPSAPKPVP
FT                   AAAKAPPAASGGDDYNASSIRVLEGLEPVRLRPGMYIGGTDEKALHHLFAEVIDNSMDE
FT                   AVAGHANFIEVTVDKEGFVTVSDNGRGIPVDEHPQVPGKSTLEVIMTKLHAGGKFDGKA
FT                   YETSGGLHGVGVSVVNALSDVLEVEVARNRRLYRQCFSRGIPQGGLEELGEVHNRRGTR
FT                   VRFHPDPEIFGKNAHFDPHRLYRMARSKAYLFGGVEIRWNCDPSLLDPKKETPEKAVFH
FT                   FPGGLKDYLEASLGKEHQVTREVFAGRTEKQGGHGAVEWAVAWFGGDGFVHSYCNTIPT
FT                   GDGGTHEAGLRIALTRGLKAYAELTNNKRASIITTDDVMVSAAGMLSVFIREPEFVGQT
FT                   KDKLATVEAQRLVENAIRDPFDHWLAASPQEASRLLEWVIDRADERLRRRQEKETVRKS
FT                   ATRKLRLPGKLADCTQNAAAGAELFIVEGDSAGGSAKQARNRANQAILPLRGKILNVAS
FT                   AGREKLTANQQIADLVQALGCGTRKNYREDDLRYDRVIVMTDADVDGAHIASLLITFFY
FT                   QEMPELIRNGHLYLAVPPLYRLSQGGKTAYARDDAHKEELLRTVFTGRGKIEIGRFKGL
FT                   GEMRADQLKETTMDPAKRTLLRVQVDEEYGDETRNTVDDLMGTKPEARFRFIQDRAAFV
FT                   EELDI"
FT   gene            complement(580750..580932)
FT                   /locus_tag="BMI_II588"
FT   CDS_pept        complement(580750..580932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II588"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49716"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI78"
FT                   /protein_id="ACU49716.1"
FT                   /translation="MWIMLTDVSGDKIAVNFNHVLSYNVYGTGTRLVTLSADLTFFVRE
FT                   STEEIETRLGIKVRE"
FT   gene            complement(580917..581141)
FT                   /locus_tag="BMI_II589"
FT   CDS_pept        complement(580917..581141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II589"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49717"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI79"
FT                   /protein_id="ACU49717.1"
FT                   /translation="MRRPENRPIHDAMPKDIERPAISGREDADAIHTLKMFNRRTGFWY
FT                   KSTLPDVEARLSFPERAIFQKEGKPCGSC"
FT   gene            complement(581166..582647)
FT                   /gene="gatA"
FT                   /locus_tag="BMI_II590"
FT   CDS_pept        complement(581166..582647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BMI_II590"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49718"
FT                   /db_xref="GOA:C7LI80"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI80"
FT                   /protein_id="ACU49718.1"
FT                   /translation="MSELTALTIAEARDKLKAKAITATELTDAYLSAIDAANDAINAYV
FT                   AVTHDQARSMAKASDERIAKGEADALEGIPLGVKDLFATKGVHTQACSHILDGFKPEYE
FT                   STVTANLWADGAVMLGKLNMDEFAMGSSNETSYYGPVKNPWRAKGSNADLVPGGSSGGS
FT                   AAAVAAHLCAGATATDTGGSIRQPAAFTGTVGIKPTYGRVSRWGTVAFASSLDQAGPIA
FT                   RDVRDAAILMKSMASLDLKDTTSVDLPVPDYEAALGRSVKGMKIGIPREYRVDGMPGEI
FT                   EELWQKGIQYLKDAGAEIVDISLPHTKYALPAYYIVAPAEASSNLARYDGVRYGLRVPG
FT                   KDIADMYEQTRAAGFGKEVKRRIMIGTYVLSAGYYDAYYLRAQKVRTLIKKDFEDVFAK
FT                   GVDAILTPATPSAAFGLADEVLANDPVKMYLNDIFTVTVNMAGLPGIAVPAGLNGQGLP
FT                   LGLQLIGRPFEEETLFQAAHVIEQAAGRFTPAKWW"
FT   gene            complement(582706..582993)
FT                   /gene="gatC"
FT                   /locus_tag="BMI_II591"
FT   CDS_pept        complement(582706..582993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BMI_II591"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II591"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49719"
FT                   /db_xref="GOA:C7LI81"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI81"
FT                   /protein_id="ACU49719.1"
FT                   /translation="MSVDISTVKRVAHLARIAVSEDDAERMTGELNAILGFVEQLNEVD
FT                   VEGIEPMTSVTPMKMRMREDKVTDGGIAAAVVANAPVTEDNFFVVPKVVE"
FT   gene            complement(583088..583801)
FT                   /locus_tag="BMI_II592"
FT   CDS_pept        complement(583088..583801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II592"
FT                   /product="metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II592"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49720"
FT                   /db_xref="GOA:C7LI82"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI82"
FT                   /protein_id="ACU49720.1"
FT                   /translation="MKITWLGHAAFRVETAKAVILIDPFLNGNPGAKGIDFKEATRGVT
FT                   HIALTHGHGDHVGDTVAIAREHGATVIANADLASWLGSQGVEKLDPGNTGGTLAHEGFT
FT                   ITFVNALHSSAMLTENGVSQALGNPNGLVFHFEDSPTLYHMGDTDIFSDMALINELHQP
FT                   EIGIVPIGDRFTMGGAVAALACQRYFNFNSVLPCHYASFPIIDRTADKFIAGMADHPAT
FT                   KVLADPAGTVHSFQA"
FT   gene            583901..584389
FT                   /locus_tag="BMI_II593"
FT   CDS_pept        583901..584389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II593"
FT                   /product="putative Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II593"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49721"
FT                   /db_xref="GOA:C7LI83"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI83"
FT                   /protein_id="ACU49721.1"
FT                   /translation="MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRP
FT                   VIKRVKFTIDAQVLLKALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTMQPLTDLP
FT                   FVFWDERLSTVAAERALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMMRRNDYDAG"
FT   gene            complement(584374..586029)
FT                   /locus_tag="BMI_II594"
FT   CDS_pept        complement(584374..586029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II594"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II594"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49722"
FT                   /db_xref="GOA:C7LI84"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI84"
FT                   /protein_id="ACU49722.1"
FT                   /translation="MNQAKRNEPLKTHEVTNQTPPITGTNAYLGDPLLMQIAARFPKEL
FT                   HTELEQAGRFVLSAEAQDLARLANTELPKLRTHDRQGRRIDLVEYHPAYHALMRRSVAQ
FT                   GLHSSIWEDNPLESGRRHQARAARFYLTAQLEAGHLCPLTMTSASLAALMASPEVYKQW
FT                   SPAVLSRKYDFSQKPAFRKQGVTLGMGMTEKQGGTDVRANATRAEPAIGGAWRLTGHKW
FT                   FMSAPMSDAFLTLAQTKEGLSCFLLPRLGEKGESNGFFFQRLKDKLGNRSNASSEVEFD
FT                   GALGQMIGSPGEGVKTIMDMVTLTRLDCAVASAGLMRSGLAEAVHHSRHRHVFGKPLVE
FT                   QPLMQRVLADMALDVAGATALSMRLARAFDMAASDRAEAAFARSMTPVVKYWVCKIAPA
FT                   LLYEAMECLGGNGYIEDGNLARAYREAPVNAIWEGSGNVMALDVARVLSRAPALFDGVL
FT                   DWISGQLGPRGQGTIDVLRAALQLTETDQGVARLLTEQLAFAAAAAELRQLGADDIADA
FT                   FIETRLGGQWRTTYGMLDARHNAMRIIDQLYPAS"
FT   gene            586186..587154
FT                   /gene="pyrB"
FT                   /locus_tag="BMI_II595"
FT   CDS_pept        586186..587154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="BMI_II595"
FT                   /product="aspartate carbamoyltransferase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II595"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49723"
FT                   /db_xref="GOA:C7LI85"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI85"
FT                   /protein_id="ACU49723.1"
FT                   /translation="MTNQTVSPLFPHRHLLGIKGLSPLDILCLLDLADQEIAVSRQPEK
FT                   KKSVLRGRTQINLFFEASTRTQSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTL
FT                   NAMQPDILVIRHASAGAAALLAQKVGCSVVNAGDGAHEHPTQALLDALTIRRAKGQIEN
FT                   LIVAICGDVLHSRVARSNILLLNALGARVRVVAPSTLLPAGMADMSVEVFNSMEEGLKD
FT                   ADVVMMLRLQRERMAGSFVPSVREYFHFYGLDREKLKFAKPDALVMHPGPMNRGVEIAS
FT                   DVADGPQSVIQQQVEMGVAVRMAVMEALLDPRRNPGNGEPA"
FT   gene            587151..588437
FT                   /gene="pyrC-2"
FT                   /locus_tag="BMI_II596"
FT   CDS_pept        587151..588437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC-2"
FT                   /locus_tag="BMI_II596"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II596"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49724"
FT                   /db_xref="GOA:C7LI86"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI86"
FT                   /protein_id="ACU49724.1"
FT                   /translation="MSAILFENARIVDPSRGLDETGSLLIENGKIVAAGSEARNQGAPE
FT                   GAEIVDLDGKAVMPGLVDSRVFIGEPGAEHRETIASASRAAAAGGVTSIIMMPDTDPVI
FT                   DDVALVEFVKRTARDTAIVNVHPAAAITKGLHGEEMTEFGLLRAAGAVAFTEGRNTIAN
FT                   TQIMRRALTYARDFNAVIACETRDPFLGANGVMNEGLFASWLGLSGTPREAEVIPLERD
FT                   LRLAALTRSRYHAAQLSCAMSADAMRRAKDLGTNVTAGVSINHLSLNENDIGEFRTFFR
FT                   LSPPLRGEEDRLAMVEAVKNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLETLLAAA
FT                   LRLYHNDNIPLLRLVEVLSTAPAKIFGLNAGTLKPGASADIAIVDLEEPWVVREEDLHS
FT                   RSKNSCFESARFQGRVVRTIVAGKTVYSA"
FT   gene            588512..589117
FT                   /locus_tag="BMI_II597"
FT   CDS_pept        588512..589117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II597"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49725"
FT                   /db_xref="GOA:C7LI87"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI87"
FT                   /protein_id="ACU49725.1"
FT                   /translation="MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSG
FT                   NIGATNVLRTGNKKLAAATLILDALKGTAAALIAAHFGQNAAIAAGFGAFIGHLFPVWI
FT                   GFKGGKGVATYLGVLIGLAWAGALVFAAAWIVTALLTRYSSLSALVASLVVPIALYSRG
FT                   NQALAALFAIMTVIVFIKHRANISRLLNGTESKIGAKG"
FT   gene            589114..590295
FT                   /locus_tag="BMI_II598"
FT   CDS_pept        589114..590295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II598"
FT                   /product="DNA processing protein DprA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II598"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49726"
FT                   /db_xref="GOA:C7LI88"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI88"
FT                   /protein_id="ACU49726.1"
FT                   /translation="MKQGANPKTGIRLSDRQRLNWLRLIRTDNIGAVTFRDLILFCGSA
FT                   SNALEMLPDLNIRGGSARPIRIISVDEAERELEAIERMGARLIGMGEPEYPPQLKNCEA
FT                   PPPLVIIKGDPGVFRKPPVAIVGSRNASVVGARFTEKLAHDLGSEGFCVVSGLARGIDA
FT                   AAHKASLSTGTAAVLAGGLDRPYPPENLPLYRAIPENGGALITEMPMGAEPRSRDFPRR
FT                   NRIIAGLSLGLIVVEAAERSGSLISARMAGEMGRTVFAVPGSPLDPRARGTNLLLKQGA
FT                   TLVTGVEDVIETLLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDAL
FT                   GPVPVDVDTLVRHTGIETDAIQLILLELDLAGRLLRYPGNRVAIVPCDEFTQA"
FT   gene            complement(590305..590472)
FT                   /locus_tag="BMI_II599"
FT   CDS_pept        complement(590305..590472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II599"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49727"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI89"
FT                   /protein_id="ACU49727.1"
FT                   /translation="MQRRATRREMFIYIEQLIDELAKLAKQAQNPMLVYLLEMAQEEAR
FT                   DSIEQVTAQD"
FT   gene            590728..593361
FT                   /gene="topA"
FT                   /locus_tag="BMI_II600"
FT   CDS_pept        590728..593361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="BMI_II600"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49728"
FT                   /db_xref="GOA:C7LI90"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI90"
FT                   /protein_id="ACU49728.1"
FT                   /translation="MNVVVVESPAKAKTINKYLGSDYKVLASFGHVRDLPAKDGSVRPD
FT                   EDFAMSWEVDSNSAKRLADIVKALKDSDGLILATDPDREGEAISWHVLEVLRQKKALNG
FT                   KTVKRVAFNAITKKAVLDAIAHPRDIDEPLVDAYLARRALDYLVGFTLSPVLWRKLPGA
FT                   RSAGRVQSVALRLVCDREAEIERFVREEYWNIAALLKTPRNDSFTARLTALDGKKLGKL
FT                   DIKNGEQAGAIRTMLESANFKAVSVEAKPTKRNPGPPFTTSTLQQAASGQLGFSASRTM
FT                   QVAQRLYEGVDIGGETAGLITYMRTDGVQIAPEAINAARDAIAKSFGAKYVPEKPRYYS
FT                   SKAKNAQEAHEAIRPTDFSRHPKDVRRFLDEDQARLYELIWKRAIASQMQAADIERTTV
FT                   DIEATNGSRAAMLRANGSVTKFDGFLAAYMDHREEEDDDEESAKLPEIRSGEALAREKI
FT                   DATQHSTEPPPRYSEATLIKKMEELGIGRPSTYAATLATLRDREYIIIDKRKLIPEAKG
FT                   RLVTAFLESFFERYVEYDFTADLEEKLDLISDGKLSWKEVLRDFWRAFSGSVEDIKELR
FT                   VTNVLDALNEELAPLVFPAREDGSDPRSCPTCGTGTLSLKLGRYGAFVGCSNYPECKYT
FT                   RQLGGEANGETAASDEPKPLGKDPFTGEEITARTGRFGPYIQRGEGKEAKRASLPKGWT
FT                   LDTVDHEKAIALLSLPRDIGLHPETGKMISAGIGRYGPYVSHDGTFANLENVEEVFSVG
FT                   LNRAVSVLADKQSKGGGRGRSTPAALATLGDHPDGGAITVRDGRYGPYVNWGKVNATLP
FT                   KGKDPASVTLEEALALITEKAGSSKGRKAPARKSAASSEKKTTAKKTATKKAPAKAKSK
FT                   AKAAEE"
FT   gene            593365..595716
FT                   /gene="rnr"
FT                   /locus_tag="BMI_II601"
FT   CDS_pept        593365..595716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="BMI_II601"
FT                   /product="exoribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II601"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49729"
FT                   /db_xref="GOA:C7LI91"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI91"
FT                   /protein_id="ACU49729.1"
FT                   /translation="MARRFSKSDTGRSARTERRAATAQSKDSAAFLPTREEVLKYIEEN
FT                   PDRAGKRELAKAFNIKGDARVYLKDLLRELADEGLVEKRARKLSRPGSLPSVAVLDITG
FT                   RDEDGSLLARPAEWDEASHGKPPMVLLRRTRLNKTSESGPVVGVGDRVLAKIFRNEDHA
FT                   GPDFSARVMKRLEHHANAVLGVVRKLGNGEWRLEPVNRKQGEVQLDPAMLENAESGDLV
FT                   EVELLSARRYGLPRGKVRQVVGSIDSEKALSMIAIHEHEIPHVFPDEVLREAETAGPAT
FT                   LEGREDWREIPLITIDPADAKDHDDAVYAEPDTDPENPGGQVVIVAIADVAAYVRPGSA
FT                   LDREAQKRGNSVYFPDRVVPMLPERISNDLCSLREMEDRPALAVRMIFSADGRKKSHKF
FT                   HRIMMRSAAKVAYGQAQAAIDGAPDDKTGPILDTVLKPLWNAYAVLKRGRDAREPLELD
FT                   LPEKKILLTPEGKVDKVIVPERLDAHKLIEEFMIQANVSAAETLEGRHQPLIFRIHGEP
FT                   ALAKQETLREFLRTLDLNLAKGAQLQPAQFNRILAAVDGTDHQELVNQVVLRTQSQAEY
FT                   SPDNIGHFGLHLRRYAHFTSPIRRYADLIVHRALIKALGLGTDGLTSAEEAQLEEISAL
FT                   ISATERRAMLAERETVDRLIAHFLASHLGDEYEGRVTGVTRAGLFVNLATYGADGLVPI
FT                   STLGHEYYLYDEANHAIAGERSGRGFRLGDTVTVRLVEALPVAGALRFEMVSEPHPLPM
FT                   STRSHHKASRAMRGRKGKPAGIPRHKRRGH"
FT   gene            595716..596177
FT                   /locus_tag="BMI_II602"
FT   CDS_pept        595716..596177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II602"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49730"
FT                   /db_xref="GOA:C7LI92"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI92"
FT                   /protein_id="ACU49730.1"
FT                   /translation="MSTLEANSEQNMQVFGGKNPKAILPKRPVGEALWRGFRCRCPHCD
FT                   EGKLFRAFVKPVDKCMACGEDYTEQRADDLPAYLTILVVGHIVVGLFMGVEATTNLSLW
FT                   AHMAIWGPMTLIMSLLLLQPIKGSVIGLQWALYMHGFGGENESEYGDAA"
FT   gene            596186..596917
FT                   /locus_tag="BMI_II603"
FT   CDS_pept        596186..596917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II603"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II603"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49731"
FT                   /db_xref="GOA:C7LI93"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI93"
FT                   /protein_id="ACU49731.1"
FT                   /translation="MSEPKPIPAKPRRCLRPRDAASLLLVDRSGATPRILMGRRHSSLA
FT                   FMPGKFVFPGGRADPADGAIAAASELSQNDTQKLLKGMGARASLRRARALGLCAIRETF
FT                   EETGLRIAHPASAHIVPPKHEDWCAFLERGMLPQLDSLRYFARAVTPPGNVRRFDTRFF
FT                   IAFRDSLPEVETQKLVPSGELEDLDWVLIDQIEKLDLARITQAILNEATALLMDTQLDL
FT                   PATLPVVQYSKRHDRFVREVI"
FT   gene            596992..598134
FT                   /locus_tag="BMI_II604"
FT   CDS_pept        596992..598134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II604"
FT                   /product="major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II604"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49732"
FT                   /db_xref="GOA:C7LI94"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI94"
FT                   /protein_id="ACU49732.1"
FT                   /translation="MHWRSLAAAIATISAVGAAIGLGIPLLSVLLESRGYSASLIGANT
FT                   AVAGLASIAAAPLAAPIAARLGVVKAILLMLLIGGGAFLGFHFLQPLWAWFALRVMLHF
FT                   ALTVLFVLSEYWINASAPPEKRGLVLGIYSTSLSLGFALGPWLFSKIGSTGGLPFYVGF
FT                   AIIMVALIPVLVAWRDSPDFEEGEHVPFLPFIFAVPTATMAVFVFGAVETGGFALFPVF
FT                   GTRVGYSEADAALLLTMIGLGNVLMQIPLGIVSDRISDRRKLLLFCATTGLIGMMALPY
FT                   LMQHWYFMAGILFLWGGVVAGLYTVGLAHLGSELTGRELASANAAFIFCYAIGMLAGPQ
FT                   LVGIGMDAMGPKGFPMTLGIFFAAYALFAAVRLLLRKKQS"
FT   gene            598293..598460
FT                   /gene="rpmG"
FT                   /locus_tag="BMI_II605"
FT   CDS_pept        598293..598460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BMI_II605"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II605"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49733"
FT                   /db_xref="GOA:C7LI95"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI95"
FT                   /protein_id="ACU49733.1"
FT                   /translation="MAKATTIKIKLLSTADTGFFYVTKKNSRTMTEKMTKTKYDPIARK
FT                   HVEFKETKIK"
FT   gene            complement(598567..599952)
FT                   /locus_tag="BMI_II606"
FT   CDS_pept        complement(598567..599952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II606"
FT                   /product="response regulator/GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II606"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49734"
FT                   /db_xref="GOA:C7LI96"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI96"
FT                   /protein_id="ACU49734.1"
FT                   /translation="MTARILVVDDVDSNVKLLEARLLSEYYEVVPAYSGAEAIEICLDG
FT                   QIDIVLLDVLMPGLDGFEVCRRLKANPRTANIPVIMITCLTSPEDKVRGLEAGAEDFLS
FT                   KPVNDLELLSRLKSLTRLKMMSDELFQRAGRIADAEVDALLARKMAGKDGNKDEIARIL
FT                   VVDEDELAAARLRHILDENYRVDVASDAETALIRAIETDYDTIIVSASFTYYDPLKLCT
FT                   QLRTIQRTRLIPIILMVWEDEGALVVRALELGVNDYLMRPLEKIELFARLRTQIKRKCY
FT                   NDILRQSMERTITQSVTDGLTGLHNRRYIDMHMPLLLTRAIERKQPLSIIMIDLDHFKQ
FT                   VNEQYGHGAGDHVLREFSGRLRRNIRGMDLISRYGGEEFVVVLPDTDRQAAFNVAERVR
FT                   GIVAEAPFVLDDGKRRASLTVSVGVAALRPAGDSLEALFTRATDALIQAKQSGRNRIVL
FT                   SAA"
FT   gene            complement(599949..600080)
FT                   /locus_tag="BMI_II607"
FT   CDS_pept        complement(599949..600080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II607"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49735"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI97"
FT                   /protein_id="ACU49735.1"
FT                   /translation="MPSAVFVLTESPERSNYLFCRIIRRKTASHFCWKCSKTFKDAQ"
FT   gene            complement(600073..600444)
FT                   /gene="divK"
FT                   /locus_tag="BMI_II608"
FT   CDS_pept        complement(600073..600444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divK"
FT                   /locus_tag="BMI_II608"
FT                   /product="polar differentiation response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II608"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49736"
FT                   /db_xref="GOA:C7LI98"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI98"
FT                   /protein_id="ACU49736.1"
FT                   /translation="MTKSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREH
FT                   HPDLILMDIQLPEVSGLEVTKWLKDDEELRHIPVIAVTAFAMKGDEERIRQGGCEAYIS
FT                   KPISVPRFIETIKSYLGDA"
FT   gene            600547..600912
FT                   /locus_tag="BMI_II609"
FT   CDS_pept        600547..600912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II609"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49737"
FT                   /db_xref="InterPro:IPR021955"
FT                   /db_xref="UniProtKB/TrEMBL:C7LI99"
FT                   /protein_id="ACU49737.1"
FT                   /translation="MANYSVTSGLLAVTTRHGTKRRERKYMKKLMSEADAQGLAIEALA
FT                   WLAQDKDLLPRFLALTGIEASSIRQAAREPGFLAGVLQFFLGHEPTLIRFCEETGHDPA
FT                   LFEKAVALLPGGFNQHL"
FT   gene            complement(600968..601477)
FT                   /locus_tag="BMI_II610"
FT   CDS_pept        complement(600968..601477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II610"
FT                   /product="nucleoside diphosphate kinase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49738"
FT                   /db_xref="GOA:C7LIA0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIA0"
FT                   /protein_id="ACU49738.1"
FT                   /translation="MNGKNRKKPNIVVSEVDYERLMGLASNASERFEEIAEELMAELDR
FT                   AKVVTAKRIPENVVQMGSTVEFRANDGHERRVTLVYPGEADIAKNRISILTPIGTALIG
FT                   LAPGQSISWTARDGKQHELNVLKVMRTDEAAEEVRAEAGNVVAFAGRDAVGVASEDDND
FT                   PGPSAA"
FT   gene            601928..603265
FT                   /gene="dinB"
FT                   /locus_tag="BMI_II611"
FT   CDS_pept        601928..603265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="BMI_II611"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II611"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49739"
FT                   /db_xref="GOA:C7LIA1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIA1"
FT                   /protein_id="ACU49739.1"
FT                   /translation="MAESPIVNHPEQGLCRDCLSLQKTQTSRRCHACGSPRLIRHKELY
FT                   RLSLAHVDCDAFYASVEKRDNPDLRDKPLIVGGGKRGVVSTACYLARIHGVRSAMPMFK
FT                   ALEACPDAVVIKPNMEKYARVGREVRQMMRDLTPLVEPISIDEAFLDLSGTERLHKAPP
FT                   AVVLARFSKRVENEIGITASIGLSYCKYLAKVASDLEKPRGFSVIGEAEALDFLRDKPV
FT                   GMIWGVGKAFAAKLESDGIRTIGQLQTMEEGALMKAYGTMGQRLYRLSRGQDSRKVEPD
FT                   HDMKSVSAETTFNTDLSAAGDLVPVLRALSEKVSRRLKAGEIAGRTIVLKLKTQDFKLR
FT                   TRNRQLGDPTQLADRIFRTGLQLLEKEMDGTRFRLLGIGVSDLSPSDRADPPDLVDIQA
FT                   TKRAVAESAIDRLRNKFGLNAVETGYTFSKGNLARTQTPTDRNNEP"
FT   gene            603441..605630
FT                   /locus_tag="BMI_II612"
FT   CDS_pept        603441..605630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II612"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49740"
FT                   /db_xref="GOA:C7LIA2"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIA2"
FT                   /protein_id="ACU49740.1"
FT                   /translation="MSKRSLTFALLTALSASVAFSASAEPVFNRIASFAVAENLPEGAD
FT                   RSKPTSSEIITVSEDGKTLIYSDSPYGAIGFIDITGPAAPKAGGLLKVEGEPTSVVVAG
FT                   PRVFAGVNTSESYKNPSGRLDVIDIASRKVEQSCDLGGQPDSVATSPDRKFLAVAIENE
FT                   RDEEFNNGELPQMPGGNLKIIELKDGKPDCAAMKTVDLTGIAEIAPEDPEPEFVAFNGK
FT                   NEIAVTLQENNHIAIVDAASGKILSHFSAGSVDLDKIDTKKDGQIKFNGEMKGVNREPD
FT                   SVKWLDDDRIVIANEGDYKGGSRGFSIFSKDGKLLHESGNTLEHRIARAGHYPEKRNKK
FT                   GVEIEGAEAAIFGDTHYIFAASERGSVVGVYKDTGKEPEFLQLLPSGIGPEGLLAIPSR
FT                   KLFVTANETDLVKDGGARSHVMIYELQDKPAAYPQIVSNLAEDGTPIGWGALSGLVADP
FT                   QKDGIFYAVSDSAYYAAPTIYTIDANTKPAKITAALLVKRGKDAAQKLDLEGITTDGEG
FT                   GFWLANEGNQAKLVPHAILNVDEKGVIRKEVALPADLLKQQTRFGLEGITRLGEGDDAV
FT                   LWMAVQREWADDDKGQVKLLAYSPKDESWKAVAYPLDAKEKGWVGLSEITAHDGNLYII
FT                   ERDNLIGTEAVNKRLYKVALDGLKPVAIGAKLPVVKKTLVHDFIPDLKKLNGFVPDKLE
FT                   GFAITRTGNAYAVTDNDGVDGSSGETQFFSIGKID"
FT   gene            complement(605610..605732)
FT                   /locus_tag="BMI_II613"
FT   CDS_pept        complement(605610..605732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II613"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49741"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIA3"
FT                   /protein_id="ACU49741.1"
FT                   /translation="MCKISPVLLSQASKETPHPSECGVSSGYERKVAGLIDLAD"
FT   gene            605820..605893
FT                   /locus_tag="BMI_II614"
FT   tRNA            605820..605893
FT                   /locus_tag="BMI_II614"
FT                   /product="tRNA-Cys"
FT                   /note="codon recognized: UGC"
FT   gene            complement(606159..606881)
FT                   /locus_tag="BMI_II615"
FT   CDS_pept        complement(606159..606881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II615"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II615"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49742"
FT                   /db_xref="GOA:C7LIA4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIA4"
FT                   /protein_id="ACU49742.1"
FT                   /translation="MAGLQLPSGNVWRRTVIVAVIATIISISLSTGIRFALGVKSDTVT
FT                   ILVRLLLPFLIAMPLGVFWFSRLEELERSYRTAVKRANELARVASVDPLTGLLNRRSFI
FT                   QQFNAANKAGVRGWFLIVDVDYLKQINDQYGHPAGDDAIIAVAQALEDCLSSDSLIARI
FT                   GGDEFCAFVPKGAINDVDSVLSDISLRADGLLREKRPNVGSSLTVSVGRISCKTGQIFE
FT                   EVLSIADEQLYRKKSQRQ"
FT   gene            complement(607554..607652)
FT                   /locus_tag="BMI_II616"
FT   CDS_pept        complement(607554..607652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II616"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49743"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIA5"
FT                   /protein_id="ACU49743.1"
FT                   /translation="MTNFIAGDFPTRSVRAAIACRGATLYKKAPAQ"
FT   gene            complement(607779..608156)
FT                   /locus_tag="BMI_II617"
FT   CDS_pept        complement(607779..608156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II617"
FT                   /product="endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II617"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49744"
FT                   /db_xref="GOA:C7LIA6"
FT                   /db_xref="InterPro:IPR004260"
FT                   /db_xref="InterPro:IPR021143"
FT                   /db_xref="InterPro:IPR024796"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIA6"
FT                   /protein_id="ACU49744.1"
FT                   /translation="MTRINCIPPAELTGPHLVAEYRELPRVFALVRAAIQRGEAPQDSR
FT                   NPQQYTLGAGHVRFFYARLGYLAKRQAALIAEMQARGYAPQFTNIEELLIGIPLEWRAD
FT                   WEPTAEAIAINRARIAERLRR"
FT   gene            608297..608602
FT                   /locus_tag="BMI_II618"
FT   CDS_pept        608297..608602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II618"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49745"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIA7"
FT                   /protein_id="ACU49745.1"
FT                   /translation="MNVANLQLEGLCLAIAAINHALVEKGILSQLEIDEALRKAEATAR
FT                   GDNRFIEDLKPSNRDAICFPIRVLQIANDTGAERPWTFSELARLVGGIKEPYNDML"
FT   gene            608747..608935
FT                   /locus_tag="BMI_II619"
FT   CDS_pept        608747..608935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II619"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49746"
FT                   /db_xref="GOA:C7LIA8"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIA8"
FT                   /protein_id="ACU49746.1"
FT                   /translation="MLPQTERFNVEVEASNEAEIFELQMQQRTARLVRYGIFAAAILLE
FT                   ILFLVFVVISHSNFFQV"
FT   gene            complement(608789..608968)
FT                   /locus_tag="BMI_II620"
FT   CDS_pept        complement(608789..608968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49747"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIA9"
FT                   /protein_id="ACU49747.1"
FT                   /translation="MMIINACHYYGLNLEEITVRYNDKDQKENFQQDGSRKNAIAHQPC
FT                   RALLHLKLKYFSFV"
FT   gene            608986..609279
FT                   /locus_tag="BMI_II621"
FT   CDS_pept        608986..609279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II621"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49748"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIB0"
FT                   /protein_id="ACU49748.1"
FT                   /translation="MSSGIFYGFIVDDERRGGGLFDLNRRNLGASKMIYPIHDQYGARI
FT                   GTVMTEEGNPPQERWVAYTLHGERKAFASWDAAQQWVGETASQPVRNDSPTA"
FT   gene            609373..610047
FT                   /locus_tag="BMI_II622"
FT   CDS_pept        609373..610047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II622"
FT                   /product="exonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II622"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49749"
FT                   /db_xref="GOA:C7LIB1"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIB1"
FT                   /protein_id="ACU49749.1"
FT                   /translation="MTDIYNPSIHTRKKRVIVFDTETTGILPYDRIITLGAVKIEGGEL
FT                   LTQSLYLIFDPRKDSSPQAEAVHGFDNWMTRYQDLFHELAAPIRKWFSWADEVVAHNAQ
FT                   FDMHYIQREFRKAEVDMLDQPVYCTMDGARRLWRGDSTKLDHCLAKIGLARTGHRHGAL
FT                   EDAYLTAGLYLHQQGVAKPLPKINSWQPPKNLKPYPERPAGELPRRTPKRRSAAVSACS
FT                   TV"
FT   gene            complement(610181..610255)
FT                   /locus_tag="BMI_II623"
FT   tRNA            complement(610181..610255)
FT                   /locus_tag="BMI_II623"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            610423..610704
FT                   /locus_tag="BMI_II624"
FT   CDS_pept        610423..610704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II624"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49750"
FT                   /db_xref="GOA:C7LIB2"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIB2"
FT                   /protein_id="ACU49750.1"
FT                   /translation="MTEEYTDFPRKRAIVILGRRIPMPQSVMMRRTLGGTLMVGGALGF
FT                   LPILGFWMLPLGLIVLSHDSHRVRRLRRRSEVHIWRKWLKRGSASQGE"
FT   gene            complement(610805..611764)
FT                   /locus_tag="BMI_II625"
FT   CDS_pept        complement(610805..611764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II625"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II625"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49751"
FT                   /db_xref="GOA:C7LIB3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIB3"
FT                   /protein_id="ACU49751.1"
FT                   /translation="MGSLHPRFILALIGSRILMSLIAENQTVMGIRSLGGRGLGTVTGH
FT                   RGVRHVKGPFQYGVTGDNVDISAQECAFAIILLDAVRNLKWNAGRGEDVIASYPAGTAF
FT                   VIPPHETIQFSWPLPVEYIYFPVSNRNKASHASEEGATGADAIPSKIIRFSSKQCLQVS
FT                   QILWEELQSENSEDHFLQALHLVLTNVVIRNAVMAYDTGGVQPGLSPYACRQIEAYLQE
FT                   NFRGPVSVPDMAAMLGISAGHFATCFRESFGQTPHRYLLKLRLDEAERCLRETDMPISE
FT                   IAARLNFSSQSHLTTALRKYRRLTPGKIRQAGASKSRY"
FT   gene            complement(611932..612093)
FT                   /locus_tag="BMI_II626"
FT   CDS_pept        complement(611932..612093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II626"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49752"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIB4"
FT                   /protein_id="ACU49752.1"
FT                   /translation="MRGTVPKIPLGIHDCCIARHIARNDGARRCNLEFFTCLFRAVGRI
FT                   LSCAYGKS"
FT   gene            complement(612119..613369)
FT                   /locus_tag="BMI_II627"
FT   CDS_pept        complement(612119..613369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II627"
FT                   /product="amino acid dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II627"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49753"
FT                   /db_xref="GOA:C7LIB5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIB5"
FT                   /protein_id="ACU49753.1"
FT                   /translation="MPMQQQDVIVLGAGIVGVSTALHLQARGRSVLLIDKGEPGEGTSY
FT                   GNAGLIERSSVIPYSFPQGLWNLLRYGMNRRSDVRYDPLYLPRIARWLFQYWRESSPER
FT                   LKIATQAMLPLVEASVREHDFLVQQAGCAKLIRAQGWIEVFRHAPAFNAAVRRLPDLQR
FT                   FNLSYDILDAPALRQRETALGEVAGGIHWLDPKTVVNPGGLVKAYADLFRRRGGAILRG
FT                   DAASLEATGAGWQVKAQEGHVQAREAVVALGPQSGVIFRKLGYPIPLGIKRGHHLHFNM
FT                   KDGVRLGHTVVDEEAGYVLAPMVQGVRLSTGIEFASPSAPANRIQLKRAEEIARRLVPQ
FT                   LGQPVEEKPWLGLRPCLPDMRPVIGEAPRHKGLWFNFGHAHHGLTLGPASGRLLAEMMT
FT                   GTEPFTDPTPYSAERFS"
FT   gene            complement(613458..614219)
FT                   /locus_tag="BMI_II628"
FT   CDS_pept        complement(613458..614219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II628"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II628"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49754"
FT                   /db_xref="GOA:C7LIB6"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIB6"
FT                   /protein_id="ACU49754.1"
FT                   /translation="MLKAIVFAGIASVIAVLPAQAREWKEIRIATEGAYPPFNFVASDG
FT                   SLQGLDVDIAKALCKAMDAKCTIVANDWDGMIPGLKSNKFDAVIASMSVTEERKKEVAF
FT                   TDKYYSTPLSVAVPKDSDITSVAPESFKGKTVGAQGSTTQGNYAEDVYGKAGAEVKLYP
FT                   TADEANADLKSGRLDAVVSDKFPISDWIKGDGADCCKLIGDIPGTQTDTAVALRLGDDD
FT                   LREQFNAAIKKIREDGTYATIVKKYFDFDIY"
FT   gene            complement(614375..615148)
FT                   /locus_tag="BMI_II629"
FT   CDS_pept        complement(614375..615148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II629"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II629"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49755"
FT                   /db_xref="GOA:C7LIB7"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIB7"
FT                   /protein_id="ACU49755.1"
FT                   /translation="MLKSLVLAGLASVVLTVSVQAPVQAKEWKEIRIASEGAYPPFNYM
FT                   SPDGKLVGFDLDIANALCEAMEAKCTIVANDWDGMIPGLQANKFDAVIASMAITDERKK
FT                   QVAFTDRYYTTPLAVVVPKDSDIVSLEPSAFAGKMVGAQAGTTQGNYADDVYGKAGADV
FT                   KLYPTADEANADLESGRLDALAADKFIAADWLKKQGADCCKFLGDIPGSETQIAVALRQ
FT                   GDDDLREQFNAAIKKIRENGTYETIRKKYFDFDIY"
FT   gene            complement(615333..616436)
FT                   /locus_tag="BMI_II630"
FT   CDS_pept        complement(615333..616436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49756"
FT                   /db_xref="GOA:C7LIB8"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIB8"
FT                   /protein_id="ACU49756.1"
FT                   /translation="MKEIVVVGAGKIGATIADLLASTGEYAVTVVDRSQAQLDALEAGA
FT                   AVKTQALDIEDAKALETALAGKFAVLSAAPFHLTTRIAEAAAKAGVHYLDLTEDVASTR
FT                   RVKELAKEAKTAFIPQCGLAPGFISIVAYDLAKRFDTLDSVRMRVGALPQYPSNALNYN
FT                   LTWSTDGVINEYIEPCEAIVNGELTEVPALEEREEFSLDGVTYEAFNTSGGLGTLCETL
FT                   EGKVRTLNYRTIRYPGHVALMKALLNDLGLRHRREVLKDIFENALPTTLQDVVVIFVTV
FT                   SGTKNGRLVQETYANKVYAAQIGKIVRSGIQITTASAICAVLDMLAKGDLPQQGFIRQE
FT                   DITLEAFLANRFGKAYAQEDHCARMVD"
FT   gene            616539..616988
FT                   /locus_tag="BMI_II631"
FT   CDS_pept        616539..616988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II631"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II631"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49757"
FT                   /db_xref="GOA:C7LIB9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIB9"
FT                   /protein_id="ACU49757.1"
FT                   /translation="MPYLTCVMTTEADLALIFLLRENARASTADLARRLGVSRTTVQSR
FT                   IEKLEKRGVIEGYTVRIAPEFERDLVRAHVLVTALPKLAPKVETALRSMMAVRTLHSVS
FT                   GHFDMIVVVEAPSIQELDAVLDRIGALEGVERTMSSIILSTRIDR"
FT   gene            617268..618995
FT                   /locus_tag="BMI_II632"
FT   CDS_pept        617268..618995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II632"
FT                   /product="twin-arginine translocation signal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II632"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49758"
FT                   /db_xref="GOA:C7LIC0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIC0"
FT                   /protein_id="ACU49758.1"
FT                   /translation="MCLMCGPAAKTILNITRRNLLKGLGAASLTAAIPFRAESADSEPG
FT                   QIVFFGGPIITMEPGAEQVEAVAVTNGVISAAGSKAEILDKKATDVLLVDLKGRTLLPG
FT                   FIDPHMHTIFSYFEDWLDMGPFVNGSYEQIMDKLRADAKAAKPGDWVRGWQYDPSITPG
FT                   AQPITLALLDEIAPNNPLFILEGNGHVTYANSKAFELAGITKDTQDPPEGRYIKDKNGN
FT                   LSGRIEEYPAFVPFVEKMPQVSPDEMERRVRALFDRGASNGCTAMMDCGLGLLMGEQDV
FT                   RTIQGVVAKDTPVRVRGALASTMYDKWVELGFKPGFGDDLFRIHAIKAWVDGSNQARTG
FT                   YMREPYLNSTTRGQLNYSLEDLTATMKRSHEDGWQICVHANGDAGIDNALKAYAATLQD
FT                   APRADHRHRIEHCSVLHDEQIKSMGDLGLSPSFLIGHVDYWGEAFRDDILGPERANLYD
FT                   RCGSARKAGLRISLHSDYNVTPIKPLQHIQTAVTRIMRANGEVLNPDERIPVEAAIRAV
FT                   TIDAAWQCHMDDLTGSIKAGKAADFVILEDNPLTVDPDKISQIKVSETWLDGKRRYSA"
FT   gene            complement(619106..620308)
FT                   /gene="pcaF"
FT                   /locus_tag="BMI_II633"
FT   CDS_pept        complement(619106..620308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaF"
FT                   /locus_tag="BMI_II633"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II633"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49759"
FT                   /db_xref="GOA:C7LIC1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIC1"
FT                   /protein_id="ACU49759.1"
FT                   /translation="MTEAYICDYIRTPIGRYGGALSSVRADDLGAVPLKALMERNGSVD
FT                   WEAVDDVIFGSANQAGEDNRNVARMSLLLAGLPVGVSGTTINRLCGSGMDAVITAARAI
FT                   KAGEAELIVAGGVESMSRAPLVMPKADSAFSRKAEIYDTTIGWRFINPLMKKQYGVDSM
FT                   PETGENVAEDYNISREDQDAFALRSQDKAAAAQANGRLAREIVSVTIPQRKGDPVIVEK
FT                   DEHPRATSREALAKLPTPFRQGGTVTAGNASGVNDGAAALVIASEAAIRKYGLKPIARI
FT                   IGGAAAGVPPRVMGIGPAPATRKLCARIGIAPDAFDVIELNEAFASQGLAVLRQLGIAD
FT                   DDKRVNPNGGAIALGHPLGMSGARIAGTAALELSLNNGKYALATMCIGVGQGIAIALER
FT                   A"
FT   gene            complement(620317..621006)
FT                   /gene="pcaJ"
FT                   /locus_tag="BMI_II634"
FT   CDS_pept        complement(620317..621006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaJ"
FT                   /locus_tag="BMI_II634"
FT                   /product="3-oxoadipate CoA-transferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II634"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49760"
FT                   /db_xref="GOA:C7LIC2"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIC2"
FT                   /protein_id="ACU49760.1"
FT                   /translation="MTIDTLEDIKLSNAQIAWRAAQDIADGAYVNLGIGFPEMVARYQP
FT                   EGREAIFHTENGILDFGEAPPPGEEDWDLINAGKKAVTLKPGAAFFHHADSFSMVRGGH
FT                   LDVAILGAYQVAQNGDLANWRVGAKGVPAVGGAMDLVHGAKQVVVITEHVTKKGEPKLV
FT                   EQCTFPLTGVKCITRIYTSHAVVDVSEGRFVLREKLAAMTLEELQAMTGAKLHIEGPVA
FT                   DLVVPEL"
FT   gene            complement(621003..621710)
FT                   /gene="pcaI"
FT                   /locus_tag="BMI_II635"
FT   CDS_pept        complement(621003..621710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaI"
FT                   /locus_tag="BMI_II635"
FT                   /product="3-oxoadipate CoA-transferase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II635"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49761"
FT                   /db_xref="GOA:C7LIC3"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIC3"
FT                   /protein_id="ACU49761.1"
FT                   /translation="MDKTIGSAAEAVAEIGDGATVMIGGFGGSGAPIELIHALIDKGSK
FT                   GLTVINNNAGNGRIGIAAMIDAGMVRKMICSFPRSSDPRAFTDRYLAGEIELELVPQGT
FT                   LAERIRAGGAGIPAFYTPTAYGTELADGKVIAEFDGRPYVQERWLKADFALVKAHLGDS
FT                   HGNLTYRMAARNFNPLMCMAAAKTIVQVSRIVPLGGIEPENVITPGIFVDRVVEIANPQ
FT                   QEEELIRAGVAYI"
FT   gene            621894..622664
FT                   /gene="pcaR"
FT                   /locus_tag="BMI_II636"
FT   CDS_pept        621894..622664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaR"
FT                   /locus_tag="BMI_II636"
FT                   /product="transcriptional regulator PcaR"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II636"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49762"
FT                   /db_xref="GOA:C7LIC4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIC4"
FT                   /protein_id="ACU49762.1"
FT                   /translation="MRETDFVGGFAKGLRVIEAFGEDRPRLSIADVSKITGLDRATARR
FT                   CLLTLAELGYAEYDGKFFMLLPRILRLGHAYLSGTPLPTIIQPHLDRLSQSVGESASAS
FT                   VLDGAEIVYIARASQMRVISINLMAGSRLPAYCASMGRVLLAWLDESEARTILEQTELR
FT                   ARTPFTQKDPEKLMEELRRIRAQGFAVNDQELELGLRSIAVPVFNHRGAVVAALNIGAP
FT                   VAHVEVSDLVGRILPEMLKIQSELRSMLRQRLFE"
FT   gene            complement(622671..623588)
FT                   /gene="pobR"
FT                   /locus_tag="BMI_II637"
FT   CDS_pept        complement(622671..623588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobR"
FT                   /locus_tag="BMI_II637"
FT                   /product="pobR protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II637"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49763"
FT                   /db_xref="GOA:C7LIC5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIC5"
FT                   /protein_id="ACU49763.1"
FT                   /translation="MRKRIPTYELYGEETDQKPDFWLHCETLYSRSSLHNFEISLHRHD
FT                   NFFQFLYVESGTGNVNFDGVLHSFRTPCAIIVPPNFNHGFAFSRNIVGHIVTVLQPQMP
FT                   FLESGFGTSTADWMMRPKLVQMEGADEADLAFLALTMRHIQSEYQSRKIHKNSMLESLL
FT                   KSSLVQIIRHALALQPEHDTWQSYREPRIERLLELIDRHFREHRPVSFYAGQLGLSATH
FT                   LNRLTRRVAGAPVQHMIARKLIDMARRDLVAMPSSVQHVAYSLGFSDPAYFSRFFQKMT
FT                   GETPRAFRLRERERLSASMPVTAQ"
FT   gene            623701..624870
FT                   /gene="pobA"
FT                   /locus_tag="BMI_II638"
FT   CDS_pept        623701..624870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="BMI_II638"
FT                   /product="4-hydroxybenzoate 3-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II638"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49764"
FT                   /db_xref="GOA:C7LIC6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIC6"
FT                   /protein_id="ACU49764.1"
FT                   /translation="MRTKVVIIGSGPAGLLLGQLLTRAGIDNVILDRVSENYILGRVRA
FT                   GVLEEGTVRLMDEAGASDRLHREGLPHDGFSLAFDGRDHRIDLHKLTGKRVTVYGQTEL
FT                   THDLMSERHRSGAHGIYEADNITPHDFDTASPYVTYEKDGITHRIDCDYIAGCDGYHGV
FT                   SRKSVPQKAIRIFEKVYPFGWLGVLADIPPVDHELIYANHERGFALCSMRSLTRSRYYI
FT                   QCALDEKVEDWSDERFYDELRRRLPAHHAEAMVTGPSFEKTIAPLRSFVAEPMRFGRLF
FT                   LAGDAAHIVPPTGAKGLNLAASDVHYLFEGLREFYIENSTAGIDAYSARALARIWKAER
FT                   FSWSMTKMLHRFPDMGPFDQKVQEAELDYFCNSQAASTALAENYVGLPF"
FT   gene            complement(625280..626188)
FT                   /gene="pcaQ"
FT                   /locus_tag="BMI_II639"
FT   CDS_pept        complement(625280..626188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaQ"
FT                   /locus_tag="BMI_II639"
FT                   /product="transcriptional regulator PcaQ"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II639"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49765"
FT                   /db_xref="GOA:C7LIC7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIC7"
FT                   /protein_id="ACU49765.1"
FT                   /translation="MIGNRIKFRHLHTFVEVARQKSVVKASEILNISQPAVTKTMRELE
FT                   EILGVPVLERDGRGIRITRYGEVFLRHAGTALTALRQGLDSVSQELDGSGPPIRIGALP
FT                   TVSTRIMPKAISLFLAEKTGSKVKIVTGENAVLLEQLRVGDLDLVVGRLAAPEKMTGFS
FT                   FEHLYSERVRFLVRAGHPLLDDDTIFDHLANYPVLMPTRNSIIRPFVERLLITNGVGSL
FT                   PTQIETVSDAFGRAFVRDSDAVWIISEGVAAHDVAEGKLVALPIDTSETTGPVGLTMRT
FT                   DMVQTAPLQILVQTIREAADH"
FT   gene            626281..627086
FT                   /pseudo
FT                   /locus_tag="BMI_II640"
FT                   /note="pcaL 3-oxoadipate enol-lactone hydrolase pseudogene"
FT   gene            627090..627506
FT                   /gene="pcaC"
FT                   /locus_tag="BMI_II641"
FT   CDS_pept        627090..627506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="BMI_II641"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II641"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49766"
FT                   /db_xref="GOA:C7LIC8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIC8"
FT                   /protein_id="ACU49766.1"
FT                   /translation="MAENATETAPSERYKLGMRVRRSVLGDTHVDRASNGATELDAPFQ
FT                   ALITEAAWGTVWARPGWSKRERSIVTIALLAALGQDDEVAMHIRATRNTGATKEDICEA
FT                   LMHVAIYAGVPASNHAFKIAKQTYAQMEAEEAEK"
FT   gene            627502..628242
FT                   /pseudo
FT                   /locus_tag="BMI_II642"
FT                   /note="PcaH, Protocatechuate 3,4-dioxygenase beta ubunit
FT                   pseudogene"
FT   gene            628244..628861
FT                   /gene="pcaG"
FT                   /locus_tag="BMI_II643"
FT   CDS_pept        628244..628861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="BMI_II643"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II643"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49767"
FT                   /db_xref="GOA:C7LIC9"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIC9"
FT                   /protein_id="ACU49767.1"
FT                   /translation="MVQPLGYLKETASQTAGPYVHIGLTPNFVGINGVFAEDLGTGPLY
FT                   NDKAHGERITIKGRVIDGMGAPLRDALVEIWQADAAGLYNSPSESRGKADPHFRGWGRC
FT                   PSNMETGEFIFETIKPGRVPFRDGRLMAPHVTLWIVARGINLGLQTRMYFSDEEAANAE
FT                   DPVLARIEHRMRVPTLIGQREGDVYHFDIHLQGEKETVFFDI"
FT   gene            628865..629929
FT                   /gene="pcaB"
FT                   /locus_tag="BMI_II644"
FT   CDS_pept        628865..629929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="BMI_II644"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II644"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49768"
FT                   /db_xref="GOA:C7LID0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:C7LID0"
FT                   /protein_id="ACU49768.1"
FT                   /translation="MSISVFEHPFLTGLFGDDEEISSLFTAYADIAAMLKFEAALAGAQ
FT                   ADLGIIPAHAAERIMSATETMEPDLAQLEHGTARDGVVVPALVRNLRKTVGEDVAAHVH
FT                   FGATSQDVIDTSLMLRLARVRDILVARIEQLSERFNWLETTFGQNDLTAYTRMQPAIST
FT                   TVADRVESWRAPFSDYAQRLAALQFPLQFGGAAGTLEKFVGKGAKLRAELAKRLGLEDR
FT                   PQWHSQRAFIADFGHLLSLVTGSLGKFGQDIALMAELRDEISLSGGGGSSAMPHKQNPV
FT                   RAELLVTLARFNAVQVSGLHQAMVHEQERSGTAWMLEWMILPPVVAATGAALKAALVLS
FT                   ENIVRMGKDRLPET"
FT   gene            630064..631236
FT                   /pseudo
FT                   /locus_tag="BMI_II645"
FT                   /note="amino acid ABC transporter, periplasmic amino-acid
FT                   binding protein pseudogene"
FT   gene            631409..632278
FT                   /locus_tag="BMI_II646"
FT   CDS_pept        631409..632278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II646"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II646"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49769"
FT                   /db_xref="GOA:C7LID1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7LID1"
FT                   /protein_id="ACU49769.1"
FT                   /translation="MQTVLSIAVDALAYGMVLFVISIGLSVTMGLMRVVNLAHGAFAMI
FT                   GGYFASYAAQQLGLNYGFAIIIAVVGTMIIAVPVERLLYRRIYGAPELTQVLMTIGVTF
FT                   CIIGITNYIFGPTLKTIPLPEMLRGSVDLGFRAIAKHRIFAIGCGLAVAVGLWYAVERT
FT                   AFGVKLRAAVDNANMAAALGVRTEIVYAVSFALAIGLAAFGGVVGAELLPVEPYYALRY
FT                   MVTFLVVVSVGGAGSIPGALVACLLLGAIDTTGRYLAPEYGEFFFYLAVIVIVTLFPRG
FT                   LAGRLARK"
FT   gene            632275..633261
FT                   /locus_tag="BMI_II647"
FT   CDS_pept        632275..633261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II647"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II647"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49770"
FT                   /db_xref="GOA:C7LID2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7LID2"
FT                   /protein_id="ACU49770.1"
FT                   /translation="MTELTQPLPQTRHSYAGLIGIVAIIAASVVGWFLFPDNLALLTRI
FT                   IAIALLVLSLDLVTGYCGIATLGHAALFGAGAYGAGIAAAHFGVTDPILMTVIGLLAGA
FT                   VTGLVSGAVILRATGLAQLVLSIAVVHLFHEAANKASGWTGGSDGLSGISPDPIFGIFE
FT                   FDLYGRTVYIYAVILLLISFIFLRYVVRSPFGMLCRGVKEDPIRIHAMGASVQGAQLRM
FT                   YVISGAVAGIGGALNAISTQVVGLDSLSFTMSAEALVMLVLGGAGSLFGGLVGTVVFMW
FT                   FEDVVSTANPFHWLTMVGALLIAVVLFAPRGLYGTLAYYFEKKARRK"
FT   gene            633258..634007
FT                   /locus_tag="BMI_II648"
FT   CDS_pept        633258..634007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II648"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II648"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49771"
FT                   /db_xref="GOA:C7LID3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C7LID3"
FT                   /protein_id="ACU49771.1"
FT                   /translation="MSTVFEVSKLRKNFGGLAVTNDVSLSMAKGDRVALIGPNGAGKTT
FT                   FVNLVTGNLAATSGTVTLGGENVSKLNAMQRVRRGLVRSFQVTRLFFDMTPEEHVALAI
FT                   LQREGKTGRILGNYRRMPQVMDEARDILHMLGLLPLAQLRVSEIAYGQQRLLEIALALA
FT                   LRPKVLLLDEPAAGVPQSDTGRIEEALDRLPPDLAVLMIEHDMDLVFRFAKRVVVLAAG
FT                   TVIFDGLPQAVVQDARVREAYLGSYAQ"
FT   gene            634004..634720
FT                   /locus_tag="BMI_II649"
FT   CDS_pept        634004..634720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II649"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II649"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49772"
FT                   /db_xref="GOA:C7LID4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LID4"
FT                   /protein_id="ACU49772.1"
FT                   /translation="MSAASLEIRNLSSGYGPTRVIEDVSFKAEPGSRLAILGRNGVGKT
FT                   SLFATIAGQTRRYGGEILLDGRNIATLPSAARALAGLGYVPQTRDIFPTLTVEENLFVG
FT                   LKNRPKDALEEAYAMFPRLKERRRNLGSQLSGGEQQMLSTARSILGQPTVLLLDEPLEG
FT                   LAPVICEELMAAFSALAQKGDMTILLVEQRIQSALDFADHVIILERGRIAWSGTAAELA
FT                   DNQQTVEELLGVGGLH"
FT   gene            complement(634721..636466)
FT                   /gene="ade"
FT                   /locus_tag="BMI_II650"
FT   CDS_pept        complement(634721..636466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ade"
FT                   /locus_tag="BMI_II650"
FT                   /product="adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49773"
FT                   /db_xref="GOA:C7LID5"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7LID5"
FT                   /protein_id="ACU49773.1"
FT                   /translation="MRHCDSFCELIPMKGCEAMLEWMIDQGAGREPADIVLKGGRFLDL
FT                   ITGELVESDIAICEDRIVGTFGTYRGKHEIDVSGRIVVPGFIDTHLHIESSQVTPHEFD
FT                   RCVLPQGVTTAICDPHEIANVLGAEGIRFFLDSALETVMDIRVQLSSCVPATHMETSGA
FT                   ELLIDDLLPFADHPKVIGLAEFMNFPGVLAKDPECMAKLRAFQGRHIDGHAPLLRGLDL
FT                   NGYIAAGIRTEHEATNAEEALEKLRKGMYVLVREGSVSKDLKALMPIITERHAQFLALC
FT                   TDDRNPLDIADQGHLDYLIRTAIAGGVEPLAIYRAASVSAARAFGLFDRGLVAPGQRAD
FT                   LVVVDSLEGCHAEIVLSAGRVVSEALFAARKPVAEVGRNSVKAPRVTASNFRSQSNSGK
FT                   TRAIGIVPGKIITQNLEFDLKVGPNGVEPDLERDVVKVAVIERHGKNGNIATGFVHGFG
FT                   LKAGAIASTVSHDSHNICVVGASDEDIATAANRLGEIEGGFVVVRDGKVLAEMPLPIAG
FT                   LMSTEPYETVREALRKLRHAAEDLGSVLEEPFLQLAFIALPVIPHLKITDRGLVDVDKF
FT                   EFVGN"
FT   gene            636625..637665
FT                   /locus_tag="BMI_II651"
FT   CDS_pept        636625..637665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II651"
FT                   /product="Zn-dependant dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II651"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49774"
FT                   /db_xref="GOA:C7LID6"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7LID6"
FT                   /protein_id="ACU49774.1"
FT                   /translation="MATEQTIKVFDGHNDVLLRLWSSNQPEPENRFLEGESSGHIDLPR
FT                   ARKGGLGGGLCAVYVPSPSHDLDADGNLPTPSQQDALKTTLAMSAILQNIERKSEGQVR
FT                   ICRTAADIRDAFAKDIFASVYHIEGVEAFDADLDALYVLHAAGLRSLGPVWSRPNIFAH
FT                   GIPFRFPSSPDIGPGLTDHGKALIRACNELKVMIDLSHMNEKGFWDIAALSDAPLVASH
FT                   SNAHVLCQQSRNLTDRQLDAIRDTGGLVGLNFGVSFLREDGKHDPDTKLEELVRHADYI
FT                   VGRIGIDHVAFGSDFDGTIISSTLRDVADLQLVIETFRKHGYDDASLVKLAHGNWIDVL
FT                   ERTWGK"
FT   gene            637998..639299
FT                   /gene="ugpB"
FT                   /locus_tag="BMI_II652"
FT   CDS_pept        637998..639299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpB"
FT                   /locus_tag="BMI_II652"
FT                   /product="glycerol-3-phosphate ABC transporter, periplasmic
FT                   glycerol-3-phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II652"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49775"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C7LID7"
FT                   /protein_id="ACU49775.1"
FT                   /translation="MFTRLITTSALTGAIALTIGSQAFAQTELAWWHGMTGANNEMVNE
FT                   LSKEFNESQSEYKIVPVYKGNYPETLNAGIAAFRSKQPPAILQVFDAGSGVMMAAEGAI
FT                   VPAAEVLEKGGYKFDKSQYLPGIVAYYSKPDGTMLSFPYNSSSPILYYNKDAFKKAGLD
FT                   ENKPPKTWPEVFEAAKKIKASGASPCGFTSTWLTWIQTENFAAWNNVPYGTNENGLAGT
FT                   DVKLEINSPLYVEHFQAIADLAKDGTFRYGGRTSEAKQLFTSGECAMLTESSGGLGDVV
FT                   KSGINYGIGQLPYYEGHGPQNTIPGGASLWVFAGLSDDQYKGIAEFFNFLSQTKIQVKL
FT                   HEKSGYLPVTLAAYEETKKSDFYEKNPGRETPILQMMGKEPTENSKGVRLVNLPQVRDI
FT                   LNEEFEAMLGGKQDAKTALDNAVKRGNAAIAAAQ"
FT   gene            639372..640253
FT                   /gene="ugpA"
FT                   /locus_tag="BMI_II653"
FT   CDS_pept        639372..640253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpA"
FT                   /locus_tag="BMI_II653"
FT                   /product="glycerol-3-phosphate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II653"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49776"
FT                   /db_xref="GOA:C7LID8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LID8"
FT                   /protein_id="ACU49776.1"
FT                   /translation="MQKVTFPNKILPYFLLAPQIVLTVVFFFWPASQAIYQSFMREDAF
FT                   GLKSTFVELANFTAVLSDPNYLHSVQVTVVFNVLTALLAMGVALLLATAADRVIRGQTF
FT                   YRTLLIWPYAVAPAVAGMLWLFMFNPAMGTFAYLLRRNGIAWDPLLDGNQAMGLVVVAA
FT                   AWKQISYNFLFFVAGLQAIPKSLIEAAAIDGARGARRFWTIVFPLLAPTSFFLLVVNTV
FT                   YAFFDTFGIIHAVTGGGPAKATETLVYKVYNDGFVNLNLGSSSAQSVILMAIVIALTAF
FT                   QFRFVEKRVHYS"
FT   gene            640265..641113
FT                   /gene="ugpE"
FT                   /locus_tag="BMI_II654"
FT   CDS_pept        640265..641113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpE"
FT                   /locus_tag="BMI_II654"
FT                   /product="glycerol-3-phosphate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II654"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49777"
FT                   /db_xref="GOA:C7LID9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LID9"
FT                   /protein_id="ACU49777.1"
FT                   /translation="MIEQRPVSNLIGHLILILGIIIVAFPIYYTFVASSMTSTQIIRPP
FT                   ISLLPGDHLVENYREAIFGGVERVVGVSLERLLWNSFVVAMAIAVGKIIISFMSAFAIV
FT                   FFRFPMRMFFFWMIFITLMLPVEVRILPTYKVIVDLGMIDTYAGLTLPLMASATATFLF
FT                   RQFFLTIPGELVEAARIDNAGPFRFMRDILLPLSKTNIAALFVILFIYGWTQYLWPLLV
FT                   TNDAKMNTIIIGLRRMVDWADASTPWNYVMVTAILAIIPPILVVVLMQRWFVKGLVETE
FT                   K"
FT   gene            641113..642168
FT                   /gene="ugpC"
FT                   /locus_tag="BMI_II655"
FT   CDS_pept        641113..642168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="BMI_II655"
FT                   /product="glycerol-3-phosphate ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II655"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49778"
FT                   /db_xref="GOA:C7LIE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIE0"
FT                   /protein_id="ACU49778.1"
FT                   /translation="MSKIVLDNVRKSYGGNIEVIKGVSLEIADGEFVVLVGPSGCGKST
FT                   LLRMIAGLESITSGTISIGERVVNNVEPAERDIAMVFQNYALYPHMTVRENLAYGLKNR
FT                   KTPKEEIERRIAKAAKALEIEQFLERKPRQLSGGQRQRVAMGRAIVREPAAFLFDEPLS
FT                   NLDAKLRVQMRVEIKRLQRSLGTTSVYVTHDQMEAMTMADRLVVLNAGHIEQVGTPIEL
FT                   YEKPASTFVATFIGSPSMNLLQSPESAAWQPGRAITLPSGGYTFGVRPEDIRILEEGDQ
FT                   DADGFNAQVRIEAVELVGAESYIHAALSDGKPLIFRVAGRSTHDIDEMVRVGASATDVH
FT                   IFGADGRRVSD"
FT   gene            642341..643692
FT                   /pseudo
FT                   /locus_tag="BMI_II656"
FT                   /note="transporter, TrkA family, pseudogene"
FT   gene            complement(643770..644369)
FT                   /locus_tag="BMI_II657"
FT   CDS_pept        complement(643770..644369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II657"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II657"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49779"
FT                   /db_xref="GOA:C7LIE1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIE1"
FT                   /protein_id="ACU49779.1"
FT                   /translation="MQPEELNLLERLIDVIEQDIIPLTERGVAEGNKVFGAALLRKSDL
FT                   SLVLAETNNETENPLWHGEVHTLKRFYEMPEKERPDTKDMVFLSTHEPCSMCLSAITWS
FT                   GFDNFYYLFSHEDSRDAFSIPHDLKILKEVFTLEPGGYNRDNAFWHSHSIPKMVASLAE
FT                   PDRSRLEKRLNAIRARYDAMSGTYQAGKEGNAIPLS"
FT   gene            complement(644430..645722)
FT                   /locus_tag="BMI_II658"
FT   CDS_pept        complement(644430..645722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II658"
FT                   /product="uracil-xanthine permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II658"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49780"
FT                   /db_xref="GOA:C7LIE2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIE2"
FT                   /protein_id="ACU49780.1"
FT                   /translation="MFEKLFKLQEHGTSARTEIIAGVTTFLTMSYIIFVNPDILSTTGM
FT                   DRNAVFVATCLAAALGSIIMALVANWPIGMAPGMGLNAFFAFTVVGAMGFSWQQALGAV
FT                   FISGVIFLLLTVTGVRRWLVDGIPHSLRSAIAAGIGMFLALIGLKSAGVVVGNQATLVG
FT                   MGDLTQSGPLLAIAGFFIIAILDALKVRGAILIGILVITVASIALGISQFGGIFSAPPS
FT                   LAPTFLQLDIMGALHTGILHVILVFVLVEVFDATGTLIGVAKRGGLIETGKPNNLGRAL
FT                   FADSGAILAGSLIGTSSTTAYVESAAGVQAGGRTGLTALVVGILFLAALFISPLAGSVP
FT                   AYATAPALVYVACLMMRELTEIEWHEVTEAAPAALTALAIPFTYSIANGLAFGFISYVV
FT                   MKTFTGKVREIHAATWLVAALFVIRFAFFAE"
FT   gene            complement(645991..646155)
FT                   /locus_tag="BMI_II659"
FT   CDS_pept        complement(645991..646155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II659"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49781"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIE3"
FT                   /protein_id="ACU49781.1"
FT                   /translation="MPEAARRSPLAVFYLNLFQIFPDKWELACARKSVHTEAFPAKLRS
FT                   GFALENATK"
FT   gene            complement(646160..646771)
FT                   /locus_tag="BMI_II660"
FT   CDS_pept        complement(646160..646771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49782"
FT                   /db_xref="GOA:C7LIE4"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIE4"
FT                   /protein_id="ACU49782.1"
FT                   /translation="MLSIFSCVAACFLHIFSGRPPRIPCRALLNGSNFYLSGGIGMIDL
FT                   IWRGILIGIGATVVMDIWAQLLALLPGQSRPKWGLVGRWFWHLRHGQIFHDDISQSEPC
FT                   RHEVALGWIGHYAVGILYGVIFALYGGAAWFANPIFLPAWIFGILTIAAGWFLLQPGLG
FT                   IGWAASKLPNAGNVRILNLIAHTFFSLGMYGTALILLNTV"
FT   gene            646831..647013
FT                   /locus_tag="BMI_II661"
FT   CDS_pept        646831..647013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II661"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49783"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIE5"
FT                   /protein_id="ACU49783.1"
FT                   /translation="MSHLEARFDLIESDRNAEHAGRKGLKQQKRQDWRPTLSLLYFKFI
FT                   PDFKFNPGGLSKAAP"
FT   gene            complement(647017..647154)
FT                   /locus_tag="BMI_II662"
FT   CDS_pept        complement(647017..647154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II662"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49784"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIE6"
FT                   /protein_id="ACU49784.1"
FT                   /translation="MNIRQKVMQYVSRRRALRELGAMDDHLLADIGVSRSQIQSAVFGR
FT                   "
FT   gene            647413..648330
FT                   /locus_tag="BMI_II663"
FT   CDS_pept        647413..648330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II663"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49785"
FT                   /db_xref="GOA:C7LIE7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIE7"
FT                   /protein_id="ACU49785.1"
FT                   /translation="MLYGILLAFASYAAFAVSDACVKFLDGTLSPYEIAFYGAVLGLLA
FT                   IPFTKKADDAWLDMFRTGNIKMWLLRTVTAAMGVIGSVAAFTYLSMAEAFALIFLLPAY
FT                   VTILSVIFLKEQVGWRRWSAVAIGFAGVLVVLRPGFRELSIGHLGALAAGMGGATSIII
FT                   FRVMGKNEKRISLYTSGLVGPILICGALMAPSYQAPGTMQWVYLAGYGLLAALANILLM
FT                   LAAQRAPASAIASPQYSQMIWAILFGYFVFHDHIDMPMLIGIVLITISGLFTFIRERQR
FT                   GVEGPPAVAAEPTPALVQEKAGYF"
FT   gene            648257..649303
FT                   /locus_tag="BMI_II664"
FT   CDS_pept        648257..649303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II664"
FT                   /product="Aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II664"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49786"
FT                   /db_xref="GOA:C7LIE8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIE8"
FT                   /protein_id="ACU49786.1"
FT                   /translation="MWKARPPSRQSRHRLWSKKKRGISEAQNEDKFPLVSALPHPYDTA
FT                   AFLTEAACTTPILLQGTREMTDTRAMWTYYKGEWREGDVRILGAASQATWLGSLVFDGA
FT                   RLFEGVTPDLDRHSARANDSARALGLEPTLSANDIEALAREGLKKFAPDTDVYIRPMYW
FT                   AEEGDASTVAPLASSTDFALCLEAIPMVEPKGFTITTTSFRRPYLEVMPVNAKAACLYP
FT                   NNARMLREAKAKGFHNALVTDVLGNVAETATSNVFMVRGGEVFTPVPNGTFLNGITRQR
FT                   VIKLLREAGVSVHETTLKIEDFREADEIFSTGNMSKVVPIIGFDERKLDYGLVTKRARA
FT                   LYWEWAHA"
FT   gene            649288..649479
FT                   /locus_tag="BMI_II665"
FT   CDS_pept        649288..649479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II665"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49787"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIE9"
FT                   /protein_id="ACU49787.1"
FT                   /translation="MGPRLTAINRNQSPGQNPEISCKGFRFNKTVRSTPMIYFQALPDA
FT                   RPSHAFAGDAMNQLLPAR"
FT   gene            649476..650237
FT                   /locus_tag="BMI_II666"
FT   CDS_pept        649476..650237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II666"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49788"
FT                   /db_xref="GOA:C7LIF0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIF0"
FT                   /protein_id="ACU49788.1"
FT                   /translation="MIEHTPLFLTVAVIAAFLVGLSKGGLPTVGTLSVPLMALVISPVT
FT                   AAALLLPIYVVSDMFGLYLYRHHFSARNLAILTPSAIVGVGIGWLFSSHLSSTFIGMLV
FT                   GLVGLLFCFNAWVGARYRKKTRKADIPGGIFWGILTGLTSFVSHSGAPPFQMYVLPQHL
FT                   EKLVFAGTSTILFAIVNAVKLVPYWELNQFSNLDLSLGLWLVPAAVIGTYAGAIFTRIM
FT                   PDGPFFLLVQLTLFGLSIKLVADWIVPFFFA"
FT   gene            650309..651964
FT                   /locus_tag="BMI_II667"
FT   CDS_pept        650309..651964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II667"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49789"
FT                   /db_xref="GOA:C7LIF1"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014614"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIF1"
FT                   /protein_id="ACU49789.1"
FT                   /translation="MADADAIIIGAGLAGLAAAHELAGAGKKVILLEQEGENSIGGQAF
FT                   WSLGGLFMIDSPEQRRLGVKDNLELARQDWFGSAQFDRPEDHWPKQWAEAYLQFAAGEM
FT                   RPWLHSLGMRWFPVVGWAERGGSHAHGHGNSVPRFHVTWGTGPGVVAPFERLLREAMHQ
FT                   NLVTLKCRHRVNGIVTTNGRISGVHGDVLAPSSVERGQPSSREVIGDFEFSAGNIIVTS
FT                   GGIGGDPERVRRAWPRERLGNPPEDMVLGVPAHVDGRGIDIAVAAGGHVINGDRMWHYT
FT                   EGLRNWNPIWPNHGIRILPGPSSMWFDAQGNRLPAPCLPGFDTLATLKHILSTGYGYSW
FT                   FILTEKIIRKEFSLSGSEQNPDLTGKDWKLLVKSRLGKTPPQPVKAFIDKGEDFITAQT
FT                   LEELVAGMNRLTGENLLDAAHIRTQIEARDREIANRYSKDAQIMAIRNARAYLGDRLTR
FT                   AVPLHALLDPANGPLIAVKLHILTRKTLGGLHTNLQSAVLDASGKPVPGLYAAGEAAGF
FT                   GGGGYHGYNALEGTFLGGCIFSGRAAGRAAASTI"
FT   gene            651973..652497
FT                   /locus_tag="BMI_II668"
FT   CDS_pept        651973..652497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II668"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49790"
FT                   /db_xref="InterPro:IPR022254"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIF2"
FT                   /protein_id="ACU49790.1"
FT                   /translation="MQSWRGHGFRGKGLNPNVAPEQTVFAQRSIYSNEGDGRRIMVELA
FT                   NNIENLEFIISKAREYDVQVPAVDEDSGSNPGDDRDVDILDASIGNPTRKELFAAISSL
FT                   NEDERIELLALMWVGRGDFSATEWEEALSTASERHNGREAKYLIGTPLLGDYIEEGLVA
FT                   LGFDVETYDNE"
FT   gene            652710..654068
FT                   /locus_tag="BMI_II669"
FT   CDS_pept        652710..654068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II669"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II669"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49791"
FT                   /db_xref="GOA:C7LIF3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIF3"
FT                   /protein_id="ACU49791.1"
FT                   /translation="MNPADEKPYAVISAGSAADIDLAVAAARRAFPAWSETPAEERIAY
FT                   IRRIAEIYESRLDEMAKTISMEMGAPIKLARESQAAAGLSHTKAFIAACENFEVEEVLS
FT                   PKYPNQTVVHEPIGVCGLITPWNWPMNQITLKVIPAIAVGCTVVLKPSEIAPMSAMLFA
FT                   EFVDQAGLPKGVFNLVNGEGPVVGEALSQHPEVDMMSFTGSTRAGTAVSRAAAATVKRV
FT                   SLELGGKSPNIVFADSDLEKAISRSLAHCFENTGQSCNAPTRMLVERSVYDKAVELAKK
FT                   AAESTKVGDPAQEGDHIGPLSSSIQFEKVQALIQKGIDEGARLVAGGTGRPEGFTEGDY
FT                   VKPTVFADVNNNMTIAREEIFGPVLAMIPFDTEEEAIAIANDTPYGLAAYIQTGSPERA
FT                   KRVARKLRAGMIQINGTSRAPGSPFGGYKQSGNGREGGKWGLEDFMEVKLISG"
FT   gene            654377..654487
FT                   /locus_tag="BMI_II670"
FT   CDS_pept        654377..654487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49792"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIF4"
FT                   /protein_id="ACU49792.1"
FT                   /translation="MLERCHLQYFRQATEDSIALILMRRSPKPMQEHTKN"
FT   gene            654546..655493
FT                   /locus_tag="BMI_II671"
FT   CDS_pept        654546..655493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II671"
FT                   /product="iron compound ABC transporter, periplasmic iron
FT                   compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II671"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49793"
FT                   /db_xref="GOA:C7LIF5"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIF5"
FT                   /protein_id="ACU49793.1"
FT                   /translation="MKGSNIMLTFRQKITRLCGVAAMALALSSAAYAADITVKHAQGET
FT                   AVPASPEKVVVFDLASLDNLDRLGVKVTGVPSGVPFPEYLKKYQGDDYAKVGTLFEPDY
FT                   EAVNAAEPDLIIVGGRSAAKYAALKKIAPTVDLTVDARNFIADTEANIEKLGQIFGKEA
FT                   EAKAEAEKLNKELAALHEKAAGKGTGLLILTSGGKISAYGPGSRFGVLHDSFGVKPAAP
FT                   NISIGNHGQPISSEFILETNPDWLFVIDRDAAIGREGNSAKQLLDNELVRQTNAWKKDQ
FT                   VVYLDAQNWYLVGGGFSALHNTIRQLSEAFDKSK"
FT   gene            655550..656512
FT                   /locus_tag="BMI_II672"
FT   CDS_pept        655550..656512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II672"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II672"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49794"
FT                   /db_xref="GOA:C7LIF6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIF6"
FT                   /protein_id="ACU49794.1"
FT                   /translation="MKGLAAAVIVVAVLAVISLFIGVSDVSLHTLFGKASTDRATEVLL
FT                   ISRIPRTLAIILAGMSMAVAGMIMQMLTRNRFVEPSTAGTVESASLGILLVILFAPETP
FT                   VFGKMLVASVSALAGTALFLRILRSIPLRSVLVVPLVGIMLGGVINAITTFIAYRFDLL
FT                   QSLNSWTTGDFSGVLRGRYELLWIAFALTVVAYVAADRFTVAGLGEDFTTNLGLNYRRV
FT                   VTLGLVIVSMVSASVVVTVGMIPFLGLIVPNVVSMFIGDNMRRAVPWVALLGAGLVLAC
FT                   DIVGRLIRFPYEIPIGTMMGVVGSAIFLYLLLRRGSRLA"
FT   gene            656505..657458
FT                   /locus_tag="BMI_II673"
FT   CDS_pept        656505..657458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II673"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II673"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49795"
FT                   /db_xref="GOA:C7LIF7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIF7"
FT                   /protein_id="ACU49795.1"
FT                   /translation="MHKRPAIVIALLGALTLLACVAFMTLGAKGSWSFVLSFRGTKLAA
FT                   MVLVAYSVAVSTVLFQTVTNNRILTPSIMGFDALYILIQTLVVFFFGAVQIDWLGPNAR
FT                   FLAETAIMVVFAGTLYYWLFSGAARSLHLIMLVGIVCGVFFRSISNLMQRMLDPNLFAI
FT                   LQDRFFASFNAINADILVISAIVVAAVSLYGLRYLYVLDVLSLGRDPAINLGVDHARVV
FT                   RKILFIVTVLVSVSTALVGPITFFGLLVANLAYMISGSARHRIVLPVAVLLAVLCIVGG
FT                   QTLLERVLAFNTALSVIIEFLGGLFFIILLVRGNAR"
FT   gene            657455..658213
FT                   /locus_tag="BMI_II674"
FT   CDS_pept        657455..658213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II674"
FT                   /product="iron compound ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II674"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49796"
FT                   /db_xref="GOA:C7LIF8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIF8"
FT                   /protein_id="ACU49796.1"
FT                   /translation="MIEISQVSKSYNGTLVVDDVTLRLPARGITSIIGPNGAGKSTLLS
FT                   MVSRLLPMDKGSVTVDGLDITTTSGDVLARRLSILRQENAINSRLTVRDLVTFGRYPYS
FT                   KGRPNSEDRKHVEQAIGYLGLEGLSERFLDELSGGQRQRAFVAMVLCQDTDYVLLDEPL
FT                   NNLDMKHSASMMKLLRRAADELGKTIVLVLHDINFASCYSDHIVAMRHGKVVHQGSPDE
FT                   LIHPEILGEIYEMEIGVEIIGGKRIGVYYL"
FT   gene            complement(658266..658865)
FT                   /locus_tag="BMI_II675"
FT   CDS_pept        complement(658266..658865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II675"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49797"
FT                   /db_xref="GOA:C7LIF9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIF9"
FT                   /protein_id="ACU49797.1"
FT                   /translation="MRKTGDGPEAPVDPREAGFEDVTLPKHLRPVASIGPIVSSAHLAE
FT                   GGSPAMSEVEYGLILASHAFSRWMVRCMAAAGLPGLSPIEILILHSIRHRDREKKLADI
FT                   CLVLDIEDTHIATYAIRKLEKAGLLTTGKAAKEKTVKITAKGAEACAHYAQIRERLLVD
FT                   STANARPSEETLSELAALLRFMSGAFNQATRSAITL"
FT   gene            658988..662614
FT                   /locus_tag="BMI_II676"
FT   CDS_pept        658988..662614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II676"
FT                   /product="N-methylhydantoinase (ATP-hydrolyzing) /
FT                   5-oxoprolinase"
FT                   /EC_number="3.5.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II676"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49798"
FT                   /db_xref="GOA:C7LIG0"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIG0"
FT                   /protein_id="ACU49798.1"
FT                   /translation="MREPMMSAAWDFWIDRGGTFTDVIGRDPEGHLHARKVLSENPSAY
FT                   KDAAVHGIRLHLGLKTGEPVPAGIIGEVRMGTTVATNALLERKGERLALVTTKGFRDAL
FT                   KIGYQERKNIFATEIIKPEALYDKVVELDERVRADGTVEKALALAEAEKALRALKAEGY
FT                   KSIAIALMHAYKFPAHEIEIARIARDLGFEQVSVSHEVSPLIKLVGRGDTTVVDAYLSP
FT                   VLRRYVAQVSDELNVERTGARVMFMMSSGGLTAADLFQGKDAILSGPAGGVVGLARTGE
FT                   TAGFGQVIGFDMGGTSTDVAHFDGEYERAFETEVAGVRVRAPMMLIHTVAAGGGSILHY
FT                   EAGRFRVGPDSAGANPGPACYRNGGPLAVTDANVMLGKLLPEFFPAIFGPQQNQPLDVA
FT                   RVRELFTALAGEIGDGRSPEAVADGFIRIAVANMVEAIKKISVQRGYDVTRYALNCFGG
FT                   AGGQHACLVADALGMKNILLHPMSGLLSAYGMGLADIRATRQKALGVALDPAAPKALKE
FT                   LGEELADECVAELAAQGIETDAMKQHLRAHIRYAGTDTALSIEATFPAEDDAARLRAEF
FT                   EAAHKRRFGFIAENKALVIDAVEVEAVGGGAGETENAQSLDSDQEAKPAKLTRFFSQGE
FT                   FHEAGVVLREAMQRGQTVTGPAIIIEKNQTIVIEDGWQARLTAHDHVVLTRIKAPPART
FT                   AIGTEADPVMLEIFNNLFMSIAEQMGVTLQNTAYSVNIKERLDFSCAVFDAEGNLVANA
FT                   PHMPVHLGSMDASVATAIRENKDIKPGDVFLINAPYNGGTHLPDLTVCTPVFDDAGHQI
FT                   RFWVASRGHHADIGGIAPGSMSPLAVNIEQEGVYIDNFKLVDRGTFREEALAALLTGAT
FT                   YPVRNLTQNVNDLKAQIAANEKGVAELKKMIGLFGEDVVKAYMGHVQDNAAESVRRVLD
FT                   RLPDGHFIYEMDQGCQIEVRVTIDREKREATVDFTGTSEQRPDNFNAPEPVTRAAVLYV
FT                   FRVLVEGDIPMNAGCLRPIRIIVPQGSMLSPRYPAAVVAGNVEVSQAVTNCLFGATGAM
FT                   AAAQGTMNNLTFGNDEYQYYETICSGAPAGPGFNGADAVHTHMTNSRLTDPEILETRFP
FT                   VLLEDFHIRKGSGGKGKWHAGDGTRRTIRALEKLDFAILSGHRRVRPFGLKGGKPGETG
FT                   RNEVCRKDGSVEVLKGCDQTLLEAGEAFTVITPTGGGYGEPE"
FT   gene            662900..663673
FT                   /locus_tag="BMI_II677"
FT   CDS_pept        662900..663673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II677"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II677"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49799"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIG1"
FT                   /protein_id="ACU49799.1"
FT                   /translation="MKFAQILATAGIIQAVLFTGAMAGENLDAIKSAGVLKIGTEGTYA
FT                   PFTYHDKDNKLVGFDVEIGEAIAGKLGVKPEFVEGKWDGLIAGLDANRYDAVINQVGIT
FT                   EERKKKFNFSNPYIVSKVVLIVNDKNDTIKDFADLKGKKAAQSLTSNYGRLAKEAGAKL
FT                   VATDGFDQSIQLVLTGRADATLNDSLSYLDFRKHQPKAPVKVVAEKDEATASGIIVRKG
FT                   DDELVAAINKALDEIKADGTYDKISQKYFGQDVSK"
FT   gene            663853..664533
FT                   /locus_tag="BMI_II678"
FT   CDS_pept        663853..664533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II678"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II678"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49800"
FT                   /db_xref="GOA:C7LIG2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIG2"
FT                   /protein_id="ACU49800.1"
FT                   /translation="MPDWLQLMADSLPTLLWAGLIFTIPLTLLSFTFGLALGLLTALVR
FT                   LFAPVWLSSVARFYVWIFRGTPLLVQLFVIFYGLPSIGIYLDAFPAALIGFTLNIGAYS
FT                   SEIIRAVISSVPKGQWEAAYSIGMSWRQALIRTILPQATRTAVPPLSNTFISLIKDTSL
FT                   AAAITVPELFQSAQRIVATTYEPLILYIEAALIYLALSSILSALQVRLERRFGRYGGTL
FT                   ETNA"
FT   gene            664530..665291
FT                   /locus_tag="BMI_II679"
FT   CDS_pept        664530..665291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II679"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II679"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49801"
FT                   /db_xref="GOA:C7LIG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIG3"
FT                   /protein_id="ACU49801.1"
FT                   /translation="MIELQHIVKRFDDAVILNDINITIAEGTVTALVGPSGGGKSTLLR
FT                   CINLLEIPTSGTLLLGGQSITFEPNRKPSWQTIQSIRRQTGMVFQNFQLFPHQTAIQNV
FT                   MEGLVTVLKWPKNKARERAMELLTKVGMAHKADAWPSTLSGGQQQRIAIARALAPSPRV
FT                   LLCDEPTSALDPELASEVVDVLSKLAQEGTTMVIATHDLRLASKIAKNVVFLETGNVVE
FT                   TGSAHDVFTHPTRERTKQFVATINAAHSYDI"
FT   gene            665533..667029
FT                   /locus_tag="BMI_II680"
FT   CDS_pept        665533..667029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II680"
FT                   /product="phosphatase, Ppx/GppA family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49802"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIG4"
FT                   /protein_id="ACU49802.1"
FT                   /translation="MHQGASGGRSGTIQARNPSEGGKRKLRKNAAAEAGNARSAPDSGR
FT                   PKTQNEAEAKGSPGQRKRARRRHRGKASRGTEAASAKPPAAEAAHAEARPCGKISNRRR
FT                   RARKKKQQARQQNGQPAHVAESAAKAAHHTPRTENHAPAPQAKRKAGTPQPARHAHGEA
FT                   PLYAALDLGTNNCRLLVASPTRPGQFRVVDAFSRIVRLGEGLSTTGALSDNAMHRAVEA
FT                   LKICRDKLAGKKIRRSRLIATEACRSAANGEEFLARVREETGLELEIVDRQTEARLAVS
FT                   GCGTLVTPDTDAVVLFDIGGGSSEIALIDVSQRRSPRLAEHITAWTSLPVGVVTLAERF
FT                   GGRNVTEESFGAMVDHVTELLSRFAERNCLGPLAASPRFHLLGTSGTVTTLAGIHLGLE
FT                   RYDRRRVDGMWMGADDVTQMTNRLLSWDFEARVANPCIGADRADLVLAGCAILDAIRKV
FT                   WPSEKLLVADRGLREGILTELMSRDGAWRHNRASGARNRH"
FT   gene            667106..667753
FT                   /gene="rrmJ"
FT                   /locus_tag="BMI_II681"
FT   CDS_pept        667106..667753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrmJ"
FT                   /locus_tag="BMI_II681"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II681"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49803"
FT                   /db_xref="GOA:C7LIG5"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIG5"
FT                   /protein_id="ACU49803.1"
FT                   /translation="MRVKKKAGTIKESSRRWLERHLNDPYVHKSRQDGYRSRAAYKLIE
FT                   INDRYNLLKKGQKIIDLGAAPGGWSQIAARIVGSTDENPQVVGIDYLHVDPLPGVILLE
FT                   MDFLDDEAPQKLMDALGDKPDLVISDMAAPTTGHRRTDHLRTVHLCEVAADFAVSVLKP
FT                   GGHFLTKTFQGGTENELLALLKQKFRSVHHVKPPASRAESVELYLLARDFKG"
FT   gene            complement(667952..669361)
FT                   /locus_tag="BMI_II682"
FT   CDS_pept        complement(667952..669361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II682"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II682"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49804"
FT                   /db_xref="GOA:C7LIG6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIG6"
FT                   /protein_id="ACU49804.1"
FT                   /translation="MNRIIPLVLAIALFMEQMDSNVISTSLPAIAADIGTSPIALKLAL
FT                   TAYLVALAVFIPVSGWMADRFGAKNVFRAAIAVFVVGSIACAASNSLPAFVIARFLQGM
FT                   GGAMMTPVGRLVLIRSTPRNELVSAMAWLTIPAMVGPLVGPPVGGFITTFLTWHWIFLI
FT                   NVPIGMIGIWFATHFLPDNEERIIKRLDWPGFFLSGFAMSGVVFGLSVVSLPALPPVIG
FT                   FATLAVGMLCTVLYVLHARRTPDPLLNLRLFDNQVFRSAVFGGSIFRFGIGAIPFLLPL
FT                   MFQLGFGLTPFQSGMMTFVSAIGAISMKFGAKRIFTRISFRRALMGGSLISAAFIAVNG
FT                   TFTPATPYWIIIGFLLVGGFARSLFFTGVNALAFAEIPNEKTSQATPLTAVAQQVSIAI
FT                   GVALAGGILEISTMLRGAPLALVDFHIGFFVVACVSVLAFFWFARLAPDAGKELATPSV
FT                   TRHHGKPVTTA"
FT   gene            complement(669407..669688)
FT                   /pseudo
FT                   /locus_tag="BMI_II683"
FT                   /note="pseudogene corresponding to BRA0688 in B. suis
FT                   (hypothetical protein)"
FT   gene            complement(669922..671043)
FT                   /gene="malK"
FT                   /locus_tag="BMI_II684"
FT   CDS_pept        complement(669922..671043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malK"
FT                   /locus_tag="BMI_II684"
FT                   /product="Maltose/maltodextrin import ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II684"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49805"
FT                   /db_xref="GOA:C7LIG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIG7"
FT                   /protein_id="ACU49805.1"
FT                   /translation="MNMSFLKITDLYKSYGSVSVLKDINIEIDEGGFLVLVGPSGCGKS
FT                   TLLNTIAGLEPITSGDIAINGKSVSNLHPSQRDIAMVFQSYALYPNMTVAGNIAFGMEI
FT                   RKVPKPERDKAIQQVADMLQIGHLLDRKPSQLSGGQRQRVAMGRALVRNPQVFLFDEPL
FT                   SNLDAKLRVDMRTEIKRLHSRMKTTIVYVTHDQIEAMTLATKIAVLKDGVLQQFGTPAE
FT                   IYNNPANMFVADFMGSPAMNLLPVKVEKSGSDYAITLDQGEGEVLKLPLKAVPQGLAQY
FT                   VGKEVVFGIRPEALTDPDGADRNAASIVEGDCLIDVVEPAGSDTFAVTRLGGKHVVARL
FT                   RADARIRAGQSARLAFNLDKSVFFDSASQTRIL"
FT   gene            complement(671056..671937)
FT                   /locus_tag="BMI_II685"
FT   CDS_pept        complement(671056..671937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II685"
FT                   /product="sugar ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II685"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49806"
FT                   /db_xref="GOA:C7LIG8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIG8"
FT                   /protein_id="ACU49806.1"
FT                   /translation="MSVQSQDNAIKSGKLTRALIYSALIFFAFYYLLPLYVMLVNSFKP
FT                   LEEIRQGGMLNLPQQWTIEPWLSAWSTAQIGVQPTGLKPFFINSILMVVPAVAISTIVG
FT                   ALNGYVLTKWRFRGSNIFFGLLLLSCFIPFQIVLIPMARVLGILGIAGTIWGLILVHVV
FT                   YGLGFTTLYFRNYYEAFPTELVRAAQIDGASFFQIFWRILLPSSGPIIVVSVIWQFTNI
FT                   WNDFLFGASFSGAHSTPMTVALNNLVSSSTGVKEYNVHFAGAILAALPTLIVYIVSGRY
FT                   FVRGLMSGAVKG"
FT   gene            complement(671934..672983)
FT                   /locus_tag="BMI_II686"
FT   CDS_pept        complement(671934..672983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II686"
FT                   /product="sugar ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II686"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49807"
FT                   /db_xref="GOA:C7LIG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIG9"
FT                   /protein_id="ACU49807.1"
FT                   /translation="MPICPPHHPRRVSWDIELFRLKRNRRNRSNYLFCRIFQRKTVSHF
FT                   WLENALDKVAHMQRNNRLQALVPKLVLGPSFLIVLVFVYGFIIYTGVLSLTNSRMLPSY
FT                   GFVGLTNYTKLWALPHWWRAITNLAIFASLYIIICSVIGLFLAILLDQKIRGEGILRPI
FT                   YLYPMALSFIVTGTAWKWFLDPGIGLEHTMHLWGWESFSFNWIKSNTMAIYCLVIAAVW
FT                   QSSGFVMAMFLAGLRGVDNEIIKAAQIDGASTGTIYRRIIIPLMRPVFLSAFVVLAHLA
FT                   IKAYDLVIALTGGGPGQATELPATFMYSYTFTRNQMGIGAFSAIIMLAMIFSIIIPYLY
FT                   SEIRGGSRP"
FT   gene            complement(673091..674356)
FT                   /locus_tag="BMI_II687"
FT   CDS_pept        complement(673091..674356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II687"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II687"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49808"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIH0"
FT                   /protein_id="ACU49808.1"
FT                   /translation="MHKLLKLAAMGTAACALLAGMAPVANAQEKQNVEVLHWWTSGGEA
FT                   SALEVLKKDLESKGISWTDMPVAGGGGTEAMTVLRARVTAGNAPTAVQMLGFDIRDWAE
FT                   QGALGNLDTVASKEGWEKVIPAPLQEFAKYDGHWIAAPVNIHSTNWMWINKAALDKAGG
FT                   KEPTNWDELIALLDNFKAQGITPIAHGGQPWQDATIFDAVVLSFGPDFYKKAFIDLDPE
FT                   ALGSDTMKQAFDRMSKLRTYVDDNFSGRDWNLASAMVIEGKAGVQFMGDWAKGEFLKAG
FT                   KKPGEDFVCMRYPGTQGAVTFNSDMFAMFKVSEDKVPAQLEMASAIESPAFQSAFNVVK
FT                   GSAPARTDVPDTAFDACGKKAIADVKEANSKGTLLGSMAHGYANPAAVKNAIYDVVTRQ
FT                   FNGQLSSEDAVKELVAAVEAAK"
FT   gene            complement(674851..675099)
FT                   /locus_tag="BMI_II688"
FT   CDS_pept        complement(674851..675099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II688"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49809"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIH1"
FT                   /protein_id="ACU49809.1"
FT                   /translation="MACESASISGARGLENCFSYRRWGVSPRPENKPAHHCASTRKLCT
FT                   DPEFVQRFEEGTQKIYPSGKTHSSTANIINEIRKINI"
FT   gene            675243..675719
FT                   /gene="ribH"
FT                   /locus_tag="BMI_II689"
FT   CDS_pept        675243..675719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="BMI_II689"
FT                   /product="riboflavin synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II689"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49810"
FT                   /db_xref="GOA:C7LIH2"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIH2"
FT                   /protein_id="ACU49810.1"
FT                   /translation="MNQSCPNKTSFKIAFIQARWHADIVDEARKSFVAELAAKTGGSVE
FT                   VEIFDVPGAYEIPLHAKTLARTGRYAAIVGAAFVIDGGIYRHDFVATAVINGMMQVQLE
FT                   TEVPVLSVVLTPHHFHESKEHHDFFHAHFKVKGVEAAHAALQIVSERSRIAALV"
FT   gene            complement(675720..676529)
FT                   /gene="fdhD"
FT                   /locus_tag="BMI_II690"
FT   CDS_pept        complement(675720..676529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD"
FT                   /locus_tag="BMI_II690"
FT                   /product="formate dehydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49811"
FT                   /db_xref="GOA:C7LIH3"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIH3"
FT                   /protein_id="ACU49811.1"
FT                   /translation="MTNQKISRDVHHLAHRMSGFQESSRIVPEEAPIAMSYNGTTQAVM
FT                   MATPGDLEDFAIGFSLTENIVTRIEEIEALDIVAFESGIDIQMKLAKQPEQRLSARRRF
FT                   MAGPVGCGLCGIDSIEQALRPLHPLEECSTTFTTRDIAAAVASLGAAQALNAKTHATHG
FT                   AGFFRPGEGLFAVREDIGRHNALDKLIGAVAREGLLAEEGIVAITSRVSVEMVQKAVML
FT                   GVPVLAAISAPTALAIRTAEAANLTLVALVRDEEFDIYTHCGRIIEG"
FT   gene            676639..676983
FT                   /locus_tag="BMI_II691"
FT   CDS_pept        676639..676983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II691"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49812"
FT                   /db_xref="GOA:C7LIH4"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIH4"
FT                   /protein_id="ACU49812.1"
FT                   /translation="MEIRQIDDNYSVTGQINPDDVRDIAAEGFQTIICNRPDGEGGEEQ
FT                   PDFEEIARVAEKAGLAAYYIPVVGGQLTQENVDDMAAALAEAEGPVLAYCRSGARSTNI
FT                   YGIVQNQKRG"
FT   gene            complement(677053..677454)
FT                   /locus_tag="BMI_II692"
FT   CDS_pept        complement(677053..677454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II692"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49813"
FT                   /db_xref="GOA:C7LIH5"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIH5"
FT                   /protein_id="ACU49813.1"
FT                   /translation="MVAGLSVVRNDLNWMMETMLTSQQWLPVELLNIGLAAAVFFACLV
FT                   HSLWKAVFDELNPVFWRRTAALLWAGVVIVALTGGMDTFNWPQALGWLLVAGGVCATVW
FT                   RAGMGYYRQYCAHNSHGLHARRTRLSSGR"
FT   gene            complement(677632..679401)
FT                   /locus_tag="BMI_II693"
FT   CDS_pept        complement(677632..679401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II693"
FT                   /product="iron compound ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II693"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49814"
FT                   /db_xref="GOA:C7LIH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIH6"
FT                   /protein_id="ACU49814.1"
FT                   /translation="MGNAGVVKHRRCDIERLMAETVAVPESKTLRPPRAGRAWLWLSAV
FT                   VTVLVLFPVLALALEALQGSAGLWSHLAFTTLPAAFADTVILLSGVGLIAAVLGTSMAW
FT                   LVTAYDFRGRAVLEWALLLPLAVPTYIIAYAYLDLLHPVGPVQGAVRFLLGYDSPRQFR
FT                   LPDIRSMGGCIVLLGFVLYPYVYIPTRAMFLTQSASLIEAARTLGVSRKGIFWRVALPL
FT                   ARPAVAVGVSLALMETLNDVGAAEFLGVRTLTVSIYTTWITRSDLPGAAQLALALLFLV
FT                   VALVSIERWARRKQRFASNIRHSRGFDPLKVSGFHGAWLFCLCAIPVMIGFVLPAFYLA
FT                   VEAIKRMRFAGISLRLAGEALNTVALASVATVLVLICGMLVAYAVRLFPAAFSRWCYRF
FT                   STMGYAAPGTVIAIGILVVSGGFDRLLNQFTMQFFGFSAGLVLIGTGAAVVYAYVVRFL
FT                   AISAGGIDAGLERIPLSLDHASRTLGRSVTETFRAVHLPLSRTAIVAAGLLVFVDCVKE
FT                   LPATLLLRPLNVETFATHLYGEAARGTYEEASIAALAIVITGILPVILLARVGRRLGRK
FT                   EKLSAPQGPVRAG"
FT   gene            complement(679422..680438)
FT                   /locus_tag="BMI_II694"
FT   CDS_pept        complement(679422..680438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II694"
FT                   /product="iron compound ABC transporter, periplasmic iron
FT                   compound-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II694"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49815"
FT                   /db_xref="GOA:C7LIH7"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIH7"
FT                   /protein_id="ACU49815.1"
FT                   /translation="MSIIARSALALVAVTLVTGAAHADEVNLYTTREPGLIQPLLDAFK
FT                   SSTGITVNTVFLKDGLAERVASEGENSPADILMTVDAGNLVDLKDKGLTQPIDSKVLKE
FT                   AVPAQLRDADGDWYALSMRARVVYADKDMEIDKITYEELSDPKWKGKICIRAGQHPYNT
FT                   ALFADYIAHHGVAKTEEWLAGLKANLARKAAGGDRDGAKDIVGGICDLAVANSYYVGLM
FT                   RSGKGGEDQKVWGEGIKVLLPTFQGGGTQVNISGAAVAKHAPHKEEAVKLLEYLVSDEA
FT                   QQIYAKANYEYPVKPGAPLDPIVESFGELKIDTVPLSEIVSHRKQASELVDKVGFDN"
FT   gene            complement(680563..681665)
FT                   /pseudo
FT                   /locus_tag="BMI_II695"
FT                   /note="putative iron compound ABC transporter, ATP-binding
FT                   protein pseudogene"
FT   gene            681902..683230
FT                   /locus_tag="BMI_II696"
FT   CDS_pept        681902..683230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II696"
FT                   /product="D-amino acid oxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II696"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49816"
FT                   /db_xref="GOA:C7LIH8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIH8"
FT                   /protein_id="ACU49816.1"
FT                   /translation="MGPITDKVATAESLPQETRIAIIGGGVIGVSTALFLAERGIPVTL
FT                   FEKGEIAGEQSSRNWGWCRRTGRDSREMPLIVESMRLWEGMNARTGRETGFRVKGIVYA
FT                   AEKEEQMARYAEWIKIARQHGIETHLLNGEQAEALAPGLTRRLAGGMSTPLDGRAEPQK
FT                   AVPAMAAKAQEDGAVILQNCAVRGIETTNGRVSAVLTEKGRVRCEAVVVAGGAWSRLFI
FT                   SGFKAHLPQLKVRSSVFRTAPIEGGVEPAIAFSDFALRKRLDGGYTVASLSGSIADIVP
FT                   DSFRFFRDFIPSLSTEWRSLRFRLGERFFEEAFQWKLRPADQMSIFEKIRTLDPAPHHT
FT                   ANVQVLAQLKKAIPAFAPAVIAQEWAGLIDTMPDIIPVISPLPGVEGLIVATGFSGHGF
FT                   GIGPGAGRLVADMVCNETPLVDPSPFHISRFSDGTKIRIENWE"
FT   gene            complement(683488..684009)
FT                   /gene="sodC"
FT                   /locus_tag="BMI_II697"
FT   CDS_pept        complement(683488..684009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="BMI_II697"
FT                   /product="superoxide dismutase, Cu-Zn"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II697"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49817"
FT                   /db_xref="GOA:C7LIH9"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIH9"
FT                   /protein_id="ACU49817.1"
FT                   /translation="MKSLFIASTMVLMAFPAFAESTTVKMYEALPTGPGKEVGTVVISE
FT                   APGGLHFKVNMEKLTPGYHGFHVHENPSCAPGEKDGKIVPALAAGGHYDPGNTHHHLGP
FT                   EGDGHMGDLPRLSANADGKVSETVVAPHLKKLAEIKQRSLMVHVGGDNYSDKPEPLGGG
FT                   GARFACGVIE"
FT   gene            complement(684286..685890)
FT                   /locus_tag="BMI_II698"
FT   CDS_pept        complement(684286..685890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II698"
FT                   /product="multicopper oxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II698"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49818"
FT                   /db_xref="GOA:C7LII0"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:C7LII0"
FT                   /protein_id="ACU49818.1"
FT                   /translation="MTGITRRRLLALGASAACVAALRPLGAFAQDAHQHMRHGAVDAPV
FT                   LKAPPLPLPPLVEPDASGIVRLKVQKGRHSFAKGSTAASAGINGAYLGPLVRLMSGESV
FT                   TLSVENAMDEETTLHWHGLFVPSHLDGGPHNVIAPGAKWEPKVAVNQPASFNWFHPHLH
FT                   GHTARQAHMGIAGLMIVRDGKDAERGLPETYGVDDLPLVLQDRRVIEGDAVYAPDIMDL
FT                   IHGFRGDWLIVNGAIAPEARVPAAMVRLRLLNGANARNFHIRFADGRPLLVIASDGGFI
FT                   SQPVSIEQLTISPGERYEVLVDFSNGEAVDLVTYGDNGSGDGLHLMRFAVDPALEGRVA
FT                   KPPVSLDGPAAPDEKLSVQRRSFFFDERMAENMKLMMRQPSSNPHASGDDMDHMEMGSM
FT                   AGMDHDMHGSRSAADAGPALDALTSGVQMAIADKPFDMERIDVEAKLGSWEIWELTSRE
FT                   MAHPFHIHGASFRILSMNGKKPPAHQTGWKDTALIDGKAEILVHFDREAARSHPFMFHC
FT                   HLLEHEDVGMMAQFVTV"
FT   gene            complement(685950..686345)
FT                   /locus_tag="BMI_II699"
FT   CDS_pept        complement(685950..686345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II699"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49819"
FT                   /db_xref="UniProtKB/TrEMBL:C7LII1"
FT                   /protein_id="ACU49819.1"
FT                   /translation="MSFVKRDIGVRMTARGHAVLRLPSRAVVLLFSLLFLVSAQLCYGM
FT                   AHDMPPREAAWDCHMNKPQAKTPQPVEHGAKAPNMCVMMACGGIVRPAGGFSTCAPAQD
FT                   FGLPPLVSALSGSNPHGVLRPPIVLHA"
FT   gene            686599..687879
FT                   /locus_tag="BMI_II700"
FT   CDS_pept        686599..687879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II700"
FT                   /product="major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49820"
FT                   /db_xref="GOA:C7LII2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7LII2"
FT                   /protein_id="ACU49820.1"
FT                   /translation="MTVAEAVAPQANSVRRVLTASMIGTTIEFFDFYIYATAAVIVFPH
FT                   LFFPASDGNSALLQSFATFAIAFFARPVGAAIFGHFGDKIGRKATLVAALMTMGLSTVA
FT                   IGFLPTYASIGVAAPLLLALCRLGQGLGLGGEWGGAVLLATENAPEGKRTWYGMFPQLG
FT                   APAGFILATGIFLLLAETMTEEQFFAYGWRVPFIASAILVAVGLFIRLRIAETPEFQKA
FT                   IDKAERVAVPAAQLFRHHKMNLFLGTIGTMATFVLFYLMTVFSLGWGTRALGYSREEFL
FT                   VLQMIGVIFFGLTIPLSALLSDRYGMRTIMVIVTVLIGLYGFIMAPLFAAGTAGVLGFL
FT                   IIGFGLMGMTYGPIGAVLAEPFPTSVRYTGASLAFNLAGILGASLAPYIATWLATDYGF
FT                   AYVGYYMVAAAIISLIGFVFITLKDKK"
FT   gene            complement(687957..688484)
FT                   /gene="ahpD"
FT                   /locus_tag="BMI_II701"
FT   CDS_pept        complement(687957..688484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpD"
FT                   /locus_tag="BMI_II701"
FT                   /product="alkyl hydroperoxide reductase D"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II701"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49821"
FT                   /db_xref="GOA:C7LII3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004674"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C7LII3"
FT                   /protein_id="ACU49821.1"
FT                   /translation="MSIDDLKSKIPDFAKDVRLNLSSMASDETLTPQQKYGLFVACGIA
FT                   SRNADVRKALVAEAAGKVDASVIQAAKAAASIMGMNNVYYRFVHLASNKDYRTMPARLR
FT                   MNVISNPGVDKVDFELWSLAVSAINGCGMCIDAHEDVLRKANVTAEAIQAAVRFASIIQ
FT                   SAAIALEAADTE"
FT   gene            complement(688564..689118)
FT                   /gene="ahpC"
FT                   /locus_tag="BMI_II702"
FT   CDS_pept        complement(688564..689118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="BMI_II702"
FT                   /product="alkyl hydroperoxide reductase C"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II702"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49822"
FT                   /db_xref="GOA:C7LII4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7LII4"
FT                   /protein_id="ACU49822.1"
FT                   /translation="MLGIGDKLPSFKVTGVKPGFNHHEENGVSAFEEVTEQSFPGKWKV
FT                   IFFYPKDFTFVCPTEIAEFARLASEFEDRDAVVLGGSTDNEFVKLAWRRDHKDLNKLPI
FT                   WSFADTNGSLVDGLGVRSPDGVAYRYTFVVDPDNVIQHVYATNLNVGRAPKDTLRVLDA
FT                   LQTDELCPCNREVGGETLKAA"
FT   gene            689275..690180
FT                   /locus_tag="BMI_II703"
FT   CDS_pept        689275..690180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II703"
FT                   /product="transcriptional regulator OxyR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II703"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49823"
FT                   /db_xref="GOA:C7LII5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LII5"
FT                   /protein_id="ACU49823.1"
FT                   /translation="MLNISVRQLHYFLALVQAGSFSRAAEAIGVTQSTLSAAIQALEAE
FT                   LGATLIDRTGRRMQMLPAGEDFLARARDIVALIEELPEHARQAERPLTTRLRMGVIPSI
FT                   APFLLPKVLPATAKAFPELQLTVREGLTRSLLESLRSGTLDVALVAHPYDLDEFEIAEI
FT                   GRDPFLLAVRRDHALANRDSVEASDIDDQPFLLLETGHCLREHVMAAIGSKPAQMSGDV
FT                   HATSIMTLVQLVQFGMGVTLLPQLAIKAGVTRGTDLSVVPYEGKYNFRSLVLAWRTNAA
FT                   RRNEFQLFANHLRSNCLQDV"
FT   gene            complement(690210..691277)
FT                   /locus_tag="BMI_II704"
FT   CDS_pept        complement(690210..691277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II704"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49824"
FT                   /db_xref="InterPro:IPR011670"
FT                   /db_xref="InterPro:IPR021068"
FT                   /db_xref="UniProtKB/TrEMBL:C7LII6"
FT                   /protein_id="ACU49824.1"
FT                   /translation="MAYDLNNLPLEAFFVPVSAATAALARLDERLARSPIRDGMVQRLH
FT                   MHDAVASMWVEGELVHMEDLVLHDALMDSRTPSHALTIAHGVLRMRRQIASRAASWALS
FT                   PAGMQQLLGRPLEAFAPRDAERPETDEDDPLLDDIDALLARTDALLEGIAANRRKPEAV
FT                   PRDQLLYDDDWDEDARLQEWRDCCAATADLPPLLRAAIMHDAWFSLEVVQRSAWVGRLL
FT                   TAAFLRQSGLAANHLPAISLGLRNKRPDERRSSNRVVRLKTFLAAIEEAAEAIMKEHDR
FT                   LMLAREQMQRKLKGRRSNSRLPQLMELILRTPLVSSQLVEKELQVTQQGALKLIGELNL
FT                   REITGRGRFRAWGIL"
FT   gene            complement(691375..692379)
FT                   /gene="idhA"
FT                   /locus_tag="BMI_II705"
FT   CDS_pept        complement(691375..692379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idhA"
FT                   /locus_tag="BMI_II705"
FT                   /product="myo-inositol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II705"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49825"
FT                   /db_xref="GOA:C7LII7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7LII7"
FT                   /protein_id="ACU49825.1"
FT                   /translation="MVTRLALLGAGRIGKVHAGAIASDRRARLVAVADANEDAAKAIAD
FT                   ASGAQVRSIDEIERASDVDAVLICTPTNTHADLIERFARAGKAVFCEKPIDLDIARVHA
FT                   CLAVIRETGAKVMLGFNRRFDPHFVAVRKAIDDGRIGKVEMVTITSRDPGAPPADYIKV
FT                   SGGIFRDMTIHDFDMARFLLGEEIESVAASASVLVDPKIGELGDYDSASVILTTASGRQ
FT                   CVISNSRRASYGYDQRIEVHGSLGAVSAENQRPVSIEIASKDGYNRPPLHDFFMTRYTA
FT                   AYAAEIGAFIDALDSGKAPMPSAEDGLKALALAEAALRSVKEGRTVKVAEILP"
FT   gene            692613..693383
FT                   /locus_tag="BMI_II706"
FT   CDS_pept        692613..693383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II706"
FT                   /product="SIS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II706"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49826"
FT                   /db_xref="GOA:C7LII8"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7LII8"
FT                   /protein_id="ACU49826.1"
FT                   /translation="MLEVADRLPKRLKQCADYVAANQDRIAVSTVAEMAEGAGVQSSAF
FT                   MRFCQILGFSGFSEMQRLFRETYAGGWPDYSTRLLHLRETAAGRAPALLAEFAEAGRTS
FT                   LEGLLKTIEPEALEKAVELLASANTIHIIGIRRAFPVASYLAYALEKMAVPAMLHSAVG
FT                   KLENLHAIRKGDVLLAITFSPYSPETIGMTEAVAARGIDVIGITDTIVSPMSKVARQTL
FT                   LVSEVDFGAFRSLSATLCLAIAIAVAVGTARQAG"
FT   gene            693474..695372
FT                   /pseudo
FT                   /locus_tag="BMI_II707"
FT                   /note="myo-inositol catabolism IolC protein pseudogene"
FT   gene            695369..697192
FT                   /gene="iolD"
FT                   /locus_tag="BMI_II708"
FT   CDS_pept        695369..697192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolD"
FT                   /locus_tag="BMI_II708"
FT                   /product="TPP-requiring enzyme IolD"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II708"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49827"
FT                   /db_xref="GOA:C7LII9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:C7LII9"
FT                   /protein_id="ACU49827.1"
FT                   /translation="MKTVRLTAAQALVRYLANQMTPEGDTFIAGVWAIFGHGNVAGLGE
FT                   ALYGAREHMPTWRGHNEQTMAHAAIAYTKQLGRRRACAVTSSIGPGATNMVTAAALAHV
FT                   NRLPVLFVPGDVFANRGPDPVLQQIEDFNDGTMTVNDCFRPVSRYFDRITRPEQLLTAL
FT                   PRAFRTMTDPADCGPVTLAFCQDVQAQAYDWPEEFFTPKVWHWRRPPPDERELETAAAA
FT                   IKTALKPVIVAGGGVHYSGAHEVLRAFVETHGIPVIETQAGKSALPWDHPLNFGPVGVT
FT                   GADSANAVAAEADLVIGVGTRFQDFTTGSWALFRHPGRRLLSLNVQPYDGAKHNSLPLV
FT                   ADAKIGLEALSGAIGAYRRQAVDASLKNRWFAAADRFTAAPSDGNALPTDMQVIGAVQR
FT                   QARENSVVMCAAGTMPGELHQLWKAGRPMSYHMEYGFSCMGYEIAGGLGIKMAEPDRDV
FT                   IVMVGDGSYMMANSELATSIMMGQKITVVVTDNRGFGCINRLQMATGGAEFNNLLDHAA
FT                   HVNPSQIDFAAHAAAMGADAKKVGSIRELEGALAEARDSLRTTVIVIDTDPYPTPETGG
FT                   WWWDVAVPEVSERDEVRAARKNYEAQIKERN"
FT   gene            697196..698098
FT                   /gene="iolE"
FT                   /locus_tag="BMI_II709"
FT   CDS_pept        697196..698098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolE"
FT                   /locus_tag="BMI_II709"
FT                   /product="iolE protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II709"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49828"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIJ0"
FT                   /protein_id="ACU49828.1"
FT                   /translation="MILYGTNPIAWSNDDDRSLGAHITLDQCLDEAAKIGFDGIEKGHK
FT                   FPQEAAALKAVLEPRGLRYVSGWHSLNLLVNSVEEEKAAMQPALDLLKAMGSKVIIVCE
FT                   TSNAIHGDNDKPLQERPVLEDARWEAFGLGVEALAAHAAAQGITLVYHHHMGTIVETED
FT                   EIDRLMRFTGPHTRLLLDTGHCLFGRGNPERVAQKHIARVGHIHAKNIRRDIVQDVRDQ
FT                   NLSFLEGVRRGVFTVPGDTEGSVDFVPVLKIAAEHGYQGWLVIEAEQDPDVRNPFEYQS
FT                   LGLKSLKAFAREAGLDKGV"
FT   gene            698102..698911
FT                   /gene="iolB"
FT                   /locus_tag="BMI_II710"
FT   CDS_pept        698102..698911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolB"
FT                   /locus_tag="BMI_II710"
FT                   /product="myo-inositol catabolism protein IolB"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49829"
FT                   /db_xref="GOA:C7LIJ1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIJ1"
FT                   /protein_id="ACU49829.1"
FT                   /translation="MPDLLRKPKGTNGKVHDITPESAGWGYVGFGLYRLKAGESAAEKT
FT                   GAREVILVLVEGKAEISASGEAFGEMGERMSVFEKLPPHCLYVPAESEWSATATTDCVL
FT                   AVCTAPGKPGRKAQKLGPEGLTLEQRGKGANTRFIHNIAMEGRDVADSLLVTEVFTPQG
FT                   NWSSYPPHRHDEDSFPDMTYLEETYYHRLNPAQGFGFQRVFTEDGSLDETMAVADGDVV
FT                   LVPKGHHPCGAPYGYEMYYLNVMAGPLCKWRFKNHPDHDWIFKRDNP"
FT   gene            complement(698942..699743)
FT                   /pseudo
FT                   /locus_tag="BMI_II711"
FT                   /note="inositol monophosphatase family protein pseudogene"
FT   gene            complement(699764..700825)
FT                   /locus_tag="BMI_II712"
FT   CDS_pept        complement(699764..700825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II712"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II712"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49830"
FT                   /db_xref="GOA:C7LIJ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIJ2"
FT                   /protein_id="ACU49830.1"
FT                   /translation="MTAIRPGSVTFENVTKKFGNFTALPNLSLTVEPGTLVTLLGPSGC
FT                   GKTTTLRLLAGLEHPTSGRILIGGKDVTNLPANERDVSMVFQSYALFPHMTSLENVAYG
FT                   LESSGFKKNEARERAEEGLKLVGLGGMGHRLPAELSGGQQQRVAVARALVLEPQVLLLD
FT                   EPLSNLDARLRRRVRTEIRELQQRLGFTAVYVTHDQDEALAVSDTIIVMKEGGIAQKGS
FT                   PRDLYEAPASAFIADFMGEANVVPCEVISAENGEAVIRVAGLTHRVPARNAQPGPAQLA
FT                   IRPNAVTLQPQAGGGFSGTVAHSAYLGDHIEYEIETEHGKLFIVDPAVEQSLPLQTDVS
FT                   IQFKTRGLAIINQ"
FT   gene            complement(700822..703047)
FT                   /locus_tag="BMI_II713"
FT   CDS_pept        complement(700822..703047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II713"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II713"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49831"
FT                   /db_xref="GOA:C7LIJ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIJ3"
FT                   /protein_id="ACU49831.1"
FT                   /translation="MTQHNRRLDAVLAIALIAFALLPWYRIEDGFLHFSWIEVLFSESA
FT                   EAPGILQIFVFGRSWIGAIALLMLICAVARFFLPVGKRSGVLIAASLVGFIFLALQGLA
FT                   IGFSGWNWTISETLFGPLSDGQPSFGAGAILTGLCFLLIFSFGLAERGVMKGDAFVVSS
FT                   ITLLVALVGVFVFYPVLSMFVGSVQDFDGSFNPDGFIGNIQDSSIWSLACVVGEGRCGV
FT                   AWRTLWLALMTATGSTILGLAFALVATRTNFPFKKGLRLLTILPIITPPFVVGLALTLL
FT                   FGRAGVVTEQISSLFGVEPGRWLYGLTGIWIAQVLSFTPISFLVLIGVVEGVSPSMEEA
FT                   SQTLRADRWRTFKRVSLPLMAPGLANAFLIAFIESMADFGNPMVLGGSHGVLSTEIFFA
FT                   VVGAQNDTSRAAVLAIVLLCFTLSAFLVQRLWLSGKNFATVTGKGDSGIHAGLPRGLKI
FT                   GVYALVIPWMFFTVVVYVMILVGGFVRQWGLDNSLTLEHYARAFSVSWTDGGLAWTGVA
FT                   WNSFWTTMEISLMSAPLTAAVGLLTAYLIVRQRFVGRNVFEFALMLSFAIPGTVIGVSY
FT                   IMAFNLPPLEMTGTALILIACFVFRNMPVGVRGGIAAMSQLDRSLDEASLTLRAGSFRT
FT                   IRKVILPLLRPAITAALVYSFVRAITSISAVIFLVSAQYNMATAYIVGLVENGEFGVAI
FT                   AYSSMLIVVMVVVITSFQLLVGERRLRRENRVAAAAPVKSVRQEKTA"
FT   gene            complement(703182..704207)
FT                   /locus_tag="BMI_II714"
FT   CDS_pept        complement(703182..704207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II714"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II714"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49832"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIJ4"
FT                   /protein_id="ACU49832.1"
FT                   /translation="MRSAFMVAALAAGVSSFAFSAQAAGNLNLICSADVVICEQMKNMF
FT                   EKDTGIKVNMVRLSSGETYAKVRAEARNPKTDIWWAGTGDPHLQAASEGLTLEYKSPML
FT                   DQLNDWAKKQAESSGFRTVGVYAGALGWGYNTDIFAKKNLKEPKCWADLLDPSYKGEIQ
FT                   MANPNSSGTAYTALATLVQIMGEDKAFDYLKKLNANVSQYTKSGSAPVKSAARGETGIG
FT                   IVFMHDAVAMTADGFPIKSVAPCEGTGYEIGSMSIIKGAKNLENAKKWYDWALTAEVQS
FT                   HMKDAKSFQLPSNKSAEVPKESPRFEDIKLIDYDFKTYGEPAKRKELLERWDKEVGAVA
FT                   N"
FT   gene            complement(704437..708120)
FT                   /locus_tag="BMI_II715"
FT   CDS_pept        complement(704437..708120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II715"
FT                   /product="proline
FT                   dehydrogenase/delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II715"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49833"
FT                   /db_xref="GOA:C7LIJ5"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIJ5"
FT                   /protein_id="ACU49833.1"
FT                   /translation="MTDNIPVSKVAVFQNFAPPIREQSALRQAITAAYRRPEAECVSAL
FT                   AEQATLPEETRQQIRSTARKLIEALRAKHKGTGVEGLVHEYSLSSQEGVALMCLAEALL
FT                   RIPDMATRDALIRDKISNGDWKSHIGGGRSLFVNAATWGLVVTGKLTNTVNDRGLSAAL
FT                   TRLIARCGEPVIRRGVDMAMRMMGEQFVTGETIDEALKRAKELEERGFRYSYDMLGEAA
FT                   TTAADAERYYKDYETAIHAIGRASAGRGIYDGPGISIKLSALHPRYTRAQSERVMGELL
FT                   PKVKALAAIAKSYNIGLNIDAEEADRLELSLDLLQSLCEDPDLAGWDGIGFVVQAYGKR
FT                   CPFVLDFIIDLARRTKRRVMVRLVKGAYWDAEIKRAQVDGLEDFPVYTRKVHTDVSYIA
FT                   CARKLLAATDVIFPQFATHNAQTLATIYHLAGPDFKTGKFEFQCLHGMGEPLYDEVVGP
FT                   EKLGRPARIYAPVGTHETLLAYLVRRLLENGANSSFVNRIGDKNVSVDELIADPVEVVR
FT                   SMAVVGARHDQIALPENLYGARRNSAGFDLSNEVTLAELSKTLKETAGRAWTAEPQVAG
FT                   AKVKGVSRPVLNPGDRNDVVGTVTEIAEADVAKAMKAAQTATTSWSAVAPAERAACLER
FT                   AADIMQRDMPALLGLVMREAGKSMPNAIAEVREAIDFLRYYAEQTRRTLGVGHKALGPV
FT                   VCISPWNFPLAIFTGQIAAALVAGNPVLAKPAEETPLIAAEGVRILHEGGIPADALQLL
FT                   PGDGRIGAALVAAPETCGVMFTGSTEVARLIQAQLASRLLPNGKPVPLIAETGGQNAMI
FT                   VDSSALAEQVVFDVIASAFDSAGQRCSALRVLCLQEDVADRILTMLKGALRELSIGRTD
FT                   QLKVDIGPVITDEAKNTIEKHIQAMRDLGRKVEQLPLGPETQNGTFVAPTIIEIESLRD
FT                   LKREVFGPVLHVVRYKRDDMESLIDDINSTGYGLTFGLHTRLDETIANVADRIRVGNIY
FT                   INRNIIGAVVGVQPFGGRGLSGTGPKAGGPLYLGRLVETAPIPPRHASVHTDAALKDFA
FT                   RWLGNRGMNDLAQAARDTGSASALGLELELPGPVGERNLYALHPRGRVLLVPQTEIGLY
FT                   RQLTAVLATGNTAVIDEACGLRAVLKDLPETVAARAIWTGDWQADAPFAGALIEGDSAR
FT                   IKEVNSRIAALPGPLVLTQAASPEDLAANQDAYCLNWLLEEVSTSINTTAAGGNASLMA
FT                   IG"
FT   gene            708283..708777
FT                   /locus_tag="BMI_II716"
FT   CDS_pept        708283..708777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II716"
FT                   /product="proline dehydrogenase transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II716"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49834"
FT                   /db_xref="GOA:C7LIJ6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIJ6"
FT                   /protein_id="ACU49834.1"
FT                   /translation="MRKIDSLDDMDQFDRRILEVLSEDGRIPVTELSKRVGLSKTPCQA
FT                   RLKRLVDEGYILGFRAAIDPEKLGLDHIAFTTVKLSDTREAALEAFNVAVRKIREVEEC
FT                   HMIASSFDYLLKVRTPNIRRYREVLGEKISSLPNVASTSTFVVMESVKDNRPVRVYPGA
FT                   L"
FT   gene            complement(708784..709020)
FT                   /locus_tag="BMI_II717"
FT   CDS_pept        complement(708784..709020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II717"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II717"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49835"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIJ7"
FT                   /protein_id="ACU49835.1"
FT                   /translation="MALSAFGSRNRRVSRSVSGRAKRKTRNDFHWIVDRAAPVLTESPE
FT                   PLYLFVFSHFWLENALGCRDEWKCFRTACRKLL"
FT   gene            complement(709832..712630)
FT                   /gene="gcvP"
FT                   /locus_tag="BMI_II718"
FT   CDS_pept        complement(709832..712630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="BMI_II718"
FT                   /product="glycine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II718"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49836"
FT                   /db_xref="GOA:C7LIJ8"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIJ8"
FT                   /protein_id="ACU49836.1"
FT                   /translation="MTEFLPFVARHIGPRHEDERAMLAALGLPSMETLITQAVPASIRL
FT                   NRALNLPAALSEADALAELGTIMGRNVVKKSFIGAGYHGVHTPPVIQRNLFENPAWYTA
FT                   YTPYQSEISQGRLELLFHFQTLVAELTGLPVACASLLDEATAVAEAIGVACRHHRDKRS
FT                   RILLAGELHPQTVDVVNTRAEPLGWEIATGSDVDDNTAAIVVPWPDTRGVYGDFAKVIA
FT                   DAKAKGALVIAVADPLALTIMEAPARWGADMAVGSMQRYGVPMGFGGPHAAYLAVSEAL
FT                   TRIIPGRIVGQSVDAHGRAAYRLALQTREQHIRRDKATSNICTAQALLANMAAAFAIWH
FT                   GPAGLQAIATRVAALAARFAAALKAAGVEIAGESLFDTVTAKVPGKAAAIAAEADKGGR
FT                   LIRIIDADTVGVTFDETSTEEDLTALASLFGAKPVGGDTVLVPGKERGEGFLTQEVFHS
FT                   HRSETEMMRFLRRLADKDLALDRAMIPLGSCTMKLNAAAEMMPVSWNTVANLHPFAPAE
FT                   QVQGYAKMTSDLEAWLCEITGFAGVSLQPNAGSQGEYAGLMAIRHYHQARGQGHRNICL
FT                   IPSSAHGTNPASASMAGMSVVVVNCRPDGDIDIDDLKAKAEKHRDNLAAFMITYPSTYG
FT                   VFEEGIKAFCEIVHDNGGQVYFDGANLNALVGLARPADIGADVCHMNLHKTFCIPHGGG
FT                   GPGVGPIGVAKHLVPYLPGHVEAGSEHAVAAAQFGSASILVITWMYIRMMGGAGLKKAT
FT                   EAAILNANYIAHRLKGVYPILYTGAHDRVAHECIVDTRVLKDSAGITVEDVAKRLIDYG
FT                   FHAPTMSWPVAGTLMIEPTESEPKLEIDRLCDAMIAIAGEAKKVADGVWPADDNPLANA
FT                   PHTASDTLATEWKHPYTREEAVFPGGAFDPTAKYWPPVSRVDNVGGDRNLICSCPPVAA
FT                   YG"
FT   gene            complement(712635..713003)
FT                   /gene="gcvH"
FT                   /locus_tag="BMI_II719"
FT   CDS_pept        complement(712635..713003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="BMI_II719"
FT                   /product="glycine cleavage system protein H"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II719"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49837"
FT                   /db_xref="GOA:C7LIJ9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIJ9"
FT                   /protein_id="ACU49837.1"
FT                   /translation="MANILFTEDHEWINVENGVATVGITIHAQEQLGDLVFVELPEVGR
FT                   TVAKGDGVVVVESVKAASDVYAPVDGEVVEVNDAVASDPSLINQAAEGEGWLFKLKLAD
FT                   EGQLTGLLDKAGYEKLIG"
FT   gene            complement(713009..714112)
FT                   /gene="gcvT"
FT                   /locus_tag="BMI_II720"
FT   CDS_pept        complement(713009..714112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="BMI_II720"
FT                   /product="glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49838"
FT                   /db_xref="GOA:C7LIK0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIK0"
FT                   /protein_id="ACU49838.1"
FT                   /translation="MGDTAHLNTLPLQDLHEKAGARFGGFAGWNMPITYPLGVMKEHLH
FT                   TRDHAGLFDISHMKLVEVSGADAAALLAETCPLDPTILKTGQSKYTFFLNDNGGVLDDL
FT                   IVTRLGEDRFMVVANAGNADADIEHLNEAASGKAVKVNPLDRVFLALQGPEAEAVITDA
FT                   GLPGADLAFMSGFEPKQGWFMTRSGYTGEDGFEIGLPADEARALAEKLLADERVEWIGL
FT                   AARDSLRLEAGLCLHGQDITPETDPVSAGLTWAITKAVREKAAFNGAKAVLDAIAKGAS
FT                   AKRVGLKPEGRQPVRAGADLFDESGRQIGTVTSGGFGPSAGFPVAMGYVEASLATPGTR
FT                   VFADVRGNKVPVDVHALPFTPHRYRKG"
FT   gene            714754..714912
FT                   /locus_tag="BMI_II721"
FT   CDS_pept        714754..714912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II721"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49839"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIK1"
FT                   /protein_id="ACU49839.1"
FT                   /translation="MVRKMNLIRSYNNWRRYRNTVNELSRLSPRELNDLGILPSEIPFV
FT                   ARKAAAR"
FT   gene            complement(715085..716314)
FT                   /locus_tag="BMI_II722"
FT   CDS_pept        complement(715085..716314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II722"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II722"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49840"
FT                   /db_xref="GOA:C7LIK2"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIK2"
FT                   /protein_id="ACU49840.1"
FT                   /translation="MDDRCIIIGAGHAGSQAAVSLRQEGYAGEIILINDETDIPYHKPP
FT                   LSKSYLKAPEKGSLVLRPESAYRDNNIEMLFGAHVDAVSIAERTVTLGDGRVLPWSELV
FT                   FATGARARIPDVLGVALEGVVTLRRMEDARRIAAMMPDVRNVVIIGGGFIGLEMAHSAI
FT                   ALGKKTVLIEAAPRVLGRSVAAPVSAHVEARSRAADITLLTGLGVASIEGENGRAIGVT
FT                   AGDGTFFPADLVVIGTGAVPNVELAAKAGLSIDNGIRVDEHMRTSAPHVYAIGDCASYA
FT                   HFHAGRHVRLESVQNATDQAKHVARTIVGRETPYREVAWFWSDQGDMKLQTAGLSFDAD
FT                   RHVLSGEPEENAFSVFHFKGDRLVAVDSINRPADHMIARRLLAAGISPSEADIMAGMPR
FT                   LKELLAVVAR"
FT   gene            complement(716426..717370)
FT                   /locus_tag="BMI_II723"
FT   CDS_pept        complement(716426..717370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMI_II723"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMI_II723"
FT                   /db_xref="EnsemblGenomes-Tr:ACU49841"
FT                   /db_xref="GOA:C7LIK3"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7LIK3"
FT                   /protein_id="ACU49841.1"
FT                   /translation="MLRFFHLCAIADYLIRPMIFCQTQFAQNWKRAAGMETAAPMSASV
FT                   AELINERIDAMPAGERSAAQMLIANYPMLGLKTVAEFSTQAGVSSPTILRFVNRLGFQS
FT                   YPDFQARLQDELAAQLQSPHHRNEQPDKRPDAADPGVEHTLENIRETFRHLGEKQLHQV
FT                   VASLSLAKGNVYLIGGRFTDPIAQYMTAHMSIVRARVFHLGGQESMWRDR